Navigation:	Title:	Summary:
Start page 782505	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳sandwich 4098	Restaurants, Cafés & Takeaway Food	These listings feature establishments offering prepared food for immediate consumption, including dine-in, takeaway, and delivery options.
↳sandwich + Sandwiches 284	Sandwich Shops And Lunchrooms	These listings feature establishments offering a variety of sandwiches, wraps, and related lunch items for dine-in, takeaway, or delivery. Many locations also serve complementary products such as salads, snacks, smoothies, and beverages.

284 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
paninomigusta.nl	Paninomigusta	Paninomigusta.nl is an online platform offering an Italian espresso bar experience, focusing on fresh sandwiches, panini, coffee, wine, and Italian delicacies.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	espresso 131 panini 156 coffee 3838 sandwich 4098 wine 4476
lunchdepartment.nl	LUNCHDEPARTMENT	The website of LUNCHDEPARTMENT is a foodtruck that offers lunch, diner, and catering services with a diverse menu of sandwiches and wraps.	Fast Food → Burgers 687 Quick Bites → Food Trucks 623	wrap 826 sauce 1141 salad 2444 sandwich 4098 catering 6456	North-Holland → Uithoorn 940
bonappetitrijssen.nl	Bon Appetit Rijssen	The website of Bon Appetit Rijssen presents the culinary possibilities of the company, primarily aimed at catering for businesses, organizations and individuals.	Fast Food → Fries 949 Lunch → Sandwiches 466	buffet 1747 salad 2444 snack 2916 sandwich 4098 catering 6456 assortment 7799	Rijssen-Holten → Rijssen 1048
boriman.nl	BORIMAN	The website of BORIMAN showcases a Surinamese sandwich shop specializing in freshly prepared sandwiches and drinks, with a particular focus on Surinamese flavors and a nostalgic sales cart.	Lunch → Sandwiches 466 Sandwiches & Salads → Sandwich Shops 229	surinamese 41 sandwich 4098 catering 6456
wouwdasnbroodje.nl	Wouw Da’s ‘n Broodje”	"Wouw Da’s ‘n Broodje” is a bakery in Zundert offering unique sandwiches inspired by the various neighborhoods of the region.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	neighborhood 2424 store 3901 sandwich 4098 menu 13856	North-Brabant → Zundert 756
vertruckelijk.nl	VerTruckelijk	VerTruckelijk Almere is a foodtruck and catering business that delivers and picks up fresh sandwiches, lunch dishes, and smoothies in Almere.	Lunch → Sandwiches 466 Quick Bites → Food Trucks 623	fillings 42 smoothie 384 lunch 1534 sandwich 4098 catering 6456	Flevoland → Almere 7765
rustburcht.nl	Café Restaurant Rustburcht	Café Restaurant Rustburcht is a restaurant in Rotterdam-South offering a diverse menu and monthly specials.	Lunch → Sandwiches 466 Cafes → Dutch Restaurants 1031	specials 65 salad 2444 sandwich 4098 dish 5936 menu 13856	Rotterdam → Feijenoord 477
lebkov.nl	Lebkov & Sons	Lebkov & Sons is a small business focused on providing high-quality, homemade food and coffee.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	cappuccino 32 juice 207 soup 1043 coffee 3838 sandwich 4098
brood-meer.nl	Brood en Meer	The website of Brood en Meer presents the shop, online ordering options, and the offerings of Bakkerij Wiercx, and provides a freshly prepared lunch with filled sandwiches and coffee.	Dairy & Cheese → Specialty Food Stores 64	bakery 718 pastries 946 lunch 1534 coffee 3838 sandwich 4098 shop 6483	Geertruidenberg → Raamsdonksveer 418
westwal.nl	Tankstation Westwal	Tankstation Westwal is a shop and gas station located on the Westwal in Urk that offers bread, car wash services, fuel, gas, and accessories.	Lunch → Sandwiches 466 Fuel & Energy → Gas Stations 249	gas station 252 wash 254 gas 434 trailer 1624 sandwich 4098	Flevoland → Urk 762
josefs.nl	Josef	The website www.Josefs.nl is an online shop selling gourmet sandwiches, cured meats, and cheese, with a focus on Austrian products.	Lunch → Sandwiches 466 Wholesale → Foodstuffs 64	cured meats 32 cheese 1205 bread 1622 sandwich 4098
maryjanemaastricht.nl	Coffeeshop Mary Jane	Coffeeshop Mary Jane Maastricht is a coffeeshop and merchandise store located in Maastricht, Netherlands, offering coffee, food, and related products.	Bakery & Food Production → Bread 765 Gifts → Gift Cards 981	cappuccino 32 merchandise 1061 coffee 3838 food 3872 sandwich 4098	Limburg → Maastricht 6008
dezeeuwsebroodjesservice.nl	The Zeeuwse Broodjesservice	The Zeeuwse Broodjesservice is a sandwich shop in Middelburg that offers delivery service across Walcheren.	Lunch → Sandwiches 466 Foodservice & Catering → Catering 390	fish 1121 cheese 1205 meat 2055 sandwich 4098 drink 5191	Zeeland → Middelburg 2342
broodjes-catering.nl	Mobile Chef	The website offers lunch and sandwich catering services for both private and business events, with delivery in the Utrecht region and nationally.	Lunch → Sandwiches 466 Foodservice & Catering → Catering 390	lunch 1534 sandwich 4098 catering 6456	North-Holland → Amsterdam 41253
gasterijdekoffiemolen.nl	Gasterij De Koffiemolen Valkenburg	Gasterij De Koffiemolen Valkenburg is a café and restaurant offering breakfast, lunch, drinks, and other meals.	Lunch → Sandwiches 466 Fine Dining & Gastronomy → Dining 677	tea 1146 snack 2916 sandwich 4098 drink 5191 menu 13856	Valkenburg aan de Geul → Valkenburg 922
snack77.nl	Snack77 Goes	Snack77 Goes is a cafeteria and sandwich express in Goes that offers online ordering, delivery, and takeaway options, as well as catering services for businesses and events.	Fast Food → Fries 949 Lunch → Sandwiches 466	hamburger 364 fries 2753 snack 2916 sandwich 4098 catering 6456	Zeeland → Goes 1899
hilverenbeek-kusadasi.nl	Kusadasi Hilvarenbeek	The website Kusadasi Hilvarenbeek offers an online ordering system for food and drinks, with an extensive menu of sandwiches, appetizers, main courses, and vegetarian options.	Lunch → Sandwiches 466 Sandwiches & Salads → Appetizers 40	plate 787 sauce 1141 salad 2444 sandwich 4098	North-Brabant → Hilvarenbeek 843
123broodje.nl	123broodje	The website 123broodje.nl provides an online platform where users can easily order and have bread and sandwich selections delivered, as well as catering for lunches and meetings.	Lunch → Sandwiches 466	bakery 718 lunch 1534 sandwich 4098 catering 6456 assortment 7799	Krimpenerwaard → Berkenwoude 62
cateringaanhuis.nl	CateringAanHuis	CateringAanHuis.nl is a website that provides a platform for easily ordering and delivering various catering services, including snacks, sandwiches, buffets, and beverages.	Catering → Buffets 277 Sandwiches & Salads → Appetizers 40	buffet 1747 snack 2916 sandwich 4098 drink 5191 catering 6456
mech.nl	Mech Make & Take Amsterdam	The Mech Make & Take Amsterdam website is an online platform where customers can order dishes and snacks for delivery. It offers a menu with various dishes, such as club sandwiches and salads, and promotes deals and discounts.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	promotion 2062 sandwich 4098 app 4595 menu 13856	North-Holland → Amsterdam 41253
delifrance036.nl	Delifrance Almere	The Delifrance Almere website offers lunch and catering services, including delivery and pick-up of sandwiches, lunch boxes, and other meals, targeting businesses and individuals in Almere and the surrounding area.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	lunchboxes 41 smoothie 384 bread 1622 sandwich 4098 catering 6456	Flevoland → Almere 7765
kebabhuisdemolen.nl	De Molen	The website of De Molen offers online ordering for a wide variety of dishes, including sandwiches, döner, pizzas and charcoal specialties, in the city of Haaksbergen.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	shawarma 335 kapsalon 509 döner 673 plate 787 sandwich 4098 pizza 4158	Overijssel → Haaksbergen 887
broodje.nl	Broodje.nl	The website offers online ordering and delivery of sandwiches, salads, fruit and pastries for home or work.	Food Delivery → Delivery 2227	pastries 946 fruit 1166 breakfast 1822 salad 2444 sandwich 4098	Leusden → Stoutenburg 41
panosbreda.nl	Panos Breda	The Panos Breda website is a bakery in Breda that sells and delivers sandwiches, filled sandwiches, and baguettes.	Food Delivery → Delivery 2227 Sandwiches & Salads → Sandwich Shops 229	baguette 35 fillings 42 bread 1622 sandwich 4098 shop 6483	North-Brabant → Breda 9003
nellies-saloon.nl	Nellie's Saloon	Nellie's Saloon is a café in Balkbrug that serves upscale sandwiches and drinks in a cozy atmosphere, inspired by country music and a cowboy theme.	Tea & Coffee → Cafes 2491	saloon 10 country 530 visitors 1048 sandwich 4098 drink 5191 atmosphere 5591	Hardenberg → Balkbrug 220
hemelsebroodjes.nl	Hemelse Broodjes	The website of Hemelse Broodjes presents the company, its bread mixes, catering options, delivery service, and opening hours, with a focus on using local products and providing good service.	Lunch → Sandwiches 466	local products 71 lunch 1534 sandwich 4098 catering 6456 menu 13856	North-Brabant → Etten-Leur 1366
broodjedaan.nl	Broodje Daan	Broodje Daan is a sandwich shop offering traditional sandwiches and lunchboxes, with options for takeaway and delivery.	Lunch → Sandwiches 466 Sandwiches & Salads → Prepared Foods 39	sandwich shop 14 lunchbox 50 filling 121 coffee 3838 sandwich 4098 drink 5191
sandwichbar68-dronten.nl	Sandwich Bar 68	Sandwich Bar 68 is an online ordering platform for food in Dronten, where visitors can view a menu and order meals online.	Lunch → Sandwiches 466	lahmacun 93 kapsalon 509 fries 2753 sandwich 4098 drink 5191	Flevoland → Dronten 1667
sameninzeist.nl	Samen in Zeist	Samen in Zeist is a cozy lunch and coffee location in Zeist offering a diverse range of dishes, including sandwiches, salads, and smoothies, often featuring authentic regional products.	Lunch → Sandwiches 466	smoothie 384 regional products 391 salad 2444 sandwich 4098	Utrecht → Zeist 2644
pinguinzwolle.nl	Cafetaria de Pinguin	The Pinguin Zwolle website showcases the menu and offers of the cafeteria, emphasizing quick takeaway options and a wide variety of sandwiches, snacks, and meals.	Lunch → Sandwiches 466 Sandwiches & Salads → Snacks 693	takeaway 653 meal 1638 fries 2753 sandwich 4098 drink 5191 menu 13856	Overijssel → Zwolle 7395
grillpointzeist.nl	Grill Point Zeist	The Grill Point Zeist website offers the possibility to order sandwiches, wraps, panini, and hamburgers online, with various promotions and discounts. It is an official online ordering platform and provides access to menus, reviews, and newsletters.	Fast Food → Burgers 687 Fast Food → Burger Restaurants 346	wrap 826 promotion 2062 reviews 3172 sandwich 4098 menu 13856	Utrecht → Zeist 2644
boulevardnederland.nl	Tao Food Concepts	The Boulevard is a restaurant and takeaway establishment in Amsterdam specializing in brioche sandwiches, poké bowls, and hot dogs.	Lunch → Sandwiches 466	loyalty program 78 poke bowl 308 sandwich 4098 catering 6456 menu 13856	North-Holland → Amsterdam 41253
broodje-horeca.nl	Broodje Horeca	The website of Broodje Horeca in Nijmegen presents a sandwich shop offering a wide selection of sandwiches and dishes, with an emphasis on fresh ingredients and quality.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	toppings 153 ingredients 2346 salad 2444 sandwich 4098 drink 5191 dish 5936	Gelderland → Nijmegen 9384
shellvankalmthout.nl	Servicestation van Kalmthout	The website of Servicestation van Kalmthout offers a wide range of services including fuel, sandwiches, salads, trailer rentals, and promotions, with the option to order online and pick up.	Lunch → Sandwiches 466	payment terminal 14 gas station 252 car wash 352 trailer 1624 promotion 2062 sandwich 4098
broodjegesmeerd.nl	Catering Broodje Gesmeerd	The website of Catering Broodje Gesmeerd in Utrecht offers the possibility to order assorted sandwiches, appetizers, tapas and buffets for various occasions, including office lunches, gatherings, and events.	Lunch → Sandwiches 466	filling 121 smoothie 384 sandwich 4098 catering 6456 event 45199	Netherlands → Utrecht 48901
kapsalon-king.nl	Kapsalon King	The website of Kapsalon King Almere provides the ability to order online and view a digital menu.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	dessert 496 döner 673 hair salon 717 burger 1431 sandwich 4098 menu 13856	Flevoland → Almere 7765
itspurelunch.nl	It’s Pure Lunch	It’s Pure Lunch is an online service that delivers lunches and sandwiches in Den Bosch and surrounding areas, primarily targeting organizations and businesses.	Lunch → Sandwiches 466 Human Resources → Employee Benefits 245	points 612 wrap 826 lunch 1534 sandwich 4098	's-Hertogenbosch → Rosmalen 1059
de-kaaswaag.nl	De Kaaswaag	De Kaaswaag is a shop in Berkel en Rodenrijs offering a wide selection of cheese, meat products, nuts, delicatessen, and sandwiches.	Lunch → Sandwiches 466 Dairy → Cheese 530	delicatessen 147 meat products 272 nuts 417 gift package 530 cheese 1205 sandwich 4098	Lansingerland → Berkel and Rodenrijs 929
hizmetbakkerij.nl	Hizmet Bakkerij	The Hizmet Bakkerij website showcases its selection of fresh bread, baklava, and Döner bread, all baked and sold in their Eindhoven bakery.	Turkish Cuisine → Turkish Restaurant 458 Quick Bites → Cafeteria 906	baklava 49 döner 673 bread 1622 sandwich 4098	North-Brabant → Eindhoven 11845
astebleef.nl	Astebleef	Astebleef is a catering company and sandwich shop in Venlo offering fresh and flavorful food.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	soup 1043 arrangement 3104 sandwich 4098 catering 6456	Limburg → Venlo 4158
lunchbus.nl	The Lunchbus	The Lunchbus is a company that delivers breakfasts, lunches, and snacks, and provides catering for events.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	buffet 1747 sandwich 4098 drink 5191 assortment 7799 event 45199	Haarlemmermeer → Nieuw-Vennep 869
baltusvolendam.nl	Baltus Volendam	Broodjeszaak Baltus Volendam is a local sandwich shop that accepts online orders and offers delivery.	Lunch → Sandwiches 466	sandwich 4098 shop 6483	Edam-Volendam → Volendam 948
croissanteriethefifties.nl	Croissanterie The Fifties	The website of Croissanterie The Fifties is a catering service and lunchroom located in Appingedam, with a nostalgic atmosphere and an extensive menu.	Lunch → Sandwiches 466 Cafes & Lunch → Lunchroom 446	tea 1146 lunch 1534 sandwich 4098 catering 6456 menu 13856	Eemsdelta → Appingedam 427
amsterdamsbroodjeshuis-groningen.nl	Amsterdam's Broodjeshuis	The website Amsterdam's Broodjeshuis from Groningen offers the possibility to order food online, with a focus on sandwiches, wraps, and side dishes.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	kapsalon 509 wrap 826 fries 2753 sandwich 4098 drink 5191	North-Holland → Amsterdam 41253
mevrouwknarie.nl	Meneer & Mevrouw K. Narie	The website of Meneer & Mevrouw K. Narie presents a foodtruck service offering delicious drinks, pastries, and snacks, with a focus on regional products and sustainability.	Lunch → Sandwiches 466 Chocolate & Sweets → Ice Cream 774	cappuccino 32 foodtruck 613 snack 2916 sandwich 4098 sustainability 18451	Purmerend → Zuidoostbeemster 79
broodjesbarjos.nl	Broodjesbar JOS	Broodjesbar JOS is a sandwich bar and restobar serving local products in a welcoming environment.	Lunch → Sandwiches 466 Bars & Pubs → Bars 1938	local products 71 sandwich 4098 atmosphere 5591 menu 13856	Limburg → Maastricht 6008
hakzecatering.nl	Hakze Catering	Hakze Catering is a caterer, bakery, ice cream shop, and cafe located in Amersfoort, offering various meals and dishes.	Lunch → Sandwiches 466 Tea & Coffee → Tea Rooms 229	caterer 47 ice cream 1000 lunch 1534 sandwich 4098 terrace 4847 menu 13856	Utrecht → Amersfoort 8011
restaurant-holiday.nl	Holiday Duiven	The Holiday Duiven website provides an online ordering service for meals and sandwiches in the city of Duiven. Users can view a menu and place orders for delivery.	International → Turkish 416 Food Delivery → Delivery 2227	saloon 10 salad 2444 sandwich 4098 pizza 4158 dish 5936	Gelderland → Duiven 851
bijtanken.nl	Tankservice Haarhuis	The Bijtanken.nl website is an online shop and bakery of Tankservice Haarhuis that sells freshly filled sandwiches, snacks, and baked goods, with the option to order online and pick up.	Lunch → Sandwiches 466	bakery 718 pickup 736 sandwich 4098 order 6912 assortment 7799
belgischebroodjesbar.nl	Belgian Bread Bar	The Belgian Bread Bar in Valkenswaard offers authentic Belgian sandwiches that can be ordered online or by phone.	Lunch → Sandwiches 466 Bars & Pubs → Bars 1938	ham 40 sauce 1141 cheese 1205 sandwich 4098 menu 13856	North-Brabant → Valkenswaard 1179
subwayoldenzaal.nl	Subway Oldenzaal	The Subway Oldenzaal website offers online ordering for sandwiches, wraps, and other meals, with options for pickup or delivery. The website also presents the menu with various sandwich types and other products.	Lunch → Sandwiches 466 Accommodation → Breakfast 364	wrap 826 bread 1622 sandwich 4098 order 6912 menu 13856	Overijssel → Oldenzaal 1219
eat-out.nl	ORADO	Eat-Out is a company that specializes in preparing and selling artisanal, freshly filled sandwiches.	Lunch → Sandwiches 466	sausage 256 curry 355 roll 358 rice 635 coffee 3838 sandwich 4098
ayo-gorinchem.nl	Ayo De Surinaamse Snackbar Gorinchem	The website of Ayo De Surinaamse Snackbar Gorinchem provides the opportunity to order various Surinamese dishes such as roti, sandwiches, and snacks online and have them delivered to your home.	Food Delivery → Surinamese 265	roti 303 satay 320 sandwich 4098 app 4595 dish 5936 menu 13856	South-Holland → Gorinchem 1947
medina-gorinchem.nl	Medina	The Medina website, located in Gorinchem, offers online ordering for a wide variety of dishes, including wraps, boxes, sandwiches, pizzas, and salads.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	wrap 826 box 1982 salad 2444 sandwich 4098 pizza 4158	South-Holland → Gorinchem 1947
broodjesservicewestland.nl	Broodjesservice Westland	The Broodjesservice Westland website offers a sandwich service and various other catering options, including salads, soups, sweets, and snacks, for pickup or delivery within the Westland region.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	lunch package 24 salad 2444 snack 2916 sandwich 4098 order 6912	Westland → Naaldwijk 903
eethuissphinx.nl	Grillroom Sphinx	Grillroom Sphinx is an online store offering a variety of dishes and sandwiches, including pizzas, hair salons, and various grill combinations, and providing delivery services.	Lunch → Sandwiches 466 Mediterranean & Middle Eastern → Takeout 286	grill 562 hair salon 717 sandwich 4098 pizza 4158	Beekdaelen → Amstenrade 72
nieuwegeinsecateringcompany.nl	Nieuwegeinse Catering Company	The Nieuwegeinse Catering Company offers catering services for lunch, breakfast, and events, providing a wide range of menu options including buffets, sandwiches, and salads.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	filling 121 buffet 1747 salad 2444 sandwich 4098 catering 6456	Utrecht → Nieuwegein 2264
broodjekato.nl	Kato	The Kato website is an authentic Dutch sandwich shop located in Haarlem, offering traditional sandwiches with various fillings, with options for pickup and delivery.	Lunch → Sandwiches 466 Dairy → Cheese 530	specialty 229 cheese 1205 sandwich 4098 menu 13856	North-Holland → Haarlem 8674
deliciousbarendrecht.nl	Delicious Traiteur	Delicious Traiteur is a catering service that offers weekly meals, sandwiches, salads, delicatessen, beverages and gift packages, with a focus on convenience and organizing festive occasions and home dinners.	Supermarkets & Grocery → Butchers 747 Dairy & Cheese → Delicatessens 617	delicatessen 147 gift package 530 meal 1638 salad 2444 sandwich 4098 catering 6456
sandwichcorner.nl	Sandwich Corner	The Sandwich Corner website provides information about the restaurant, its menu, opening hours, contact details, and online ordering options.	Sandwiches & Salads → Sandwich Shops 229	sunday 208 specialty 229 salad 2444 sandwich 4098	South-Holland → Rotterdam 25048
awa-velp.nl	AWA	The website of AWA in Velp offers the possibility to order meals online from an extensive menu.	Lunch → Sandwiches 466 Cafes → Dutch Restaurants 1031	falafel 108 spareribs 213 kebab 276 kapsalon 509 plate 787 sandwich 4098	Rheden → Velp 700
jongmanmarsdijk.nl	Jongman Marsdijk	The website of Jongman Marsdijk is an online menu and information center for the Snackbar & Broodjeshuis in Marsdijk, where visitors can view the menu items and available drinks.	Fast Food → Fries 949 Lunch → Sandwiches 466	fries 2753 snack 2916 sandwich 4098 drink 5191 menu 13856	Assen → Marsdijk 27
kaatjejans-breda.nl	Kaatje Jans Breda Noord	The website Kaatje Jans Breda Noord offers the possibility to order meals online from Breda. It presents a menu with various sandwiches, wraps, paninis, and pizzas.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	snack box 39 smoothie 384 tapas 465 wrap 826 sandwich 4098 pizza 4158	North-Brabant → Breda 9003
caterfood.nl	Caterfood	Caterfood is a company that provides sandwiches, lunches, soups, snack platters, and luxury lunch boxes for delivery, with the option for custom catering solutions for events and meetings.	Lunch → Sandwiches 466 Cafes & Lunch → Deli 23	snack platters 17 lunchboxes 41 soup 1043 sandwich 4098 catering 6456	Renkum → Oosterbeek 604
groenteboerbeijers.nl	Beijers Groente & Fruit	The website of Beijers Groente & Fruit is an online presentation of a family business specializing in the sale of fresh vegetables and fruit, as well as various meal and sandwich options in the Deurne area.	Lunch → Sandwiches 466 Produce & Vegetables → Vegetables 1070	family business 793 fruit 1166 vegetables 1416 meal 1638 salad 2444 sandwich 4098	North-Brabant → Deurne 1329
happyhapvancello.nl	Happy Hap of Cello	The website for Happy Hap of Cello is an online platform where customers can order sandwiches, salads, and wraps for lunch or another occasion.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	pickup 736 wrap 826 salad 2444 sandwich 4098 order 6912	Oisterwijk → Haaren 255
alexandria-online.nl	Alexandria Bennebroek	The website Alexandria Bennebroek offers the online possibility to order meals, including pizzas, sandwiches, plates and salads, with delivery to your home.	Lunch → Sandwiches 466 Sandwiches & Salads → Salads 133	plate 787 salad 2444 sandwich 4098 pizza 4158 drink 5191	Bloemendaal → Bennebroek 247
eethuiswijchen-wijchen.nl	Eethuis Wijchen	The Eethuis Wijchen website offers online ordering for dishes and snacks, focusing on Turkish and Dutch cuisine including pizzas, döner kebabs, and various sandwiches and snacks.	Turkish Cuisine → Fast Food 3222	snack box 39 kapsalon 509 döner 673 plate 787 fries 2753 sandwich 4098	Gelderland → Wijchen 1579
stationnekeoisterwijk.nl	Broodjesservice ’t Stationneke	The website of Broodjesservice ’t Stationneke presents a bakery and sandwich shop in Oisterwijk, offering freshly made sandwiches, drinks and coffee, and providing delivery services to businesses and other locations.	Sandwiches & Salads → Prepared Foods 39 Sandwiches & Salads → Sandwich Shops 229	baguette 35 station 420 coffee 3838 sandwich 4098 terrace 4847	North-Brabant → Oisterwijk 1422
broodjebenfranchise.nl	Broodje Ben	The website of Broodje Ben presents franchise opportunities for ambitious entrepreneurs interested in running a bread shop based on a successful formula.	Lunch → Sandwiches 466 Food & Beverage → Franchising 254	fillings 42 franchise 284 formula 287 sandwich 4098 shop 6483
vrije-gasten.nl	Vrije-Gasten Amersfoort	Vrije-Gasten Amersfoort is a company offering fresh sandwiches, healthy smoothies, and flexible lunch solutions, including pick-up, delivery, and business options.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	lunchboxes 41 smoothie 384 pickup 736 sandwich 4098
debezorgkantine.nl	De Bezorgkantine	De Bezorgkantine is a lunch delivery service specializing in prepared sandwiches, salads, and soups for businesses.	Lunch → Sandwiches 466 Food Delivery → Surinamese 265	price list 201 sandwich 4098 order 6912	North-Brabant → Best 978
desmaakhalte.nl	The Smaak-Halte	The Smaak-Halte is a bakery in Borne that offers freshly baked sandwiches and a business lunch service.	Lunch → Sandwiches 466 Local & Regional Focus → Local Businesses 1077	lunchbox 50 sourdough 91 artisan 94 flavor 1032 ingredients 2346 sandwich 4098	Overijssel → Borne 812
sinbad-online.nl	Sinbad	The website of Sinbad allows customers to order a variety of pizzas, sandwiches and other dishes online, including shawarma, doner kebab and grilled items. Delivery is available.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	toppings 153 shawarma 335 sandwich 4098 pizza 4158 dish 5936	Drenthe → Assen 3516
willemientje.nl	Brasserie Willemientje	The website of Brasserie Willemientje presents the menu, atmosphere, and services of the brasserie, emphasizing healthy and diverse dishes and catering options.	Lunch → Sandwiches 466 Brasseries & Bistros → Brasserie 1005	soup 1043 ingredients 2346 salad 2444 sandwich 4098 recipe 5142 catering 6456
broodjemeppel.nl	BroodjeMeppel	The website BroodjeMeppel.nl offers a sandwich service to businesses in the Meppel region, with delivery within a 15-kilometer radius.	Lunch → Sandwiches 466 Foodservice & Catering → Catering 390	sandwich 4098 order 6912 menu 13856	Drenthe → Meppel 1903
broodjeco-arnhem.nl	Broodje & Co	The website of Broodje & Co in Arnhem offers the possibility to order online.	Lunch → Sandwiches 466	panini 156 sauce 1141 ingredients 2346 salad 2444 sandwich 4098 drink 5191	Gelderland → Arnhem 8680
cafetariajasmijn.nl	Cafetaria Jasmijn	The website of Cafetaria Jasmijn in Almelo presents the menu, specials, and delivery options of the cafe, which distinguishes itself through homemade fries and high-quality snacks.	Fast Food → Fries 949 Lunch → Sandwiches 466	promotion 2062 fries 2753 snack 2916 sandwich 4098 menu 13856	Overijssel → Almelo 2696
croissanterieparisleeuwarden.nl	Croissanterie Paris	The website of Croissanterie Paris presents the bakery and its menu, as well as its location in Leeuwarden. It offers information about opening hours, the possibility of takeaway orders and the availability of gift vouchers.	Lunch → Sandwiches 466	toppings 153 gift voucher 548 bread 1622 sandwich 4098 menu 13856	Friesland → Leeuwarden 6068
debroodjesbox.nl	The Broodjesbox	The Broodjesbox website allows customers to order fresh sandwiches and snacks online or by phone.	Lunch → Sandwiches 466 Quick Bites → Snack Bar 580	snack 2916 sandwich 4098 account 5781 order 6912	Overijssel → Almelo 2696
hemels-eindhoven.nl	Hemels Eindhoven	The website aims to allow customers to order food online from Hemels Eindhoven in Eindhoven.	Turkish Cuisine → Fast Casual 16	chicken fillet 35 soft drinks 87 milkshake 195 soup 1043 sandwich 4098	North-Brabant → Eindhoven 11845
cafetariadeknuistboom-oisterwijk.nl	Cafetaria de Knuistboom	Cafetaria de Knuistboom is a cafeteria in Oisterwijk that accepts online orders for a wide range of dishes, including plates, fries, snacks, sandwiches, and drinks.	Quick Bites → Cafeteria 906 Meal Solutions → Food Store 11	plate 787 fries 2753 snack 2916 sandwich 4098 drink 5191	North-Brabant → Oisterwijk 1422
broodjezuid.nl	Broodje Zuid	The website of Broodje Zuid informs visitors about the cessation of the bread service and offers alternative takeaway options.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	lunchboxes 41 bread 1622 salad 2444 sandwich 4098 catering 6456	Gelderland → Arnhem 8680
broodjesservicevrouwenpolder.nl	Broodjesservice Vrouwenpolder	The website Broodjesservice Vrouwenpolder provides an online service for ordering and delivering sandwiches to holiday parks in Zeeland.	Lunch → Sandwiches 466 Accommodation → Holiday Parks 1024	holiday park 566 online shop 1310 sandwich 4098 assortment 7799	Veere → Oostkapelle 205
bijmaranth.nl	BijMaranth	The website of BijMaranth is a lunchroom in Den Helder that offers a variety of food and drinks, including coffee, tea, pastries, sandwiches, and snacks, as well as options for corporate events.	Lunch → Sandwiches 466 Cafes & Lunch → Lunchroom 446	pastries 946 snack 2916 coffee 3838 sandwich 4098 restaurant 11215 event 45199	North-Holland → Den Helder 1886
snackbar-ambrosia.nl	Snackbar Ambrosia	The website Snackbar Ambrosia in Den Helder offers a wide selection of snacks, fries, sandwiches, and drinks, with the option to order online.	Fast Food → Fries 949 Lunch → Sandwiches 466	fries 2753 snack 2916 sandwich 4098 drink 5191	North-Holland → Den Helder 1886
subwayecht.nl	Subway Echt	The Subway Echt website allows customers to order sandwiches and other products online for delivery. It also provides information on the menu, promotions, and customer reviews.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	option 292 points 612 sandwich 4098 order 6912 menu 13856	Echt-Susteren → Echt 454
karpatsjo-enzo.nl	KARPATSJOenzo	The KARPATSJOenzo website offers the possibility to order a wide range of products online, including sandwiches, meat products, dairy products, beverages, salads, desserts and various meals, with delivery option.	Lunch → Sandwiches 466 Chocolate & Sweets → Sweets 257	dessert 496 meal 1638 salad 2444 sandwich 4098 drink 5191	South-Holland → The Hague 19898
oliversfoodtruck.nl	Oliver's Foodtrucks	The website of Oliver's Foodtrucks showcases a menu of sandwiches, burgers, and snacks, emphasizing flame-grilled dishes and fresh ingredients.	Fast Food → Burgers 687 Lunch → Sandwiches 466	sauce 1141 burger 1431 snack 2916 sandwich 4098
bommelsbroodjes.nl	Bommels Broodjes	Bommels Broodjes is a traditional Amsterdam bread shop delivering fresh filled sandwiches, fish and specialties to Amsterdam.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	herring 156 fish 1121 market 2772 sandwich 4098 family 6462	North-Holland → Amsterdam 41253
tankstationheinneman.nl	Shell Heinneman Schildwolde	The website of Shell Heinneman Schildwolde is an online ordering platform for sandwiches, snacks, and drinks, with the option for home delivery.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	snack 2916 reviews 3172 sandwich 4098 newsletter 6504 order 6912 menu 13856	Midden-Groningen → Schildwolde 38
brengmijnlunch.nl	BrengMijnLunch	The website BrengMijnLunch provides businesses with healthy and responsible lunch packages consisting of sandwiches, soups, salads, and smoothies.	Lunch → Sandwiches 466 Nutrition → Healthy Eating 634	lunch package 24 smoothie 384 soup 1043 salad 2444 arrangement 3104 sandwich 4098	Westerkwartier → Leek 642
shoarmaelta.nl	ELTA	The website of ELTA in Oosterwolde provides an online ordering system for a variety of dishes, including sandwiches, meat plates, pizzas, and wraps. It also offers an option to sign up for a newsletter for special promotions.	Lunch → Sandwiches 466	reviews 3172 sandwich 4098 pizza 4158 app 4595 dish 5936 menu 13856	Ooststellingwerf → Oosterwolde 417
gregmonsieur.nl	Greg Monsieur	Greg Monsieur is a food stall located on the Albert Cuyp market in Amsterdam, specializing in toasted sandwiches with various fillings and cheeses.	Quick Bites → Street Food 125	sourdough 91 cheese 1205 market 2772 staff 3405 sandwich 4098	Amsterdam → South 1488
debroodjesgigant.nl	Broodjes Gigant	Broodjes Gigant is a company that delivers sandwiches, wraps, and complete group lunches to homes or offices.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	fillings 42 wrap 826 lunch 1534 sandwich 4098
yankeesstreetfood-groningen.nl	Yankees Streetfood	The Yankees Streetfood website from Groningen allows customers to order street food, smoothies and sandwiches online for delivery.	Quick Bites → Street Food 125	shake 112 smoothie 384 bread 1622 sandwich 4098	Netherlands → Groningen 23734
route-66.nl	My shop	The website is a store that offers sandwiches, sauces and other products.	Lunch → Sandwiches 466 Supermarkets & Grocery → Food Stores 1058	sauce 1141 burger 1431 fries 2753 sandwich 4098 menu 13856	Netherlands → Groningen 23734
stopbroodje.nl	Stopbroodje B.V.	Stopbroodje.nl is a website dedicated to selling fresh, artisan-made sandwiches with unique recipes.	Lunch → Sandwiches 466	sandwich 4098 recipe 5142
brandstoflunchroom.nl	Brandstof Lunchroom	The Brandstof Lunchroom website showcases their lunchroom in Utrecht, offering the option to order online, pick up, or have their food delivered.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	lunchroom 312 pickup 736 coffee 3838 sandwich 4098 order 6912 menu 13856	Netherlands → Utrecht 48901
dailybakerygeleen.nl	Daily Bakery	Daily Bakery is a bakery located in Geleen that offers a variety of filled sandwiches (cold and warm), ‘bake-off’ specials, and other tasty treats.	Lunch → Sandwiches 466	sandwich 4098	Sittard-Geleen → Geleen 978
spareribs-delivery-leidsche-rijn-de-meern.nl	Spareribs Delivery Leidsche Rijn	The website of Spareribs Delivery Leidsche Rijn offers online ordering of various dishes, including sandwiches, spareribs, satays, and burgers.	Fast Food → Burgers 687 Lunch → Sandwiches 466	spareribs 213 satay 320 burger 1431 fries 2753 sandwich 4098 menu 13856	Woerden → Leidsche Rijn 430
snackwagen-brandstof-utrecht.nl	Brandstof Lunchroom	The Brandstof Lunchroom website, located in Utrecht, offers online ordering for a wide range of sandwiches, salads, vegan options, drinks and smoothies. The aim is to provide a simple way to order lunch items online.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	smoothie 384 vegan 508 salad 2444 sandwich 4098 drink 5191 menu 13856
lapepitabyvroegopmaastricht.nl	Vroegop	The website Vroegop facilitates online ordering of sandwiches, sweets, and drinks in Maastricht.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	sweets 229 sandwich 4098 drink 5191	Limburg → Maastricht 6008
broodjesbardekade.nl	Broodjesbar de Kade	Broodjesbar de Kade is a lunchroom and sandwich bar located in Maastricht, offering a variety of sandwiches, lunch dishes, drinks, and breakfast, with options for delivery and catering.	Lunch → Sandwiches 466 Cafes & Lunch → Lunchroom 446	lunchroom 312 breakfast 1822 sandwich 4098 drink 5191 menu 13856	Limburg → Maastricht 6008
oranje-maastricht.nl	Griekse Grillroom pizzeria Oranje	The website of Griekse Grillroom pizzeria Oranje is an online platform allowing visitors in Maastricht to order dishes from their menu, including sandwiches, plates, and pizzas.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	beverage 586 plate 787 sauce 1141 salad 2444 sandwich 4098 pizza 4158	Limburg → Maastricht 6008
dekeukenvandekempen.nl	De Keuken van de Kempen	The Keuken van de Kempen is a catering company that provides sandwiches, lunches, snacks, buffets and BBQ menus.	Lunch → Sandwiches 466 Sandwiches & Salads → Prepared Foods 39	bbq 908 lunch 1534 buffet 1747 ingredients 2346 sandwich 4098 catering 6456	North-Brabant → Eersel 2086
audrys.nl	Audry’s	The website of Audry’s presents the menu, opening hours, and contact information of a company that delivers lunches to businesses and other groups.	Lunch → Sandwiches 466 Catering & Ready Meals → Takeaway 409	lunch package 24 soup 1043 salad 2444 sandwich 4098 drink 5191 menu 13856	Roermond → Swalmen 254
uwlunch.nl	UwLunch	The website 'Uw Lunch Vers Bezorgd!' offers an online service for ordering and delivering lunches and lunchboxes in the Amersfoort, Soest, and Leusden regions.	Catering & Ready Meals → Ready-To-Eat Meals 359	lunchbox 50 lunch 1534 sandwich 4098	Utrecht → Amersfoort 8011
broodjeszaakdeksels.nl	Broodjeszaak Deksels	Broodjeszaak Deksels is an online bread shop in Almelo that offers the opportunity to order meals online.	Fast Food → Fries 949 Lunch → Sandwiches 466	hamburger 364 soup 1043 salad 2444 sandwich 4098 drink 5191 menu 13856	Overijssel → Almelo 2696
shelldewetering.nl	Shell Vissers De Wetering	The website of Shell Vissers De Wetering presents a one-stop shop for both motorists and customers looking for fuel, meals, and services.	Lunch → Sandwiches 466 Fuel & Energy → Gas Stations 249	gas station 252 car wash 352 fuel 424 grill 562 sandwich 4098	Leidsche Rijn → Terwijde De Wetering 26
mikenleut.nl	Mik + Leut	Mik + Leut is a bread and coffee shop located in Boxmeer, offering freshly made sandwiches and coffee.	Lunch → Sandwiches 466 Events → Places 1219	supplier 1725 ingredients 2346 coffee 3838 sandwich 4098 shop 6483	Land van Cuijk → Boxmeer 861
rissebroodjesenzo.nl	Risse Broodjes & Zo	Risse Broodjes & Zo is a webshop offering lunch packages, sandwiches, wraps, fruit, salads, drinks, and snacks for delivery in Spijkenisse and surrounding areas.	Food Delivery → Delivery 2227 Sandwiches & Salads → Prepared Foods 39	lunch package 24 fruit 1166 sandwich 4098 drink 5191 order 6912	Nissewaard → Spijkenisse 1433
grillbar-de-mazzel-weesp.nl	Grillbar De Mazzel	The website of Grillbar De Mazzel in Weesp offers the possibility to order meals online and view the entire menu.	International → Turkish 416 Bars & Pubs → Bars 1938	pita 199 shoarma 254 plate 787 meat 2055 salad 2444 sandwich 4098	Amsterdam → Weesp 1005
vrijevogelbroodjes.nl	The Vrije Vogel Broodjes	The Vrije Vogel Broodjes is a lunchroom and catering service that offers sandwiches, lunch packages, salads and drinks. They also offer delivery services and catering options.	Lunch → Sandwiches 466 Sandwiches & Salads → Sandwich Shops 229	lunch package 24 salad 2444 sandwich 4098 drink 5191 catering 6456	South-Holland → Waddinxveen 1046
kinggrill.nl	King Bbq & Grillrestaurant Apeldoorn	King Bbq & Grillrestaurant Apeldoorn’s official website offers online ordering, delivery, and takeout options.	Lunch → Sandwiches 466 Catering & Ready Meals → European Cuisine 61	mixed grill 27 extras 64 dürüm 97 sandwich 4098 drink 5191 dish 5936	Gelderland → Apeldoorn 6996
butcherbrothers-alkmaar.nl	Butcher Brothers Europaboulevard	Butcher Brothers Europaboulevard is an online ordering platform for food in Alkmaar.	Fast Food → Burgers 687 Lunch → Sandwiches 466	chicken 944 ice cream 1000 sauce 1141 salad 2444 sandwich 4098 dish 5936	North-Holland → Alkmaar 6507
gegrildekip.nl	The Goudhaantje	The Goudhaantje is a mobile food truck selling freshly grilled chicken spit-roasted daily at various locations.	Quick Bites → Food Trucks 623 Events → Places 1219	grill 562 chicken 944 sandwich 4098 menu 13856	Noordwijk → Noordwijkerhout 1099
broadrunners.nl	Broadrunners	Broadrunners is a company that sells cold and warm freshly filled baguettes, Italian balls and flatbreads, and accepts orders.	Lunch → Sandwiches 466 Food & Beverage → Franchising 254	flatbread 14 baguette 35 salad 2444 reviews 3172 concept 3338 sandwich 4098
ciaofoodbar.nl	CIAO foodbar	The website of CIAO foodbar presents a mobile Italian-Mediterranean food truck and catering service that offers delicious sandwiches, Italian tapas and catering on-site, with a focus on authentic flavors and customized options for dietary needs.	Quick Bites → Food Trucks 623 Food Delivery → Italian Restaurant 1040	antipasti 74 foodtruck 613 pasta 1389 truck 1412 sandwich 4098 catering 6456
rotiq.nl	ROTIQ	The ROTIQ website in Driebergen offers an online ordering system for a variety of sandwiches, roti dishes, and other snacks, with options for home delivery and via a mobile app.	Lunch → Sandwiches 466 Mediterranean & Middle Eastern → Takeout 286	roti 303 reviews 3172 sandwich 4098 order 6912 menu 13856
broodjes-denbosch.nl	Broodjes Den Bosch	The Broodjes Den Bosch website offers an online ordering service for fresh sandwiches and lunches, delivered in and around Den Bosch.	Lunch → Sandwiches 466 Food Delivery → Delivery 2227	bread roll 28 lunch 1534 staff 3405 hospitality 3491 sandwich 4098	North-Brabant → 's-Hertogenbosch 8868
broodjesbarfriso.nl	Broodjesbar Friso	Broodjesbar Friso is a sandwich shop located in Terneuzen that offers freshly made sandwiches with various fillings and provides takeaway (for private customers) and delivery (for business customers).	Food Delivery → Delivery 2227 Sandwiches & Salads → Sandwich Shops 229	fillings 42 testimonials 416 takeaway 653 sandwich 4098 menu 13856	Zeeland → Terneuzen 1517
lunchbezorgservicealmere.nl	Saporito Broodjes	Saporito Broodjes is a bread shop in Almere offering sandwiches, lunch boxes, and catering services.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	lunchboxes 41 bread 1622 sandwich 4098 catering 6456	Flevoland → Lelystad 3180
deli-company.nl	Deli Company Amsterdam	The website of Deli Company Amsterdam provides an online ordering system for sandwiches, meals, and snacks with delivery options and a rewards program.	Lunch → Sandwiches 466 Fuel & Energy → Gas Stations 249	reviews 3172 sandwich 4098 app 4595 menu 13856	Ouder-Amstel → Stationsplein 170
lunchlevering.nl	Lunchlevering.nl	Lunchlevering.nl is an online service that delivers fresh lunch products and meal boxes.	Lunch → Sandwiches 466	bowl 482 wrap 826 lunch 1534 salad 2444 sandwich 4098	North-Holland → Amsterdam 41253
detempelhaarlem.nl	De Tempel	De Tempel is a restaurant in Haarlem offering a variety of sandwiches, meals, and snacks.	Lunch → Sandwiches 466 International → Turkish 416	lamb 100 shoarma 254 chicken 944 sandwich 4098 pizza 4158	North-Holland → Haarlem 8674
dikbelegd-purmerend.nl	Dik Belegd Purmerend	The website of Dik Belegd Purmerend allows customers to order sandwiches, lunch boxes, and other dishes online for delivery.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	lunchboxes 41 sandwich 4098 app 4595 menu 13856	North-Holland → Purmerend 2620
tankshopelsendorp.nl	Tankshop de Witte	Tankshop de Witte in Elsendorp is a gas station that also offers sandwiches and various other products and fuels.	Lunch → Sandwiches 466 Fuel & Energy → Gas Stations 249	gas station 252 fuel 424 bakery 718 sandwich 4098	Gemert-Bakel → Elsendorp 59
gulfenschede.nl	Gulfenschede	The website Gulfenschede.nl is an online shop and gas station offering freshly made sandwiches, juice, smoothies, hot snacks and coffee, with the option for online ordering and takeaway/delivery.	Lunch → Sandwiches 466 Fuel & Energy → Gas Stations 249	juice 207 gas station 252 bakery 718 snack 2916 sandwich 4098 order 6912	Overijssel → Enschede 5554
eetcafe-mangerie.nl	Eetcafé Mangerie	Eetcafé Mangerie is a café in Sneek that accepts online orders for a diverse menu of fries, sandwiches, snacks, and drinks.	Quick Bites → Snack Bar 580 Quick Bites → Cafeteria 906	shoarma 254 plate 787 fries 2753 snack 2916 sandwich 4098 drink 5191	Southwest-Friesland → Sneek 1921
enjoy15.nl	Enjoy15	The website of Enjoy15 presents a new and trendy concept that combines various hospitality venues into one location: an espresso bar, lunchroom, juice bar, and catering company.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	espresso bar 33 lunchroom 312 tea 1146 sandwich 4098 catering 6456
beersebroodjes.nl	Beerse Broodjes	Beerse Broodjes is an online shop offering sandwiches, bread and salads to customers in the East and West Brabant region.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	salad 2444 sandwich 4098 drink 5191	Moerdijk → Zevenbergschen Hoek 669
cafetariacharlyarnhemseweg-apeldoorn.nl	Cafetaria Charly Arnhemseweg	The website of Cafetaria Charly in Apeldoorn offers the opportunity to place online orders for a wide range of snacks, fries, sandwiches, and other dishes. The goal is to serve customers with a simple and fast way to order their favorite meals.	Fast Food → Burgers 687 Lunch → Sandwiches 466	combo meal 65 sauce 1141 fries 2753 snack 2916 sandwich 4098 menu 13856	Gelderland → Apeldoorn 6996
broodjesexpresszoetermeer.nl	Broodjes Express Zoetermeer	Broodjes Express Zoetermeer is a company that delivers and picks up fresh sandwiches in Zoetermeer.	Lunch → Sandwiches 466 Hospitality → Suppliers 1057	payment 1389 sandwich 4098 order 6912 menu 13856	South-Holland → Zoetermeer 4046
samyssandwiches.nl	Samy’s Sandwiches	Samy's Sandwiches is a sandwich shop specializing in the creation and delivery of high-quality, freshly made sandwiches for both individuals and businesses and events in the Den Haag, Leiden and surrounding area.	Lunch → Sandwiches 466 Sandwiches & Salads → Prepared Foods 39	filling 121 bread 1622 sandwich 4098 menu 13856 event 45199	South-Holland → Wassenaar 1372
bakkerij-ogur.nl	Bakkerij Ogur	The website of Bakkerij Ogur in Nieuwegein offers an online ordering system for sandwiches, mixed grills, Turkish pizzas, and other dishes, with the option of home delivery and a downloadable mobile app for faster ordering.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	mixed grill 27 discounts 795 sandwich 4098 app 4595 menu 13856	Utrecht → Nieuwegein 2264
30ml-rotterdam.nl	30ml Rotterdam Centrum	30ml Rotterdam Centrum is an online ordering platform for food in Rotterdam.	Lunch → Sandwiches 466	sweet 22 juice 207 breakfast 1822 sandwich 4098	South-Holland → Rotterdam 25048
babylongrillroom-panningen.nl	Babylon Grillroom	The Babylon Grillroom website in Panningen offers an online ordering system for a comprehensive menu of pizzas, sandwiches, dishes, and beverages.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	toppings 153 beverage 586 sandwich 4098 pizza 4158 dish 5936	Peel and Maas → Panningen 373
baguette-express-delifrance-zwolle.nl	Délifrance Zwolle	The website Délifrance Zwolle offers an online ordering system for the meals and snacks available in the store in Zwolle. Visitors can view the menu and place their order online.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	salad 2444 sandwich 4098 order 6912 menu 13856	Overijssel → Zwolle 7395
bakkerij-nieuwendijk.nl	Bakkerij Nieuwendijk	The website Bakkerij Nieuwendijk allows customers to order food online, offering a variety of dishes including pizzas, Turkish cuisine, wraps and sandwiches.	Lunch → Sandwiches 466 Fast Food → Döner 238	shawarma 335 döner 673 sandwich 4098 pizza 4158 menu 13856	Altena → Nieuwendijk 123
bakkerijhesseplacerotterdam.nl	Bakkerij Hesse Place	The Bakkerij Hesse Place website offers online ordering of various dishes, including sandwiches, Turkish pizzas, fries, döner boxes, and pastries, focused on the city of Rotterdam.	Lunch → Sandwiches 466 Quick Bites → Cafeteria 906	baklava 49 döner 673 fries 2753 sandwich 4098 drink 5191	South-Holland → Rotterdam 25048
bakkerijoostlaan-pijnacker.nl	Bakkerij Oostlaan Pijnacker	The website Bakkerij Oostlaan Pijnacker offers the possibility to order meals and various products, including sandwiches, pizzas, wraps, and more, online for pickup in Pijnacker.	Bakery & Food Production → Bread 765 Food Delivery → Delivery 2227	kapsalon 509 döner 673 wrap 826 sandwich 4098 pizza 4158	Pijnacker-Nootdorp → Pijnacker 788
bakkiespizzagrill-lelystad.nl	Bakkie's Pizza & Grill	The website Bakkie's Pizza & Grill from Lelystad offers the possibility to order pizzas, sandwiches, and other dishes online and view the menu.	Lunch → Sandwiches 466 International → Turkish 416	grill 562 plate 787 salad 2444 fries 2753 sandwich 4098 pizza 4158	Flevoland → Lelystad 3180
bemabroodjes.nl	BeMa Catering	BeMa Catering is a catering company that offers sandwiches, drinks and event organization, and provides delivery services for individuals and businesses.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	bread 1622 sandwich 4098 drink 5191 catering 6456 event 45199
bestelyummy.nl	Yummy Wok & Broodjes Amsterdam	The Yummy Wok & Broodjes Amsterdam website is an online platform where visitors can order wok dishes, sandwiches, and other treats for delivery or takeaway.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	side dish 118 wok 231 sandwich 4098 newsletter 6504 order 6912 menu 13856	North-Holland → Amsterdam 41253
big-mama-sate.nl	Big Mama Saté	The website Big Mama Saté in Barneveld allows customers to order meals online, including satay dishes, sandwiches, and other beverages and desserts.	Lunch → Sandwiches 466 Food Delivery → Indonesian 502	satay 320 dessert 496 beverage 586 sandwich 4098 order 6912 menu 13856	Gelderland → Barneveld 2781
blond-to-go-kerkrade.nl	Blond To Go	Blond To Go is an online ordering platform for food and sandwiches in Kerkrade.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	filling 121 wrap 826 soup 1043 salad 2444 sandwich 4098 drink 5191	Limburg → Kerkrade 1031
bodrum-schoonhoven.nl	Pizzeria Bodrum	The website Pizzeria Bodrum offers online ordering for a wide range of dishes, including Turkish pizzas, sandwiches, and various doner and kapsalon variations, with delivery options available.	Lunch → Sandwiches 466 Fast Food → Döner 238	doner 131 kapsalon 509 pasta 1389 fries 2753 sandwich 4098 pizza 4158	Krimpenerwaard → Schoonhoven 544
booonrotterdam.nl	Booon	The Booon website is an online platform where customers in Rotterdam can order food.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	sourdough bread 25 toastie 45 dessert 496 salad 2444 sandwich 4098 drink 5191	South-Holland → Rotterdam 25048
brasserie-restaurant-la-vache.nl	Brasserie Restaurant La Vache	The website of Brasserie Restaurant La Vache in Veendam allows customers to view the menu online and place orders for meals, lunch boxes and other dishes.	Lunch → Sandwiches 466 Brasseries & Bistros → Brasserie 1005	lunchboxes 41 sauce 1141 bread 1622 sandwich 4098 dish 5936	Groningen → Veendam 896
break-fast-dinteloord.nl	Break & Fast Dinteloord	The Break & Fast Dinteloord website offers the possibility to order sandwiches and other delicacies online and have them delivered. It also presents a menu, customer reviews, and a newsletter subscription.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	salad 2444 reviews 3172 sandwich 4098 menu 13856
broodje-euro-amersfoort.nl	Broodje Euro Amersfoort	The website of Broodje Euro Amersfoort provides an online ordering platform for sandwiches, drinks, and other treats in Amersfoort. The aim is to facilitate the ordering of the dishes.	Lunch → Sandwiches 466 Beverages → Soft Drinks 92	smoothie 384 sandwich 4098 drink 5191 order 6912 menu 13856	Utrecht → Amersfoort 8011
broodje-lucullus.nl	Broodje Lucullus	The Broodje Lucullus website, located in Arnhem, provides an online ordering platform for various food items including sandwiches, platters, baguettes, and snacks. The website displays a menu and arranges for the delivery of ordered items.	Lunch → Sandwiches 466	baguette 35 platters 54 meat 2055 salad 2444 snack 2916 sandwich 4098	Gelderland → Arnhem 8680
broodje-vianen.nl	Broodje Vianen	The website Broodje Vianen offers online ordering of sandwiches, wraps, smoothies, and drinks from the lunchroom Broodje Vianen in Vianen.	Lunch → Sandwiches 466	smoothie 384 wrap 826 sandwich 4098 drink 5191 menu 13856	Vijfheerenlanden → Vianen 707
broodjebeuk.nl	Broodje Beuk Zutphen	The website of Broodje Beuk Zutphen offers an online ordering system for sandwiches and other drinks, along with information about the restaurant and customer reviews.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	reviews 3172 sandwich 4098 app 4595 drink 5191 order 6912 menu 13856	Gelderland → Zutphen 2690
broodjesbar-lelystad.nl	Broodjesbar Lelystad	Broodjesbar Lelystad is an online sandwich bar in Lelystad where visitors can order food online and view the menu.	Lunch → Sandwiches 466	shake 112 panini 156 soup 1043 burger 1431 salad 2444 sandwich 4098	Flevoland → Lelystad 3180
broodjeszaakdesmulhoek.nl	Broodjeszaak de Smulhoek	Broodjeszaak de Smulhoek is a village restaurant in Sint Willebrord offering a variety of sandwiches, hot dishes, snacks, and drinks.	Lunch → Sandwiches 466 Quick Bites → Cafeteria 906	hot dish 13 celebration 316 snack 2916 sandwich 4098 drink 5191	Rucphen → St. Willebrord 141
broodjeszaken-lekker-den-bosch.nl	Broodjeszaken Lekker Den Bosch	The website Broodjeszaken Lekker Den Bosch is an online ordering platform for sandwiches, salads, omelets and other snacks in Den Bosch. It offers a menu with various filled sandwiches and other dishes, as well as the ability to order them directly online.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	omelet 20 salad 2444 sandwich 4098 drink 5191 menu 13856	North-Brabant → 's-Hertogenbosch 8868
broodjevanbootje-diemen.nl	Broodje van Bootje Diemen	Broodje van Bootje Diemen is an online ordering platform for food and snacks in Diemen.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	omelet 20 burger 1431 fries 2753 snack 2916 sandwich 4098	North-Holland → Diemen 975
brussels-bun-hoofddorp.nl	Brussels Bun Hoofddorp	The website Brussels Bun Hoofddorp offers the possibility to place online orders for sandwiches, extras, smoothies and drinks at the location Hoofddorp.	Lunch → Sandwiches 466 Beverages → Soft Drinks 92	extras 64 smoothie 384 fruit 1166 salad 2444 sandwich 4098 drink 5191	Haarlemmermeer → Hoofddorp 2739
brusselsbun-haarlem.nl	Brussels Bun	The website "Brussels Bun" in Haarlem offers the possibility to order food online.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Casual 16	fillings 42 extras 64 smoothie 384 sandwich 4098 drink 5191	North-Holland → Haarlem 8674
budgetbroodjes-zwaag.nl	Budget Broodjes Zwaag	The website Budget Broodjes Zwaag offers an online option to order filled sandwiches, salads, lunch boxes and other dishes for pick-up in Zwaag.	Lunch → Sandwiches 466	lunchboxes 41 cheese 1205 meat 2055 salad 2444 sandwich 4098 dish 5936	Hoorn → Zwaag 494
bunocoffee-amsterdam.nl	Buno Coffee	The Buno Coffee website allows customers to order food online from their Amsterdam location, including bowls, toasties, sandwiches, and sweets.	Lunch → Sandwiches 466 Brasseries & Bistros → Bistro 594	sweet 22 toastie 45 bowl 482 soup 1043 sandwich 4098	North-Holland → Amsterdam 41253
cafetaria-broodjeszaak-lopik.nl	Broodjeszaak Bella	The website Broodjeszaak Bella from Lopik allows customers to order sandwiches, pizzas, and salads online and view the menu.	Lunch → Sandwiches 466 Sandwiches & Salads → Salads 133	extras 64 salad 2444 sandwich 4098 pizza 4158 order 6912 menu 13856	Utrecht → Lopik 464
cafetaria-broodjeszaakheideroermond.nl	Cafetaria-Broodjeszaak Heide	Cafetaria-Broodjeszaak Heide is a sandwich shop and cafe in Roermond that accepts online orders.	Lunch → Sandwiches 466 Quick Bites → Cafeteria 906	frikandel 18 hamburger 364 sauce 1141 fries 2753 snack 2916 sandwich 4098	Limburg → Roermond 2602
cafetaria-kebabhouse-ede.nl	Cafetaria & KebabHouse	The website Cafetaria & KebabHouse from Ede offers the opportunity to order dishes online, including sandwiches, plates, snacks, Turkish pizzas and burgers. The menu is detailed and offers a wide range of options.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	beverage 586 plate 787 snack 2916 sandwich 4098 pizza 4158 menu 13856	Gelderland → Ede 5104
cafetaria-multifriet-ede.nl	Cafetaria Multifriet	The website Cafetaria Multifriet from Ede offers online ordering options for various snacks, fries, sandwiches, and other dishes.	Lunch → Sandwiches 466 Mediterranean & Middle Eastern → Takeout 286	waterbike 12 frikandel 18 fries 2753 snack 2916 sandwich 4098 menu 13856	Gelderland → Ede 5104
cafetariadehuiskamer-deventer.nl	Cafetaria de Huiskamer	The website of Cafetaria de Huiskamer in Deventer offers the opportunity to order food online and view the menu.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	pancakes 568 plate 787 wrap 826 burger 1431 fries 2753 sandwich 4098	Overijssel → Deventer 4751
cafetariafamily-maarssen.nl	Cafetaria Family Maarssen	Cafetaria Family Maarssen is an online ordering platform for food in Maarssen, where visitors can view the menu and have dishes delivered to their home.	Lunch → Sandwiches 466 Fast Food → Fries Chain 46	salad 2444 fries 2753 snack 2916 sandwich 4098 drink 5191 catering 6456	Stichtse Vecht → Maarssen 1051
cafetariakennedyplein-ulft.nl	Cafetaria Kennedyplein	The website of Cafetaria Kennedyplein from Ulft allows for online ordering of a wide variety of dishes, including fries, snacks, sandwiches, Turkish cuisine, and drinks.	Fast Food → Fries 949 Sandwiches & Salads → Snacks 693	menus 221 sausage 256 sauce 1141 fries 2753 snack 2916 sandwich 4098	Oude IJsselstreek → Ulft 392
cafetariamingmmm-steyl.nl	Cafetaria Ming MMM	The website of Cafetaria Ming MMM from Steyl offers the possibility to order online from an extensive menu with fries, sauces, snacks, sandwiches, and various Asian dishes.	Fast Food → Fries 949 Lunch → Sandwiches 466	sauce 1141 fries 2753 snack 2916 sandwich 4098 menu 13856	Venlo → Steyl 95
chopcheese.nl	Chop & Cheese Nieuwegein	The website of Chop & Cheese Nieuwegein allows customers to order sandwiches, burgers, and other items online for delivery.	Fast Food → Burgers 687 Lunch → Sandwiches 466	points 612 burger 1431 fries 2753 sandwich 4098 order 6912 menu 13856	Utrecht → Nieuwegein 2264
ciao-enkhuizen.nl	Ciao Enkhuizen	The Ciao Enkhuizen website allows customers to order food online in Enkhuizen, offering a comprehensive menu including various dishes, drinks, and add-ons.	Pastries & Baked Goods → Menus 223	salad 2444 sandwich 4098 dish 5936 order 6912 menu 13856	North-Holland → Enkhuizen 1064
cjs-cuisine.nl	C.J’s Cuisine	The website of C.J’s Cuisine in Soesterberg offers the possibility to order sandwiches, salads and other dishes online and have them delivered to your home. It also provides information about the restaurant and customer reviews.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	smoothie 384 reviews 3172 sandwich 4098 menu 13856	Soest → Soesterberg 410
clubsandwiches-breda.nl	Clubsandwiches	The website allows customers to order sandwiches, snacks, and hot meals online from Clubsandwiches in Breda.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	soup 1043 salad 2444 snack 2916 sandwich 4098	North-Brabant → Breda 9003
coradelicatessencanaldistrict-amsterdam.nl	Cora Delicatessen	The Cora Delicatessen website allows customers to order food online from the Cora Delicatessen deli in Amsterdam.	Sandwiches & Salads → Prepared Foods 39	juice 207 food 3872 sandwich 4098 menu 13856	North-Holland → Amsterdam 41253
croissanteriedunord-drachten.nl	Croissanterie Du Nord	The website of Croissanterie Du Nord in Drachten offers the possibility to place online orders for sandwiches, snacks, salads, and drinks.	Lunch → Sandwiches 466	red bull 16 soft drinks 87 salad 2444 snack 2916 sandwich 4098	Smallingerland → Drachten 2052
crownbeefribs-groningen.nl	Shoarma Brothers	Shoarma Brothers is an online ordering platform for dishes from Groningen.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	party box 35 shoarma 254 kapsalon 509 fries 2753 sandwich 4098	Netherlands → Groningen 23734
cupalacakeamsterdam.nl	Cup a la Cake	The Cup a la Cake website offers the possibility to order sandwiches and other dishes online in Amsterdam. It presents an extensive menu and allows customers to quickly and easily place their order.	Lunch → Sandwiches 466	smoothie 384 cake 1730 ingredients 2346 sandwich 4098 menu 13856	North-Holland → Amsterdam 41253
de-broodtoren-breda.nl	De Broodtoren	The website of De Broodtoren in Breda offers online ordering of sandwiches, toasties, sandwiches and other dishes.	Sandwiches & Salads → Sandwich Shops 229	baguette 35 toastie 45 sandwich 4098 club 4225 dish 5936	North-Brabant → Breda 9003
debroodjesbar-wassenaar.nl	De Broodjes Bar	De Broodjes Bar is an online ordering platform for sandwiches and other dishes in Wassenaar.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	omelet 20 smoothie 384 bread 1622 sandwich 4098	South-Holland → Wassenaar 1372
decanterland-online.nl	De Canterlanden	The website of De Canterlanden offers the possibility to order and have delivered various snacks, sandwiches, and drinks online. The site contains an extensive catalog of products and options.	Fast Food → Fries 949 Lunch → Sandwiches 466	soft drink 39 croquette 136 milkshake 195 fries 2753 snack 2916 sandwich 4098	Tytsjerksteradiel → Gytsjerk 70
dejongegraafcothen.nl	De Jonge Graaf	The website De Jonge Graaf is an online platform allowing customers in Cothen to order food from the restaurant for delivery or takeout.	Lunch → Sandwiches 466	omelet 20 appetizer 556 pancakes 568 salad 2444 sandwich 4098 dish 5936	Wijk bij Duurstede → Cothen 165
dekoningsandwich-tilburg.nl	De Koning Sandwich	De Koning Sandwich is a website where customers can order food directly from the restaurant in Tilburg.	Lunch → Sandwiches 466	sauce 1141 burger 1431 sandwich 4098 menu 13856	North-Brabant → Tilburg 8759
delicompanytogo-amsterdam.nl	Deli Company To Go	The Deli Company To Go website, based in Amsterdam, provides an online ordering service for a variety of sandwiches, meals, snacks, and drinks, with a focus on Indonesian cuisine.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	indonesian 44 vegetarian 337 meal 1638 sandwich 4098 drink 5191	North-Holland → Amsterdam 41253
dikkemikdenhaag.nl	Dikke Mik	The website of Ontbijt & Lunchroom Dikke Mik is a bakery and lunchroom in The Hague that offers freshly made sandwiches, smoothies, and coffee.	Ready-To-Eat Meals → Wraps 102 Bakery & Food Production → Bread 765	espresso 131 toppings 153 smoothie 384 sandwich 4098	South-Holland → The Hague 19898
don-panini.nl	Don Panini Amersfoort	The website of Don Panini Amersfoort offers the possibility to order and have sandwiches, salads, paninis and other dishes delivered online.	Lunch → Sandwiches 466 Food Delivery → Delivery 2227	panini 156 bread 1622 sandwich 4098 app 4595 menu 13856	Utrecht → Amersfoort 8011
doner-food-assendelft.nl	Doner Food	The website Doner Food from Assendelft offers the possibility to order food online, including pizzas, salads, and sandwiches.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	döner 673 salad 2444 fries 2753 sandwich 4098 pizza 4158	Zaanstad → Assendelft 524
eddys-lunchcafe-eindhoven.nl	Eddy's Lunchcafe	The website of Eddy's Lunchcafe in Eindhoven offers the possibility to order food online and view the menu.	Lunch → Sandwiches 466	snack platters 17 pancakes 568 salad 2444 sandwich 4098 dish 5936 menu 13856	North-Brabant → Eindhoven 11845
eethuis-nieuwburen-lemmer.nl	Eethuis Lemmer	The website Eethuis Lemmer offers online ordering for a variety of dishes, including sandwiches, shawarma plates, Turkish pizzas, paninis, and pita wraps, all served in Lemmer.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	turkish pizza 63 pita 199 shawarma 335 plate 787 sandwich 4098	De Fryske Marren → Lemmer 1188
eethuis-spicy.nl	Eethuis Spicy	The website of Eethuis Spicy in Amsterdam offers an online ordering system for the restaurant’s dishes and keeps visitors informed about promotions and discounts via a newsletter.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	soup 1043 sandwich 4098 dish 5936 newsletter 6504 order 6912 menu 13856	North-Holland → Amsterdam 41253
eethuistoday-middelburg.nl	Eethuis Today	The Eethuis Today website offers online ordering for various dishes from the Eethuis in Middelburg, including sandwiches, Turkish pizzas, wraps, and plates.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	soft drinks 87 döner 673 plate 787 wrap 826 sandwich 4098 pizza 4158	Zeeland → Middelburg 2342
fastfoodrestaurantmurat-bergenopzoom.nl	Fastfood Restaurant Murat	The website of Fastfood Restaurant Murat in Bergen op Zoom offers online ordering of a wide variety of dishes, including pizzas, sandwiches, wraps, and various ‘kapsalons’ (combinations of meat and bread).	Lunch → Sandwiches 466 International → Turkish 416	döner 673 wrap 826 fries 2753 sandwich 4098 pizza 4158	North-Brabant → Bergen op Zoom 2274
foodbeverageteamzwolle.nl	Food & Beverage Team Zwolle	The Food & Beverage Team Zwolle website allows customers to order dishes from their menu in Zwolle online. The menu includes various sandwiches, meat products, fish sandwiches, vegetarian options and sweet treats such as cannoli's.	Lunch → Sandwiches 466 Sandwiches & Salads → Snacks 693	meat products 272 vegetarian 337 bread 1622 sandwich 4098 drink 5191	Overijssel → Zwolle 7395
gloria-maria-rijnsburg.nl	Gloria Maria	The website Gloria Maria in Rijnsburg offers the possibility to order meals online, including pizzas, sandwiches, plates and various snacks and drinks.	Fast Food → Fries 949 Lunch → Sandwiches 466	doner 131 shawarma 335 plate 787 sandwich 4098 pizza 4158	Katwijk → Rijnsburg 475
grillroomandalous-zwijndrecht.nl	The Shoarmasaack	The Shoarmasaack is an online ordering platform for dishes from Zwijndrecht, including shawarma, sandwiches, and burgers.	Fast Food → Shawarma 30 Lunch → Sandwiches 466	shawarma 335 kapsalon 509 plate 787 burger 1431 sandwich 4098 drink 5191	South-Holland → Zwijndrecht 1455
grillroompiramide-zoeterwoude.nl	Grillroom Piramide	Grillroom Piramide is an online ordering platform for food in Zoeterwoude, where customers can view a menu and order dishes online.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	pita 199 plate 787 salad 2444 fries 2753 sandwich 4098 pizza 4158	South-Holland → Zoeterwoude 402
grillroomthamar-ridderkerk.nl	Grillroom Thamar	The website of Grillroom Thamar from Ridderkerk offers the possibility to order food online, including pizzas, sandwiches, plates and various meat and fish dishes.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	chicken fillet 35 shawarma 335 plate 787 sandwich 4098 pizza 4158 drink 5191	South-Holland → Ridderkerk 1335
healthyfoodsmoothies-amsterdam.nl	Broodjeshuys Noord	Broodjeshuys Noord is an online platform where customers can order sandwiches and other dishes in Amsterdam.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	salad 2444 snack 2916 sandwich 4098 menu 13856	North-Holland → Amsterdam 41253
heel-bijzonder-enschede.nl	Heel Bijzonder	The website Heel Bijzonder offers online ordering for sandwiches, toasties, hot drinks and pastries in Enschede, with a menu overview and the option to order online.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	toastie 45 pastries 946 sauce 1141 salad 2444 sandwich 4098	Overijssel → Enschede 5554
hetperronhollandscherading.nl	Het Perron	Het Perron is a coffee and lunchroom located in Hollandsche Rading near the train station, offering a wide range of hot drinks, homemade cakes and sandwiches.	Lunch → Sandwiches 466	cake 1730 fries 2753 coffee 3838 sandwich 4098	De Bilt → Vuursche Dreef 70
hierder-hepke.nl	Hierder Hepke	The website Hierder Hepke offers the possibility to order meals and filled sandwiches online in Maastricht.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	panini 156 pancakes 568 soup 1043 salad 2444 sandwich 4098 drink 5191	Limburg → Maastricht 6008
izasbroodjesgrill-oostburg.nl	Iza's Broodjes & Grill	The website Iza's Broodjes & Grill is an online platform allowing customers to order sandwiches, döner kebab, burgers, buckets and other dishes from the restaurant in Oostburg.	Lunch → Sandwiches 466 International → Turkish 416	bucket 113 döner 673 plate 787 burger 1431 fries 2753 sandwich 4098	Sluis → Oostburg 205
japitacoffeemore-rotterdam.nl	Japita Coffee & More	The website Japita Coffee & More from Rotterdam offers the possibility to order food and drinks online.	Lunch → Sandwiches 466 Sandwiches & Salads → Sandwich Shops 229	soft drinks 87 panini 156 smoothie 384 sandwich 4098	South-Holland → Rotterdam 25048
jsfoodplace.nl	JS Food	The website of J’s Food Place is a Surinamese sandwich shop in The Hague offering meals and snacks with a focus on a personal and sustainable approach.	Supermarkets & Grocery → Food Stores 1058 Cooking & Recipes → Cuisine 1147	packaging 2236 sandwich 4098 environment 4873 menu 13856	South-Holland → The Hague 19898
koemans-belegde-broodjes-amsterdam.nl	Koeman's Belegde Broodjes	The Koeman's Belegde Broodjes website offers an online ordering service for sandwiches and drinks in Amsterdam. The website displays a menu with various sandwich options and beverages, allowing customers to easily place online orders.	Lunch → Sandwiches 466	beef 319 salad 2444 sandwich 4098 drink 5191 order 6912 menu 13856	North-Holland → Amsterdam 41253
kwalitaria-de-musketiers-ter-apel.nl	Kwalitaria De Musketiers	The website Kwalitaria De Musketiers offers online ordering for meals, salads, burgers, and snacks in Ter Apel. Visitors can easily order their favorite dishes and have them delivered or picked up.	Fast Food → Burgers 687 Lunch → Sandwiches 466	ice cream 1000 burger 1431 salad 2444 fries 2753 sandwich 4098	Westerwolde → Ter Apel 345
la-delizia-pizzeria-grillroom-valkenswaard.nl	La Delizia Pizzeria-Grillroom	La Delizia Pizzeria-Grillroom is an online ordering platform for pizzas, pasta, salads, sandwiches, wraps and other dishes from Valkenswaard. It offers a menu with various options and the ability to place online orders.	Lunch → Sandwiches 466 International → Turkish 416	saloon 10 doner 131 pasta 1389 salad 2444 sandwich 4098 pizza 4158	North-Brabant → Valkenswaard 1179
leeuwarden-dionysos.nl	Dionysos	The Dionysos website in Leeuwarden offers the ability to order food online, including Greek meals and combo meals with ice cream and drinks.	Grilling & Steaks → Meat Dishes 40	gyro 95 ice cream 1000 salad 2444 sandwich 4098 drink 5191 dish 5936	Friesland → Leeuwarden 6068
lekkeraanhuis-vlaardingen.nl	Lekker aan huis	The website Lekker aan huis is an online platform that allows customers in Vlaardingen to easily have their favorite dishes delivered to their homes. The website offers a menu with a variety of sandwiches, salads, pastries and drinks.	Lunch → Sandwiches 466 Sandwiches & Salads → Salads 133	pastries 946 salad 2444 sandwich 4098 drink 5191	South-Holland → Vlaardingen 1853
lina-snacks-grill-haarlem.nl	Lina Snacks & Grill Haarlem	The Lina Snacks & Grill Haarlem website is an online ordering platform for food and drinks in Haarlem. It offers an extensive menu with pizzas, kapsalons (dish combinations), sandwiches, and other dishes, with the option to order online.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	kapsalon 509 sauce 1141 sandwich 4098 pizza 4158 drink 5191	North-Holland → Haarlem 8674
luigipizzaservice-amsterdam.nl	Luigi Pizza Service	Luigi Pizza Service is an online ordering platform for pizzas, salads, and other dishes in Amsterdam.	Cuisine → Vegetarian 697 Sandwiches & Salads → Appetizers 40	risotto 26 kapsalon 509 salad 2444 sandwich 4098 pizza 4158	North-Holland → Amsterdam 41253
lunchbezorgen.nl	Broodjes.nl	The website, broodjes.nl, provides a service for delivering sandwiches and complete lunches to locations in the Netherlands and Belgium, catering to both business and private clients.	Lunch → Sandwiches 466	caterer 47 lunch 1534 sandwich 4098 event 45199	Netherlands → Utrecht 48901
lunchcafeovervecht-utrecht.nl	Lunchcafé Overvecht	Lunchcafé Overvecht is an online ordering platform for picking up meals in Utrecht. The website offers a menu with a variety of sandwiches, snacks, and other dishes.	Lunch → Sandwiches 466 Quick Bites → Snack Bar 580	snack 2916 sandwich 4098 pizza 4158 dish 5936 order 6912 menu 13856	Netherlands → Utrecht 48901
lunchebox.nl	Lunchbox Eindhoven	The Lunchbox Eindhoven website offers prepared sandwiches, business lunches, and complete lunch packages in the Eindhoven region, with delivery seven days a week.	Lunch → Sandwiches 466	lunch package 24 tapas 465 bread 1622 sandwich 4098	Meierijstad → Veghel 1288
lunchroom-kartal.nl	Lunchroom Kartal	Lunchroom Kartal is a lunchroom in Haarlem that accepts online orders for sandwiches, Turkish pizzas, wraps, and various dishes, sides, and salads. Customers can also order extras and drinks.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	turkish pizza 63 kapsalon 509 fries 2753 sandwich 4098 dish 5936	North-Holland → Haarlem 8674
lunchroombijusmaastricht.nl	Bij Us Maastricht	The website aims to facilitate online ordering of food from restaurant Bij Us Maastricht in Maastricht.	Lunch → Sandwiches 466 Cuisine → Vegetarian 697	muffin 22 hummus 64 tomato 144 chicken 944 sandwich 4098	Limburg → Maastricht 6008
mado-broodje-wieringerwerf.nl	Mado Broodje	The Mado Broodje website is an online platform allowing customers in Wieringerwerf to order food, including sandwiches, pizzas, plates, and snacks.	Lunch → Sandwiches 466 Sandwiches & Salads → Subs 23	fry 59 kapsalon 509 plate 787 salad 2444 sandwich 4098 pizza 4158	Hollands Kroon → Wieringerwerf 197
mediterraan-harde.nl	Mediterraan	The website Mediterraan from 't Harde offers the possibility to order meals online, including salads, sandwiches, small and large dishes, plates, pizzas and children's meals. Menu, reviews and contact information are also available.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	kebab 276 kapsalon 509 plate 787 salad 2444 sandwich 4098 pizza 4158	Elburg → Spoorstraat 142
midas-berkelenrodenrijs.nl	Midas Berkel	The website Midas Berkel provides an online ordering system for dishes in Berkel en Rodenrijs, featuring a comprehensive menu and customer reviews.	Fast Food → Burgers 687 Lunch → Sandwiches 466	burger 1431 bread 1622 salad 2444 sandwich 4098 dish 5936 menu 13856	Lansingerland → Berkel and Rodenrijs 929
misspiggie.nl	Miss Piggie Foodtruck	The website of Miss Piggie is a food truck specializing in providing a variety of sandwiches, hamburgers, and other snacks at events such as weddings, birthdays, and corporate parties.	Quick Bites → Food Trucks 623	foodtruck 613 sandwich 4098 interior 8093 menu 13856 event 45199
monalisa-noordwijkerhout.nl	Mona Lisa Noordwijkerhout	The Mona Lisa Noordwijkerhout website offers an online ordering system for the diverse dishes offered by the restaurant in Noordwijkerhout, including sandwiches, salads and pizzas.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	extras 64 shoarma 254 kapsalon 509 salad 2444 sandwich 4098 pizza 4158	Noordwijk → Noordwijkerhout 1099
monstersushi-hengelo.nl	Soralicious Sushi Hengelo	The website Soralicious Sushi Hengelo offers online ordering of sushi, sandwiches, hot meals, and other dishes in Hengelo.	Japanese → Sushi 971 Lunch → Sandwiches 466	sushi rice 12 poke bowl 308 sushi 1695 sandwich 4098	Overijssel → Hengelo 3499
picobellofreshpinsapaninijuice-rotterdam.nl	Picobellofresh Pinsa Panini Juice	The website of Picobellofresh Pinsa Panini Juice is an online ordering platform for dishes and drinks in Rotterdam. It offers a menu with various pizzas, paninis, sandwiches and special boxes, as well as smoothies and soft drinks.	Lunch → Sandwiches 466	soft drink 39 panini 156 smoothie 384 box 1982 sandwich 4098 pizza 4158	South-Holland → Rotterdam 25048
pimsbroodjeszaak-tilburg.nl	Yammie by Pims	The website Yammie by Pims from Tilburg offers the possibility to order food online. It presents an extensive menu with various sandwiches, salads and other treats.	Lunch → Sandwiches 466	specials 65 salad 2444 sandwich 4098 drink 5191 order 6912 menu 13856	North-Brabant → Tilburg 8759
pizzeriaaalten.nl	Pizzeria Aalten	Pizzeria Aalten is an online platform where customers can order dishes from the pizzeria in Aalten. The website offers a menu with various pizzas, sandwiches, plates and other dishes, as well as an overview of reviews and contact information.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	plate 787 pasta 1389 sandwich 4098 pizza 4158 drink 5191	Gelderland → Aalten 964
pizzeriadinaro-sintanthonis.nl	Pizzeria Dinaro	The website Pizzeria Dinaro from Sint anthonis offers the possibility to order food online, including pizzas, sandwiches, wraps, kapsalons (style salads), pasta and salads.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	döner 673 pasta 1389 salad 2444 sandwich 4098 pizza 4158	Land van Cuijk → Sint Anthonis 158
pizzeriagrillroomnapoli.nl	Pizzeria & Grillroom Napoli	The website Pizzeria & Grillroom Napoli from Kesteren offers an online ordering system for pizzas, sandwiches, salads, and other dishes.	Lunch → Sandwiches 466 International → Turkish 416	doner 131 salad 2444 sandwich 4098 pizza 4158	Neder-Betuwe → Casterhoven 248
pizzeriamey-kortenhoef.nl	Pizzeria Mey	The website Pizzeria Mey offers online ordering of a variety of dishes, including pizzas, sandwiches, and Turkish specialties, with a focus on fast delivery in Kortenhoef.	Lunch → Sandwiches 466 Turkish Cuisine → Fast Food 3222	turkish pizza 63 hamburger 364 kapsalon 509 fries 2753 sandwich 4098 pizza 4158	Wijdemeren → Kortenhoef 719
pyramide-zeewolde-zeewolde.nl	Pyramiden Zeewolde	The Pyramiden Zeewolde website allows customers to order food online from the restaurant in Zeewolde. It presents a menu with various pizzas, sandwiches, and other dishes.	Lunch → Sandwiches 466 International → Turkish 416	top 377 snack 2916 sandwich 4098 pizza 4158 drink 5191 menu 13856	Flevoland → Zeewolde 1243
raam-amsterdam.nl	Raam Amsterdam	The website Raam Amsterdam offers the possibility to order meals online in Amsterdam.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	panini 156 breakfast 1822 salad 2444 sandwich 4098 drink 5191	North-Holland → Amsterdam 41253
rax-corner.nl	Rax Corner & Sparerib King	The website Rax Corner & Sparerib King is an online platform where customers can order meals from the restaurant in Aalsmeer.	Lunch → Sandwiches 466 Catering & Ready Meals → Ready-To-Eat Meals 359	turkish pizza 63 dürüm 97 spareribs 213 kapsalon 509 döner 673 sandwich 4098	North-Holland → Aalsmeer 1710
rebelsebroodjes-enschede.nl	Rebelse Broodjes & Pokébowls	Rebelse Broodjes & Pokébowls is a website that allows you to order food online in Enschede.	Lunch → Sandwiches 466	poké bowl 169 wrap 826 sauce 1141 sandwich 4098	Overijssel → Enschede 5554
restaurant-alanya-delfzijl.nl	Alanya Delfzijl	The website Alanya Delfzijl offers the possibility to order meals online from the Alanya Delfzijl restaurant in Delfzijl. The menu is directly visible and orders can be easily placed online.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	lahmacun 93 kebab 276 shawarma 335 sandwich 4098 pizza 4158	Eemsdelta → Delfzijl 615
restaurant-hollywood-arnhem.nl	Restaurant Hollywood Arnhem	Restaurant Hollywood Arnhem is a restaurant in Arnhem that accepts online orders for sandwiches, wraps, plates, and other dishes.	Lunch → Sandwiches 466 Pastries & Baked Goods → Menus 223	chicken fillet 35 shawarma 335 döner 673 plate 787 wrap 826 sandwich 4098	Gelderland → Arnhem 8680
roti-king-leiden-leiden.nl	Roti King Leiden	The Roti King Leiden website offers the possibility to order dishes online, including sandwiches, roti rolls, and various Indonesian/Surinamese meals. The menu is diverse and includes meat and vegetarian options.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	cabbage 23 roti 303 chicken 944 sandwich 4098	South-Holland → Leiden 7089
rubenskoffiebroodjes.nl	Rubens Waddinxveen	The website of Rubens Waddinxveen is an official online shop where customers can order sandwiches, coffee, and other treats for delivery.	Lunch → Sandwiches 466	coffee 3838 sandwich 4098 newsletter 6504 menu 13856	South-Holland → Waddinxveen 1046
salumeriaprimo-hilversum.nl	Salumeria Primo	The website Salumeria Primo from Hilversum offers the possibility to order food online, including sandwiches, pizza, desserts and drinks.	Lunch → Sandwiches 466 Beverages → Beer 1095	soft drinks 87 dessert 496 beer 2887 sandwich 4098 pizza 4158 wine 4476	North-Holland → Hilversum 4397
samonolunchroom-nieuwegein.nl	Samono Lunchroom	The website Samono Lunchroom offers online ordering of meals in Nieuwegein. It presents a comprehensive menu with various sandwiches, paninis, salads, smoothies and drinks.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	panini 156 halal 165 smoothie 384 sandwich 4098 drink 5191	Utrecht → Nieuwegein 2264
sharonscateringtraiteur-eindhoven.nl	Sharon's Catering & Traiteur	The website Sharon's Catering & Traiteur from Eindhoven offers an online menu with the option to order dishes. The company specializes in catering and the sale of sandwiches, paninis, salads, and hamburgers.	Lunch → Sandwiches 466 Sandwiches & Salads → Salads 133	panini 156 hamburger 364 salad 2444 sandwich 4098 menu 13856	North-Brabant → Eindhoven 11845
smakelijk-veenendaal.nl	Smakelijk Veenendaal	The Smakelijk Veenendaal website offers an online ordering system for sandwiches, drinks, and other dishes in Veenendaal. The aim is to simplify and expedite the ordering process.	Lunch → Sandwiches 466 Turkish Cuisine → Takeout Restaurant 81	lettuce 26 curry 355 sandwich 4098 order 6912 menu 13856	Utrecht → Veenendaal 2641
snackwagentfriethoekje-lemmer.nl	Snackwagen 't Friethoekje	Snackwagen 't Friethoekje is an online ordering platform for snacks and sandwiches in Lemmer.	Fast Food → Fries 949 Lunch → Sandwiches 466	coleslaw 10 butter 61 rib 191 roll 358 fries 2753 sandwich 4098	De Fryske Marren → Lemmer 1188
sofrabergeijk.nl	Sofra Bergeijk	The website Sofra Bergeijk offers the possibility to order online from the restaurant Sofra Bergeijk in Bergeijk. It presents a menu with various dishes and sandwiches.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	kebab 276 plate 787 bread 1622 salad 2444 sandwich 4098 pizza 4158	North-Brabant → Bergeijk 775
sofravlissingen.nl	SOFRA VLISSINGEN	The website Sofra Vlissingen offers an online ordering system for dishes, including sandwiches, pizzas, döners, and ice cream, in the city of Vlissingen. Customers can easily order their favorite meals for delivery or takeaway.	Lunch → Sandwiches 466 International → Turkish 416	grill dishes 46 kapsalon 509 döner 673 ice cream 1000 sandwich 4098 pizza 4158	Zeeland → Vlissingen 1614
sonali-roti.nl	Sonali Roti Afhaalrestaurant	Sonali Roti Afhaalrestaurant offers an online platform to order various Surinamese dishes, including roti, bami/nasi, sandwiches, and snacks, for delivery to your home.	Lunch → Sandwiches 466 Restaurants & Dining → Takeaway Restaurants 240	biryani 80 roti 303 snack 2916 sandwich 4098 drink 5191	South-Holland → Delft 5309
stachzuidas-amsterdam.nl	STACH Amsterdam Strawinskylaan	The website STACH Amsterdam Strawinskylaan offers the possibility to order food online, specifically sandwiches, juices and soft drinks, from the location on Strawinskylaan in Amsterdam.	Lunch → Sandwiches 466	soft drinks 87 juice 207 sandwich 4098 menu 13856	North-Holland → Amsterdam 41253
star-snack-lopik.nl	Star Snack	The website Star Snack offers online ordering for a variety of snacks, sandwiches, and meals from Lopik, with an extensive menu and reviews.	Lunch → Sandwiches 466 Sandwiches & Salads → Snacks 693	party box 35 croquettes 108 menus 221 fries 2753 snack 2916 sandwich 4098	Utrecht → Lopik 464
sweetsalt-vlaardingen.nl	Sweet & Salt	Sweet & Salt is an online ordering platform for food in Vlaardingen, offering a menu of sandwiches, burgers, snacks, and drinks.	Fast Food → Burger Restaurants 346 Lunch → Sandwiches 466	burger 1431 snack 2916 sandwich 4098 drink 5191	South-Holland → Vlaardingen 1853
t-pompje-breda.nl	t Pompje	't Pompje is an online ordering platform for Turkish dishes, sandwiches, and plates in Breda. It offers a comprehensive menu and the ability to easily order meals online.	Lunch → Sandwiches 466 Sandwiches & Salads → Snacks 693	kapsalon 509 döner 673 plate 787 sandwich 4098 pizza 4158 dish 5936	North-Brabant → Breda 9003
tankshopfraneker.nl	Tankshop Franeker	Tankshop Franeker offers freshly made sandwiches, baked goods, and salads, focusing on a good start to the day or a quick lunch.	Lunch → Sandwiches 466	baked goods 148 salad 2444 sandwich 4098	Waadhoeke → Franeker 694
tastetheoriginal-breda.nl	TASTE the original	The website TASTE the original offers online ordering of food from the restaurant located in Breda, featuring a comprehensive menu including sandwiches, salads, combo meals, smoothies, and beverages.	Lunch → Sandwiches 466	combo meal 65 smoothie 384 salad 2444 sandwich 4098 drink 5191 menu 13856	North-Brabant → Breda 9003
the-pizzabus-geleen.nl	The Pizzabus	The Pizzabus website allows customers to order pizzas and sandwiches online from Geleen. It provides an extensive menu with various pizza types, sandwiches, sauces, beverages, and cocktails.	Fast Food → Fries Restaurants 87 Lunch → Sandwiches 466	top 377 sauce 1141 sandwich 4098 pizza 4158 drink 5191	Sittard-Geleen → Geleen 978
thecompanykitchen-krimpenaandenijssel.nl	The Company Kitchen	The website The Company Kitchen provides the option to order food online in Krimpen aan den IJssel, with a focus on sandwiches, lunch packages, and beverages.	Catering & Ready Meals → Takeaway 409	lunch package 24 roll 358 beverage 586 bread 1622 sandwich 4098	South-Holland → Krimpen aan den IJssel 654
thegreatcaribbeantastehoogvlietrotterdam.nl	The Great Caribbean Taste	The Great Caribbean Taste website offers an online platform to order Caribbean cuisine dishes in Hoogvliet, Rotterdam. It presents an extensive menu with various sandwiches, grill dishes, side dishes, and beverages.	Online Services → Ordering 121 Food → Restaurants & Dining 27325	grill dishes 46 side dish 118 beverage 586 plate 787 sandwich 4098	Rotterdam → Hoogvliet 516
tomsbreadmore-amsterdam.nl	Tom's Bread & More	The website Tom's Bread & More offers the opportunity to order food online, primarily sandwiches, warm bread rolls and paninis, from an extensive menu. The company is located in Amsterdam.	Lunch → Sandwiches 466 Quick Bites → Cafeteria 906	panini 156 cheese 1205 meat 2055 sandwich 4098 drink 5191	North-Holland → Amsterdam 41253
toonsgroenteenfruithoek-nijmegen.nl	CATERING VAN ALEX	Catering Van Alex is an online catering company based in Nijmegen offering a wide range of sandwiches, salads, tapas, desserts, fruit, and beverages.	Lunch → Sandwiches 466 Mediterranean & Middle Eastern → Takeout 286	tapas 465 dessert 496 beverage 586 salad 2444 sandwich 4098	Gelderland → Nijmegen 9384
traiteurnico.nl	Traiteur Nico	The website of Traiteur Nico presents a catering service specializing in sandwiches, buffets, and BBQ, with a long history of over 20 years in the region, and offers services for various occasions.	Lunch → Sandwiches 466 Sandwiches & Salads → Prepared Foods 39	bbq 908 buffet 1747 sandwich 4098 catering 6456 event 45199	Zeeland → Hulst 741
trattoriafaam-amsterdam.nl	ROSSI Mediterranean Sandwiches	The website ROSSI Mediterranean Sandwiches offers online ordering of Mediterranean sandwiches, drinks and sweets from Amsterdam.	Lunch → Sandwiches 466	sweets 229 sandwich 4098 drink 5191 menu 13856	North-Holland → Amsterdam 41253
trukipantogo-rotterdam.nl	Truk'i Pan To Go	The website Truk'i Pan To Go offers online ordering of food and drinks, focusing on sandwiches, dishes, and mixed grill options, in the city of Rotterdam.	Lunch → Sandwiches 466 Online Services → Ordering 121	mixed grill 27 pastries 946 sandwich 4098 dish 5936	South-Holland → Rotterdam 25048
twenty-eight-hoensbroek.nl	Twenty Eight	The website Twenty Eight offers the possibility to order meals online from the restaurant Twenty Eight in Hoensbroek.	Lunch → Sandwiches 466	toastie 45 lunchbox 50 pancakes 568 soup 1043 sauce 1141 sandwich 4098	Heerlen → Hoensbroek 371
visspeciaalzaakfishcorner-rotterdam.nl	Fish Corner	The website Visspeciaalzaak Fish Corner offers the possibility to order dishes online from Rotterdam, with an extensive menu and the option for takeaway.	Lunch → Sandwiches 466 Restaurants & Dining → Seafood Restaurants 612	platters 54 soft drinks 87 kibbeling 115 sauce 1141 sandwich 4098	South-Holland → Rotterdam 25048
wrapsbroodjeshuis.nl	Wraps and Broodjeshuis Tilburg	The website of Wraps and Broodjeshuis Tilburg allows customers to order wraps, sandwiches, and other dishes online for home delivery, offering discounts and a newsletter for special promotions.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	points 612 discounts 795 wrap 826 sandwich 4098 menu 13856	North-Brabant → Tilburg 8759
zeeduivel-amsterdam.nl	Zeeduivel	The Zeeduivel website offers online ordering of food and drinks, with a focus on fish dishes and a wide selection of sandwiches, snacks, and beverages, located in Amsterdam.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	kibbeling 115 fish 1121 beer 2887 sandwich 4098 drink 5191 menu 13856	North-Holland → Amsterdam 41253
zinineenoliebol.nl	ZinInEenBroodje	The website is an online store and delivery service that delivers freshly made sandwiches, sandwiches, meal salads, and hot snacks, both for individual use at home or in the office, and for catering.	Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102	bakery 718 sandwich 4098 catering 6456	North-Holland → Hilversum 4397
t-bosje-oosterhout.nl	T BOSJE	T bosje is an online ordering platform for food from Oosterhout, focused on quickly delivering a variety of snacks, fries and sandwiches.	Fast Food → Fries 949 Lunch → Sandwiches 466	croquette 136 burger 1431 fries 2753 snack 2916 sandwich 4098	North-Brabant → Oosterhout 2086
amalfi-hoofddorp.nl	Amalfi	The official website of Amalfi in Hoofddorp allows online ordering of sandwiches and hamburgers, and offers the ability to earn points for discounts.	Fast Food → Burgers 687 Lunch → Sandwiches 466	hamburger 364 points 612 discounts 795 sandwich 4098 app 4595 menu 13856	Haarlemmermeer → Hoofddorp 2739
face-two-face.nl	Face-to-You	Face-to-You is a website offering video filming and editing services, primarily for special occasions such as vacations, parties, and capturing personal moments.	Lunch → Sandwiches 466 Live Events → Videography 1039	film 3007 reviews 3172 sandwich 4098 party 5928 video 6714
broodjekeurslager.nl	Keurslagerij Mennen	The website of Keurslagerij Mennen offers the possibility to order sandwiches and salads online for pickup. The company provides a selection of filled sandwiches, salads, and drinks, with personalization options via comments.	Lunch → Sandwiches 466	comments 74 ingredients 2346 salad 2444 sandwich 4098 order 6912
thetosticlubrotterdam.nl	The Tosti Club Rotterdam	The website of The Tosti Club Rotterdam offers the possibility to order food online, primarily tosti sandwiches, and presents an extensive menu with various options.	Quick Bites → Snack Bar 580 Sandwiches & Salads → Italian Cuisine 99	smoothie bowl 17 tosti 23 toppings 153 sandwich 4098 drink 5191 menu 13856	South-Holland → Rotterdam 25048
onglet-maastricht.nl	Onglet	The Onglet website is an online platform where residents of Maastricht can order and have delivered sandwiches, grill dishes, including various meats and beverages.	Lunch → Sandwiches 466	toppings 153 grill 562 bread 1622 sandwich 4098 drink 5191	Limburg → Maastricht 6008
x1-brood-schagen.nl	X1 Brood	The X1 Brood website is an online platform where customers in Schagen can order dishes from the sandwich shop.	Ready-To-Eat Meals → Wraps 102 Sandwiches & Salads → Subs 23	plate 787 sandwich 4098 pizza 4158 drink 5191	North-Holland → Schagen 2182
cafekralingseveer-rotterdam.nl	Cafetaria Kralingse Veer	The website of Cafetaria Kralingse Veer provides an online ordering system for various snacks, sandwiches, and meals in Rotterdam. Visitors can view the menu and place their order online.	Fast Food → Fries 949 Lunch → Sandwiches 466	croquettes 108 sauce 1141 fries 2753 sandwich 4098 dish 5936 package 6112	South-Holland → Rotterdam 25048
calis-noordwijk.nl	Calis Sandwich & Snacks	The Calis Sandwich & Snacks website offers online ordering for sandwiches, Turkish pizzas, döner, kapsalons, and fries in Noordwijk.	Lunch → Sandwiches 466 Food Delivery → Delivery 2227	kapsalon 509 fries 2753 snack 2916 sandwich 4098 pizza 4158 drink 5191	South-Holland → Noordwijk 2507
burgers-aan-den-hoef.nl	Burgers aan den Hoef	The website Burgers aan den Hoef offers online ordering of a varied menu of burgers, snacks, sandwiches, and salads, with a focus on quick and easy ordering in Egmond aan den Hoef.	Fast Food → Burgers 687 Lunch → Sandwiches 466	wrap 826 burger 1431 salad 2444 fries 2753 snack 2916 sandwich 4098	Bergen → Egmond aan den Hoef 142
durper.nl	t’Landje	The website is an online store selling a variety of food and beverage products, predominantly sourced from the island of Texel.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	potato 542 soup 1043 cheese 1205 beer 2887 sandwich 4098	North-Holland → Texel 2208
belpaninisliedrecht.nl	Bel Panini	Bel Panini’s website offers online ordering of various snacks, sandwiches, and meals from Sliedrecht.	Fast Food → Fries 949 Lunch → Sandwiches 466	burger 1431 fries 2753 snack 2916 sandwich 4098	South-Holland → Sliedrecht 863
dirkscatering.nl	Dirks Catering	Dirks Catering is a catering company that delivers sandwiches, bittergarnituur (fries with snacks) and salads on order, catering for events, parties, meetings and lunches.	Lunch → Sandwiches 466 Wholesale → Foodstuffs 64	dress 405 bread 1622 sandwich 4098 catering 6456 assortment 7799 event 45199
pokestation-amsterdam.nl	De Valentino's 7	The website of De Valentino's 7 in Amsterdam offers the possibility to order food online.	Fast Food → Burgers 687 Lunch → Sandwiches 466	panini 156 sauce 1141 cheese 1205 sandwich 4098 drink 5191	North-Holland → Amsterdam 41253
thebakerycompany.nl	The Bakery Company	The Bakery Company is a bakery chain located in Amsterdam, offering a variety of sandwiches, sweets, and coffee.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	sweet 22 panini 156 bakery 718 coffee 3838 sandwich 4098 menu 13856	North-Holland → Amsterdam 41253
foodnmood-houten.nl	Food 'n' Mood	Food 'n' Mood is an online ordering platform for food in Houten, offering a comprehensive menu.	Lunch → Sandwiches 466	tomato 144 smoothie 384 salad 2444 sandwich 4098 dish 5936	Utrecht → Houten 1677
bennys-place-putten.nl	Benny's Place	The website of Benny's Place in Putten offers an online ordering system for a wide range of dishes, including burgers, sandwiches, snacks and drinks.	Fast Food → Burgers 687 Lunch → Sandwiches 466	menus 221 burger 1431 fries 2753 snack 2916 sandwich 4098 drink 5191	Gelderland → Putten 1069
akkerhuis.nl	Lebkov & Sons	The website of Lebkov & Sons presents a food business with multiple locations in the Netherlands offering sandwiches, soup, sandwiches and catering, with a focus on fresh, homemade products and flexible employment opportunities.	Lunch → Sandwiches 466 Bakery & Food Production → Bread 765	wifi 1372 bread 1622 ingredients 2346 sandwich 4098 catering 6456	Amsterdam → Southeast 815
broodjeunicum.foodticket.nl	Broodje Unicum Hoek van Holland	The website of Broodje Unicum Hoek van Holland is an online platform where customers can order sandwiches, salads, and drinks for takeaway and delivery in Hoek van Holland and surrounding areas.	Lunch → Sandwiches 466	bread 1622 salad 2444 sandwich 4098 drink 5191 order 6912	Rotterdam → Hoek van Holland 540
tokoh.ijburgeats.nl	Restaurant Group (implied)	This website presents a menu of Indonesian sandwiches, salads, and rice dishes offered by various restaurants.	Lunch → Sandwiches 466 Catering & Ready Meals → Indonesian Restaurant 392	baguette 35 bowl 482 rice 635 salad 2444 coffee 3838 sandwich 4098

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.