Food Delivery & Restaurants Online

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳sauce ¹¹³¹	Food Delivery & Restaurants Online	This compilation features websites of restaurants, food trucks, and online ordering platforms throughout the country. Many listings offer diverse cuisines, including Turkish, Asian, and fast food options, alongside traditional Dutch snacks.

1131 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
yildriz.nl	Yildriz	Yildriz wereldsauzen produces a variety of sauces from local recipes from around the world, with a focus on flavor and quality.	E-Commerce → B2B ¹¹⁸ Sauces & Condiments → Sauces ⁴⁹	flavor ¹⁰³² barbecue ¹¹⁷⁵ ingredients ²³⁴⁶ recipe ⁵¹⁴² party ⁵⁹²⁸
knoflooksausmaken.nl	Not specified	The website focuses on various sauces and salsas.	Cooking & Recipes → Dishes ³³⁵	mayonnaise ²⁷ recipe ⁵¹⁴²
haagsheet.nl	Haags Heet	The website sells various sauces with unique flavors, including hot sauces, BBQ sauces and chili-hazelnut-chocolate spreads.	Sauces & Condiments → Condiments ¹⁷	handcrafted ¹⁵⁹ flavor ¹⁰³² artwork ²²⁴⁸ ingredients ²³⁴⁶	The Hague → City Center ⁴⁴⁵
magnifiek-saus.nl	Magnifiek saus	Magnifiek Ambachtelijke Sausen offers a variety of sauces such as curry sauce and mustard sauce, specially crafted.	Sauces & Condiments → Sauces ⁴⁹	artisanal ⁵⁶ ingredients ²³⁴⁶ dish ⁵⁹³⁶	Gelderland → Ede ⁵¹⁰⁴
whitewhalesauces.nl	White Whale Sauces	White Whale Sauces produces a variety of sauces with distinct flavor profiles, from mild to spicy.	Online Retail → Specialty Food ³² Sauces & Condiments → Sauces ⁴⁹	garlic ³⁷ pepper ⁵⁵ onion ¹¹¹
heatsupply.nl	Heatsupply	The website is specialized in the sale of various types of sauces.	Sauces & Condiments → Sauces ⁴⁹	subscription ³²⁸⁷ blog ¹³³⁹²
antilleancoast.nl	Antillean Coast	The website’s primary offerings are hot sauces and barbecue sauces, reflecting a focus on flavorful condiments.	Online Retail → Specialty Food ³² Sauces & Condiments → Sauces ⁴⁹	seasoning ¹⁵
manzjare.nl	Manzjare	The sauce is intended as a accompaniment for meat and vegetables and serves as a flavoring for multiple dishes.	Cooking & Recipes → Vegetarian Recipes ¹³	olive oil ³⁴⁶ vegetables ¹⁴¹⁶ recipe ⁵¹⁴²
remiaprofessioneel.nl	Remia Professioneel	The website offers a wide variety of sauce options, both hot and cold, intended for use in the hospitality industry.	Sauces & Condiments → Sauces ⁴⁹ Sauces & Condiments → Condiments ¹⁷	menu ¹³⁸⁵⁶
bgppizzavlaardingen.nl	BGP Pizza	The website provides an extensive selection of various sauces that can be added to the ordered pizzas.	Italian Restaurant → Pizza Restaurant ³⁵¹	top ³⁷⁷ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Vlaardingen ¹⁸⁵³
oliehoorn.nl	Oliehoorn	The website focuses on offering various types of sauces, ranging from fries sauce to curry sauce and mayonnaise, with the aim of enhancing meals.	Sauces & Condiments → Sauces ⁴⁹ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	family business ⁷⁹³ recipe ⁵¹⁴² webshop ⁸⁶⁴⁸ event ⁴⁵¹⁹⁹	Hoorn → Zwaag ⁴⁹⁴
sambalmaken.nl	Pieter	The website covers different types of sauces, including Mexican Mole, Adobo, Gyoza, Spicy chili oil, Hot Ketjap Sambal, and Harissa, in addition to traditional sambal.	Cooking & Recipes → Cuisine ¹¹⁴⁷	sambal ⁵⁴ mole ⁶¹ recipe ⁵¹⁴²
cestsibon.nl	C’est Si Bon Sauzen	The website offers a wide range of sauces, including garlic sauce, curry sauce and herb creams.	Wholesale → Food Products ³⁰³ Sauces & Condiments → Sauces ⁴⁹	sales points ⁸⁸	Enschede → Boekelo ¹⁷¹
hufsaus.nl	HUF Saus	HUF Saus is a unique sauce that stands out due to its spicy aftertaste and the combination of spices and peanuts.	Hospitality → Suppliers ¹⁰⁵⁷ Sauces & Condiments → Sauces ⁴⁹	mayonnaise ²⁷ peanuts ³² spices ³⁴⁰ hospitality ³⁴⁹¹
chiliwinkel.nl	One Stop Chilli Shop	A broad assortment of sauces, beyond just hot sauces, is available, including BBQ sauces and chutneys.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	recipe ⁵¹⁴² brand ¹⁷⁷³⁷
sauspomp.nl	Fastfood Support	Sauces are drawn into the pump and piping without air, ensuring optimal flavor and texture.	Machinery & Repair → Machinery ¹⁰⁴⁵ Sauces & Condiments → Condiments ¹⁷	mayonnaise ²⁷ portion ³³
maickelsbroodjes.nl	Maickels Broodjes	The food truck is known for its unique and flavorful sauces, such as the Spicy and Smokey Cocktail Sauce, developed after years of testing.	Quick Bites → Food Trucks ⁶²³ Services → Personal Services ¹⁰⁶²	foodtruck ⁶¹³ sandwich ⁴⁰⁹⁸ event ⁴⁵¹⁹⁹	Laarbeek → Beek and Donk ³⁷³
bohmhotsauce.nl	Böhm Hot Sauce	The website features a selection of ten different hot sauces with unique flavors and characteristics.	Coffee & Tea → Beverages ⁴⁴⁵³ Sauces & Condiments → Sauces ⁴⁹	recipe ⁵¹⁴² webshop ⁸⁶⁴⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
sausboss.nl	Sausboss	The website showcases a single type of hot sauce, emphasizing the care and craftsmanship involved in its production.	Cooking & Recipes → Culinary Arts ³⁵ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	ingredients ²³⁴⁶ health ⁶³⁶⁶	North-Holland → Amsterdam ⁴¹²⁵³
desausvanjoep.nl	NO LEMON	‘De saus van Joep’ offers a freshly prepared satay sauce in pasta form, which is easy to prepare with different liquids and suitable for various dishes.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Sauces & Condiments → Sauces ⁴⁹	passion ⁷⁹² stock ¹¹⁵⁴ ship ⁵¹⁰³ shop ⁶⁴⁸³
eetcafesnackbarkokkie-apeldoorn.nl	Eetcafé/snackbar Kokkie	The website describes the various sauces served with the fries and snacks.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
poelier-van-leeuwen-utrecht.nl	Poelier van Leeuwen	The website offers various types of sauces, such as garlic sauce, BBQ sauce and sweet chili sauce.	Meat → Chicken ¹²⁷	chicken ⁹⁴⁴ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
primo-gusto-eindhoven.nl	Primo Gusto	Primo Gusto offers a selection of delicious sauces, including truffle mayo and garlic sauce.	Italian Restaurant → Pizza Restaurant ³⁵¹	dessert ⁴⁹⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
versaa.nl	Versaa	Sauces play a key role in culinary dishes, each with unique flavors and cultural backgrounds.	Supermarkets & Grocery → Specialty Stores ⁷⁰	sample pack ³⁷ rice ⁶³⁵ flavor ¹⁰³² pasta ¹³⁸⁹
smaqsaus.nl	SmaQ B.V.	The website describes SmaQsaus as a curry sauce, a product that is sold.	Sauces & Condiments → Sauces ⁴⁹	sales points ⁸⁸ chef ⁶³¹	The Hague → Segbroek ¹³¹
joppie.nl	Elite B.V.	Joppie® offers two different flavors of sauce: Original and Bit Bit Spicy, which are popular as a garnish for various dishes.	Sauces & Condiments → Sauces ⁴⁹	kibbeling ¹¹⁵ distribution ¹⁰¹¹ magazine ²¹⁸² recipe ⁵¹⁴²	Berkelland → Neede ³⁰⁰
ratuculinair.nl	Ratu Culinair B.V.	Ratu Culinair offers a wide range of different types of sauces, including peanut sauce and satay sauce.	Sauces & Condiments → Sauces ⁴⁹	peanut sauce ²⁵ ingredients ²³⁴⁶ recipe ⁵¹⁴²	South-Holland → Zoetermeer ⁴⁰⁴⁶
metnlintje.nl	metnlintje.nl	The entire website content revolves around the creation and sharing of a delicious mushroom sauce.	Sauces & Condiments → Sauces ⁴⁹ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	mushroom ²²³ cream ²⁶¹ wine ⁴⁴⁷⁶ recipe ⁵¹⁴²
vishandelvanlennep-groningen.nl	Vishandel Van Lennep	The website offers a diverse range of sauces, including mayonnaise, curry and garlic sauce, to complete the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹² Supermarkets & Grocery → Fish Shops ¹⁹¹	kibbeling ¹¹⁵ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
flint-stone.nl	Afhaalbistro Flintstone	The bistro offers a diverse selection of sauces, including gypsy sauce, mushroom sauce, satay sauce and various spicy variations.	Restaurants & Dining → Takeaway Restaurants ²⁴⁰	chicken fillet ³⁵ spareribs ²¹³ satay ³²⁰ steak ³³⁵
thai-athome.nl	Thai at Home	The website offers a wide variety of Thai sauces, such as Cashew Nut Chicken Sauce and Bird’s Eye Chili Sauce.	Asian → Thai ³⁰¹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	ingredients ²³⁴⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶
bistrosaus.nl	Bistrosaus	Bistrosaus produces exclusive, handcrafted sauces focused on enriching meals with diverse flavors.	Online Retail → Food Retail ³⁴⁰ Sauces & Condiments → Sauces ⁴⁹	flavor ¹⁰³² netherlands ¹³⁷⁶ ingredients ²³⁴⁶ recipe ⁵¹⁴² story ⁸²⁸⁵
febo-schagen.nl	Dino's Schagen	The menu includes various sauces such as cocktail sauce, sweet chili sauce, and satay sauce.	Fast Food → Chicken Dishes ⁹²	shake ¹¹² satay ³²⁰ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Schagen ²¹⁸²
nevagroothandel.nl	Neva Saus Groothandel	The wholesaler offers a wide range of sauces in sticks and bottles, targeted at various applications in the hospitality and retail sectors.	Coffee & Tea → Beverages ⁴⁴⁵³ Food & Beverage → Food Industry ⁸³⁵	sticks ²⁴ private label ¹⁸⁴ hospitality ³⁴⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
mondre-gerechten.nl	Mondre gerechten	Extensive recipes for various sauces are presented, such as wok sauce, chili sauce, tomato sauce, and spinach cream sauce.	Mexican & South American → International Cuisine ⁴¹¹	noodles ¹⁹¹ curry ³⁵⁵ rice ⁶³⁵ pasta ¹³⁸⁹ dish ⁵⁹³⁶
drentsekruidensaus.nl	Lorenz and Mariëlle	The Drentse Kruidensaus is a specially made sauce with a unique flavor, developed by Lorenz and Mariëlle in Drenthe.	Sauces & Condiments → Sauces ⁴⁹	dish ⁵⁹³⁶ network ¹¹¹²³
inproba.nl	Inproba B.V.	Inproba produces various types of sauces, including ketchup, soy sauce, and wok sauce.	Turkish Cuisine → International ¹²⁰⁷ Administrative Support → Family Businesses ⁶⁶⁴	marinades ¹⁹ ingredients ²³⁴⁶ production ⁴⁵⁸² recipe ⁵¹⁴² sustainability ¹⁸⁴⁵¹
elite-neede.nl	Elite B.V.	Elite BV produces and sells refined curry sauces and the well-known Joppie sauce.	Food & Beverage → Food Industry ⁸³⁵	artisanal ⁵⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹	Berkelland → Neede ³⁰⁰
senortorres-denhaag.nl	Señor Torres	A selection of homemade sauces, such as Tartara sauce and Picante sauce, are offered.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	bowl ⁴⁸² dessert ⁴⁹⁶ beverage ⁵⁸⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
sudderbijnaklaar.nl	Sudder	Sudder offers a range of different meal sauces, each with a unique flavor and composition.	Food & Diet → Food Waste ⁶⁰ Essential → Food ⁴⁷⁹⁹⁹	portion ³³ flavor ¹⁰³² ingredients ²³⁴⁶ order ⁶⁹¹²	South-Holland → Delft ⁵³⁰⁹
liroy.nl	Liroy B.V.	Lee Kum Kee produces various authentic Chinese sauces, which are popular in restaurants and other foodservice establishments.	Cuisine → Vegetarian ⁶⁹⁷ Sauces & Condiments → Asian Food ¹⁵	chili ¹⁰ noodles ¹⁹¹ brand ¹⁷⁷³⁷
supertaste.nl	Super Taste Trends & Trade	Super Taste creates high-quality sauces for diverse applications in the food sector.	Administrative Support → Family Businesses ⁶⁶⁴ Sauces & Condiments → Sauces ⁴⁹	taste experience ¹⁴ mustard ³³ ingredients ²³⁴⁶ recipe ⁵¹⁴²
hoekje-dieren.nl	T HOEKJE DIEREN	The website is known for the variety of homemade sauces.	Fast Food → Burgers ⁶⁸⁷ Sandwiches & Salads → Snacks ⁶⁹³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Rheden → Dieren ⁴⁶²
hela-shop.nl	Hela	The website sells a variety of sauces, such as ketchup, meal sauce and snack sauce.	Wholesale → Food Products ³⁰³	flavor enhancer ¹⁴ recipe ⁵¹⁴²
chovi.nl	Choví	The website offers a variety of authentic Spanish sauces, developed with a focus on quality and tradition.	Wholesale → Food Products ³⁰³ Sauces & Condiments → Sauces ⁴⁹	recipe ⁵¹⁴²
crazy-grill-breda.nl	Crazy Grill Breda	The website offers a variety of sauces such as BBQ, garlic and pepper sauce.	Cafes → Dutch Restaurants ¹⁰³¹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	side dish ¹¹⁸ spareribs ²¹³ beverage ⁵⁸⁶	North-Brabant → Breda ⁹⁰⁰³
frietjesapp.nl	‘t Gangetje	Various sauces are offered, such as mayonnaise, garlic sauce, and sate sauce, which can be served with the fries.	Fast Food → Burgers ⁶⁸⁷ Coffee & Tea → Beverages ⁴⁴⁵³	menus ²²¹ vegan ⁵⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶	Terneuzen → Axel ²⁰²
happyburgerhouse-spijkenisse.nl	Happy Burger House	Various sauces are offered, including ketchup, BBQ sauce, sour cream sauce, and Andalouse sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Nissewaard → Spijkenisse ¹⁴³³
klausschnitzelhaus-amsterdam.nl	Klaus Schnitzelhaus	Various sauces are available to accompany the schnitzels, such as pepper sauce, cheese sauce and mushroom sauce.	Fast Food → Burgers ⁶⁸⁷ Regional Cuisine → German ¹⁷	schnitzel ⁶¹ deal ⁷⁷³ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
otacos-denhaag.nl	O'Tacos Den Haag	A wide range of sauces, such as cheese sauce, cheddar sauce and Fuego sauce, is available for the orders.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → Mexican ¹⁵¹	fingerfood ⁴¹ taco ⁹² bowl ⁴⁸² meat ²⁰⁵⁵ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
visspecialist-marc-van-mierlo-eindhoven.nl	Visspecialist Marc van Mierlo	A diverse selection of sauces is offered to enhance the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹²	herring ¹⁵⁶ fish ¹¹²¹ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
yumonline.nl	Yum	The website offers a variety of sauces, such as Yum sauce, American sauce, and truffle mayonnaise, which can be added to the burgers.	Sandwiches & Salads → Snacks ⁶⁹³	poke ²² chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	North-Brabant → Vught ¹²³⁰
tuutjevanruudjebezorglijn.nl	Tuutje van Ruudje	The website offers a wide assortment of sauces to enhance the dishes.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gulpen-Wittem → Wijlre ⁶⁶
levo.nl	Levo	The website offers a diverse collection of sauces, including both classic and innovative varieties.	Medical Care & Services → Nutrition ⁵⁷⁹⁹	sample pack ³⁷ fry ⁵⁹ oil ⁹⁷⁰ hospitality ³⁴⁹¹
jonkmansauzen.nl	Jonkman Sauzen	The website describes a wide range of sauces, including cocktail sauce and garlic sauce, specifically formulated for various uses.	Wholesale → Food Products ³⁰³ Produce & Vegetables → Vegetables ¹⁰⁷⁰	dressings ¹⁰ marinades ¹⁹ private label ¹⁸⁴ spices ³⁴⁰
goudenambacht.nl	Gouden Ambacht	The special sauces, such as honey mustard sauce and garlic sauce, are traditionally prepared and add a unique flavor experience.	Cuisine → Vegetarian ⁶⁹⁷ Food → Meat ¹¹²³	meat ²⁰⁵⁵ recipe ⁵¹⁴² assortment ⁷⁷⁹⁹
oliehoornshop.nl	Oliehoorn B.V.	The Oliehoorn webshop specializes in providing various quality sauces.	Sauces & Condiments → Sauces ⁴⁹ Sauces & Condiments → Condiments ¹⁷	dispenser ¹⁸² promotional material ²¹⁷ account ⁵⁷⁸¹ order ⁶⁹¹² webshop ⁸⁶⁴⁸	Hoorn → Zwaag ⁴⁹⁴
zeester-kruisstraat.nl	Zeester	Zeester offers a wide range of sauces, such as Andalouse sauce, Samurai sauce, and Curry sauce, to flavor the dishes.	Japanese → Poke ¹⁹ Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
ccasianmarket.nl	C&C Asian Market	The website sells a wide variety of sauces, essential for preparing many Asian dishes.	Catering & Ready Meals → Asian Cuisine ¹³⁷	noodles ¹⁹¹ spices ³⁴⁰ ingredients ²³⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹
lasagne-recept.nl	lasagne-recept.nl	Lasagna combines flavors of rich sauces and creamy cheeses.	Italian → Pasta ²¹³	lasagna ²³ cheese ¹²⁰⁵ recipe ⁵¹⁴²
disposales.nl	DispoSales	DispoSales sells an extensive assortment of sauces, such as satay sauce and private label products.	Specialty Foods → International Foods ¹⁹ Coffee & Tea → Beverages ⁴⁴⁵³	beverage ⁵⁸⁶ packaging ²²³⁶ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹	Zaanstad → Zaandam ²⁷⁴⁰
originalsinners.nl	ORIGINAL SINNERS®	The website offers a variety of Craft Hot Sauce products, intense sauces with different flavors.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵
artsdivers.nl	Arts divers	A large selection of sauces is available, from simple mustard sauce to advanced sambal-based sauces.	Fish & Seafood → Fresh Food ⁵²	pate ¹⁰ bread ¹⁶²² meal ¹⁶³⁸ salad ²⁴⁴⁴
luckykingenhong.nl	Lucky King and Hong	The dishes are served with various sauces such as oyster sauce and spicy sauce.	Websites → Local Businesses ⁸⁵ Food Delivery → Asian ²⁷²³	beef ³¹⁹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
rimboesauzen.nl	Rimboe Sauzen en Marinades	Rimboe produces artisanal sauces with a unique flavor, distinguishing it from other brands.	Produce & Vegetables → Vegetables ¹⁰⁷⁰ Food → Foodservice & Catering ⁵⁷⁷	marinades ¹⁹ foodservice ³³ flavor ¹⁰³² packaging ²²³⁶ assortment ⁷⁷⁹⁹
smikkelhuus.nl	Snackbar 't Smikkelhuus	Various sauces, including horeca sauces and patat sauce, are available for ordering.	Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Drenthe → Hoogeveen ²²⁹⁴
bidoe-utrecht.nl	Bidoe	The website describes a variety of sauces, including cheesy sauce, BBQ sauce, and Jambie sauce.	Vegan & Vegetarian → Vegan ³⁹⁰ Sandwiches & Salads → Snacks ⁶⁹³	nachos ³⁵ loaded fries ⁴¹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	Netherlands → Utrecht ⁴⁸⁹⁰¹
husselsaus.nl	Husselsaus	The sauce is the main product and receives a lot of attention on the site.	Sauces & Condiments → Sauces ⁴⁹	sales points ⁸⁸ recipe ⁵¹⁴²	Netherlands → Overijssel ³⁹⁶⁴⁹
deburgerpresident.nl	De Burger President	A wide selection of sauces, including homemade cheese sauce, burger sauce, and special sauces, are available to enhance the burgers.	Fast Food → Burgers ⁶⁸⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	burger ¹⁴³¹ price ⁸³²⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
22high-amersfoort.nl	22High	The website describes different types of sauces used in the dishes, such as teriyaki, chili, and sweet and sour sauce.	Japanese → Sushi ⁹⁷¹	poke ²² sashimi ¹⁹⁴ wok ²³¹ sushi ¹⁶⁹⁵	Utrecht → Amersfoort ⁸⁰¹¹
cafetaria-broodjeszaakheideroermond.nl	Cafetaria-Broodjeszaak Heide	Many different sauces are available, including mayonnaise, curry, samurai sauce and satay sauce.	Lunch → Sandwiches ⁴⁶⁶ Quick Bites → Cafeteria ⁹⁰⁶	frikandel ¹⁸ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Limburg → Roermond ²⁶⁰²
cafetariabonnieenclyde-wageningen.nl	Cafetaria Bonnie and Clyde Wageningen	Various sauces are offered with the different dishes, such as garlic sauce, curry sauce, and chili sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Restaurants ⁸⁷	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Wageningen ¹⁹⁴⁹
cafetariabunnik-bunnik.nl	Cafetaria Bunnik	The website showcases a wide range of sauces, from classic mayonnaise to spicy special sauces.	Fast Food → Fries Restaurants ⁸⁷	döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Utrecht → Bunnik ⁸²¹
de-olijftuin-apeldoorn.nl	De Olijftuin	The website offers various sauces, such as peanut sauce, curry sauce and satay sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	shawarma ³³⁵ wrap ⁸²⁶ burger ¹⁴³¹ snack ²⁹¹⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
foodiez-venray.nl	Foodiez Venray	The website offers a wide range of sauces, including Foodiez sauce, BBQ sauce, mayonnaise, and curry sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken burger ¹⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Limburg → Venray ¹⁶⁰¹
frederikambachtelijkefriet-ijmuiden.nl	Frederik Ambachtelijke Friet	The website describes a diverse selection of sauces, such as curry sauce, peanut sauce, and mayonnaise.	Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Velsen → IJmuiden ¹¹⁰⁹
friedtmaastricht.nl	Friedt	A key element of the offering is the variety of sauces, including a traditional Maastricht sauce.	Food Delivery → Delivery ²²²⁷ Cooking & Recipes → Dishes ³³⁵	mayonnaise ²⁷ top ³⁷⁷ farmer ⁶⁶¹	Sittard-Geleen → Geleen ⁹⁷⁸
frietboutiqueamsterdam.nl	Frietboutique Amsterdam	The website offers a variety of sauces, such as mayonnaise, curry sauce and pepper mayonnaise.	Quick Bites → Hair Salon ¹¹²	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
king-kumpir-rotterdam.nl	POTAÉ King Kumpir Poolsterstraat	The website offers an extensive selection of sauces to combine with the Kumpir, such as parsley sauce, tomato sauce, and avocado sauce.	Turkish Cuisine → Fast Food ³²²²	falafel ¹⁰⁸ potato ⁵⁴² salad ²⁴⁴⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
lastvegasutrecht.nl	Last Vegas	The website offers a wide range of sauces, both classic and homemade.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
otacososs.nl	O'Tacos Oss	A key element of the menu options are the various sauces that can be chosen with tacos and fries.	Fast Food → Burgers ⁶⁸⁷	taco ⁹² bowl ⁴⁸² meat ²⁰⁵⁵ fries ²⁷⁵³	North-Brabant → Oss ²⁹⁶²
plazazuid-bussum.nl	PLAZA ZUID	Burgers and fries can be ordered with different sauces, such as BBQ, American garlic, and satay sauce.	Fast Food → Burger Restaurants ³⁴⁶ Sandwiches & Salads → Snacks ⁶⁹³	milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gooise Meren → Bussum ²²⁰¹
santamaria-diemen.nl	Santa Maria Diemen	Various sauces, such as garlic sauce, onion sauce and sambal, are available with the grilled sandwiches.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	calzone ⁹⁰ kebab ²⁷⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Diemen ⁹⁷⁵
sonmat-utrecht.nl	SONMAT	SONMAT offers a wide range of Korean sauces, including homemade gochujang and soy garlic sauces, accompanying their various dishes.	Asian → Korean ⁵¹ Food Delivery → Korean Restaurants ³³	bibimbap ¹⁶ noodles ¹⁹¹ rice ⁶³⁵	Netherlands → Utrecht ⁴⁸⁹⁰¹
thrillgrilltogo-rotterdam.nl	Thrill Grill To Go	A wide range of sauces, including mayonnaise, Aji Amarillo sauce and black garlic mayonnaise, are available to accompany the hamburgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-barrier.nl	De Barrier	The website describes the many different sauces that can be added to the fries.	Quick Bites → Cafeteria ⁹⁰⁶ Sandwiches & Salads → Sandwich Shops ²²⁹	croquette ¹³⁶ hamburger ³⁶⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸
basbeersandsteaks-barneveld.nl	B.A.S. Beers and Steaks	Various types of sauces are offered, such as BBQ sauce, sweet chili sauce, chili sauce, and satay sauce.	Fast Food → Burgers ⁶⁸⁷	spareribs ²¹³ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Barneveld ²⁷⁸¹
sushima.nl	SUSHIMA	The website emphasizes the use of homemade sauces, including Sriracha mayo and Roasted sesame sauce.	Japanese → Sushi ⁹⁷¹	tuna ³⁶ poké bowl ¹⁶⁹ salmon ¹⁸⁵ vegetables ¹⁴¹⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
spicydutchman.nl	Spicy Dutchman	The website offers a broad assortment of spicy sauces, ranging from classic flavors to unique combinations.	Cooking & Recipes → Spices ¹⁴⁴	chili ¹⁰ gift box ²⁴³ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
remia.nl	Remia	The website offers a wide variety of different types of sauces.	Sauces & Condiments → Sauces ⁴⁹	dressings ¹⁰ fats ²⁰ prize ⁶²¹ job vacancies ¹²⁴¹
granditalia.nl	Grand’Italia	The website offers a variety of Italian sauces, such as pesto and tomato sauce.	Cuisine → Vegetarian ⁶⁹⁷	pesto ⁴² pasta ¹³⁸⁹ recipe ⁵¹⁴²
sambalbinkie.nl	Sambal Binkie	The website offers a wide range of sauces that can be completely customized to your liking.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	sambal ⁵⁴ personalize ²⁹¹ flavor ¹⁰³² ingredients ²³⁴⁶ order ⁶⁹¹²
red-phoenix.nl	Red Phoenix	A comprehensive selection of sauces is a core component of the website's offerings, designed to enhance a variety of dishes.	Japanese → Sushi ⁹⁷¹ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	noodles ¹⁹¹ recipe ⁵¹⁴²
hansel.nl	Hansel Salades en Sauzen BV	The website describes the extensive range of sauces that Hansel offers, ranging from classic flavors to innovative recipes.	Hospitality → Suppliers ¹⁰⁵⁷ Preserved Foods → Processed Foods ⁵²	artisanal ⁵⁶ salad ²⁴⁴⁴	Zaanstad → Zaandam ²⁷⁴⁰
easygrill.nl	Easygrill	Various sauces are offered to accompany the meat dishes.	Food → Supermarkets & Grocery ³⁵⁶⁸	meat ²⁰⁵⁵ salad ²⁴⁴⁴ package ⁶¹¹² price ⁸³²⁸
chicksdenbosch.nl	Chicksdenbosch	An extensive selection of sauces can be found on the website.	TravelBrands → Deals ³⁴⁹ Sauces & Condiments → Sauces ⁴⁹	dip ⁴⁹ organizer ¹⁶⁷ spices ³⁴⁰ deals ¹⁰⁷⁰
rasa-oisterwijk.nl	Rasa Senang Oisterwijk	Indonesian dishes are often served with unique and flavorful sauces like ketjap sauce, coconut sauce, and chili-mayo.	Food Delivery → Indonesian ⁵⁰² Events → Places ¹²¹⁹	weekly menu ³⁷ rice table ²⁷⁷ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	North-Brabant → Oisterwijk ¹⁴²²
dethuistoko.nl	DeThuisToko	The website offers a variety of sauces and marinades, including peanut sauce, bumbu, wok sauce and chili sauce.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	noodles ¹⁹¹ beverage ⁵⁸⁶ rice ⁶³⁵ snack ²⁹¹⁶
kunukuspices.nl	Kunuku Spices	The website features a selection of delicious Caribbean hot sauces, such as Papaya Hot Sauce and Tropical Hot Sauce.	Cooking & Recipes → Spices ¹⁴⁴ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	seasoning ¹⁵ marinade ³⁸ blend ¹⁴⁵ spices ³⁴⁰
biobandits.nl	Bio Bandits	Bio Bandits specializes in the production of a diverse range of sauces, including those with unique flavor combinations like chili garlic and curry.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵ Sauces & Condiments → Condiments ¹⁷	mayonnaise ²⁷ organic ⁴⁷¹ flavor ¹⁰³²
broodjeshuissunshine.nl	Broodjes huis Sunshine	Various sauces are offered to fill the sandwiches, such as sate sauce, chili sauce, and ham sauce.	Cafes & Lunch → Deli ²³ Sandwiches & Salads → Sandwich Shops ²²⁹	baguette ³⁵ sandwich ⁴⁰⁹⁸	Drenthe → Emmen ³³⁴⁸
justribs-voorburg.nl	Just Ribs	A wide range of sauces is available, including mayonnaise, ketchup and curry sauce.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	wing ⁴² rib ¹⁹¹ satay ³²⁰ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Leidschendam-Voorburg → Voorburg ¹²³⁴
station134.nl	Station 134	Fries are served with various types of sauces, such as fries sauce, curry, ketchup and war sauce.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family pack ²⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Oldebroek → Spoorlaan ³²³
tatjesonwheels.nl	Tatjes on Wheels	The company uses delicious, homemade sauces, including peanut sauce and sauces from Oliehoorn.	Fast Food → Fries ⁹⁴⁹ Vegetables → Potatoes ¹⁰⁰	potato ⁵⁴² oil ⁹⁷⁰ fries ²⁷⁵³ event ⁴⁵¹⁹⁹
eetwinkeldehorizon.nl	Eetwinkel De Horizon	The shop offers various types of sauces with their fries, such as fries sauce, curry sauce and apple sauce.	Local & Regional → Regional Events ⁸²¹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	kidsbox ³⁸ fries ²⁷⁵³ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Montferland → Zeddam ¹⁵⁵
weesperfriet.nl	Weesper Friet	A variety of sauces are offered, including mayonnaise, curry and special sauces like Joppiesaus.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ hamburger ³⁶⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Amsterdam → Weesp ¹⁰⁰⁵
maozfalafelnijmegen.nl	Maoz Nijmegen	Maoz Nijmegen offers a wide range of sauces, including mint, onion, sesame, and mango sauces. (1 sentence)	International Cuisine → Middle Eastern Cuisine ⁷² International → Turkish ⁴¹⁶	pita bread ⁵⁰ falafel ¹⁰⁸ vegan ⁵⁰⁸ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
cafetaria-heikant-tilburg.nl	Cafetaria-Resto De Heikant	De Heikant offers a wide assortment of sauces, including Belse mayo, satay sauce and beef stew sauce.	Fast Food → Fries Restaurants ⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
doubleacesfood.nl	Double Aces Food	The website describes the company as a producer of sauces, particularly Eastern sauces based on Japanese soy sauce and fresh chili peppers, aiming to capture authentic Asian flavors.	Hospitality → Suppliers ¹⁰⁵⁷ Cooking & Recipes → Spices ¹⁴⁴	marinades ¹⁹ raw materials ⁴⁴⁶ knowledge ³⁵²⁸ innovation ⁴⁶⁵⁹	Gelderland → Ede ⁵¹⁰⁴
dirksvis.nl	Dirk's Vis & Meer Beverwijk	A variety of sauces are available to combine with the dishes, including cocktail sauce and honey mustard.	Sandwiches & Salads → Snacks ⁶⁹³ Restaurants & Dining → Seafood Restaurants ⁶¹²	snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Beverwijk ¹⁶⁹⁰
steakhousepizzeriaoost-amsterdam.nl	Steakhouse Pizzeria Oost	Various sauces are available, such as pizza sauce, satay sauce, and cream sauce, which can be used with the dishes.	Fast Food → Fries Restaurants ⁸⁷	top ³⁷⁷ pasta ¹³⁸⁹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
247burgerhouseamsterdam.nl	24/7 BurgerHouse	The website offers a selection of homemade sauces, such as BBQ sauce and a fresh special sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	shoarma ²⁵⁴ wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
arkoubisvisplaza-s-gravenhage.nl	Arkoubi's Visplaza Den Haag	The website offers a variety of sauces, including garlic sauce, cocktail sauce and katjang sauce.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	wok dish ⁶⁶ soup ¹⁰⁴³ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
baramaribo-almere.nl	Baramaribo	The website offers a variety of sauces, such as cheese sauce, sambal and spicy mayonnaise.	Fast Food → Burgers ⁶⁸⁷	combo meal ⁶⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
burgerssandwichtogo-zaltbommel.nl	Burgers & Sandwich To Go	The menus contain different sauce variations, such as the 'crispy chicken sauce' and the 'samurai sauce'.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	halal ¹⁶⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Zaltbommel ¹²³¹
cafetaria-de-overweg-leeuwarden.nl	Lekker Leeuwarden	The website describes various types of sauces, such as ‘cheese sauce’, ‘BBQ sauce’ and ‘peanut sauce’.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	combo ⁵⁹ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
cafetaria-lili-utrecht.nl	Cafetaria Lili	The menu describes a wide assortment of sauces served with the dishes.	Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariabol-broekoplangedijk.nl	Cafetaria BOL	The website offers various sauces to pour over the dishes.	Fast Food → Fries ⁹⁴⁹	gyro ⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Dijk en Waard → Broek op Langedijk ²⁴³
damnliciousutrecht.nl	Damnlicious	Various sauces, such as Truffle mayonnaise, Damn sauce, andalouse, sate sauce, and siracha sauce, are used.	Fast Food → Burger Restaurants ³⁴⁶ Fine Dining & Gastronomy → Gastronomy ⁵⁹⁹	burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
dekoningsandwich-tilburg.nl	De Koning Sandwich	The website emphasizes the various sauces used in the dishes, such as the Koning avocado sauce and Truffle mayo sauce.	Lunch → Sandwiches ⁴⁶⁶	burger ¹⁴³¹ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
delhiindianamstelveen.nl	Delhi Indian	Various sauces, such as yogurt-mint sauce, tamarind sauce, curry sauce and butter, are used in the dishes.	Food Delivery → Delivery ²²²⁷ Food Delivery → Indian Cuisine ⁵⁴³	lamb ¹⁰⁰ tandoori ¹¹⁴ curry ³⁵⁵ rice ⁶³⁵ chicken ⁹⁴⁴	North-Holland → Amstelveen ³¹⁸⁰
dinges-express-ijmuiden.nl	Dinges Express	The website offers a variety of sauces, including garlic sauce and tomato onion sauce.	Food Delivery → Delivery ²²²⁷ Mediterranean & Middle Eastern → Takeout ²⁸⁶	pita ¹⁹⁹ shoarma ²⁵⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Velsen → IJmuiden ¹¹⁰⁹
feboutrecht.nl	FEBO Utrecht	Various sauces, such as mustard sauce and curry sauce, are used with burgers and other dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → FEBO ²⁴	croquette ¹³⁶ milkshake ¹⁹⁵ burger ¹⁴³¹ bread ¹⁶²² fries ²⁷⁵³	Netherlands → Utrecht ⁴⁸⁹⁰¹
fitmaaltijdkatwijk-katwijkaanzee.nl	Fitmaaltijd Katwijk	The website offers a selection of different sauces, such as sriracha mayonnaise and teriyaki sauce.	Mexican & South American → Mexican ¹⁵¹	side ⁷⁴ poké bowl ¹⁶⁹ meal ¹⁶³⁸ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Katwijk → Katwijk aan Zee ⁶¹⁶
fomofood-almere.nl	Fomo Food	Various sauces are offered with the salons and plates, such as garlic sauce and BBQ sauce.	Quick Bites → Hair Salon ¹¹² Turkish Cuisine → Fast Food ³²²²	lamb ¹⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸ salon ⁵⁵⁴¹	Flevoland → Almere ⁷⁷⁶⁵
food-runner-denbosch.nl	Food Runner	Various sauces are offered, including cheese sauce, BBQ sauce, and homemade sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	side ⁷⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
franggoamsterdam.nl	Franggo	The website offers a diverse selection of sauces, including Piri-Piri, Butter Lemon, and Pirinaise.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → International Cuisine ⁴¹¹	dessert ⁴⁹⁶ chicken ⁹⁴⁴ bread ¹⁶²² fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
hamwikiosk-barendrecht.nl	Hamwi Kiosk	A wide range of sauces are offered, including Syrian garlic sauce and paprika sauce.	International Cuisine → Middle Eastern Cuisine ⁷² Quick Bites → Food Trucks ⁶²³	salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Barendrecht ¹⁶⁵³
jackjonespizza-rotterdam.nl	Jack & Jones Pizza Rotterdam	Various sauces are offered, including tomato sauce and cream sauce, allowing customers to customize the flavor of their dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹	spareribs ²¹³ shrimp ²¹⁹ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
jordysplaza-eindhoven.nl	Jordy's Plaza	Various sauces are available with the dishes, ranging from satay sauce to garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	chicken satay ²⁶ plate ⁷⁸⁷ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
krioyo-rotterdam.nl	Krioyo	The dishes are served with a diverse sauce assortment, including rosada sauce.	Food Delivery → Delivery ²²²⁷ Food Delivery → Indonesian ⁵⁰²	sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
levita073s-hertogenbosch.nl	Levita 073	The website offers a selection of sauces, such as tomato sauce and cream sauce.	Fast Food → Fries ⁹⁴⁹	toppings ¹⁵³ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
lordoffries-tilburg.nl	Lord Of Fries	The website offers a wide selection of sauces, including Andalouse sauce, Katjang sauce, and Ranch sauce, which can be added to the fry order.	Fast Food → Fries ⁹⁴⁹	loaded fries ⁴¹ fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹²	North-Brabant → Tilburg ⁸⁷⁵⁹
menaracatering-hilversum.nl	Menara Catering	The dishes are served with various sauces, including Andalouse sauce and garlic sauce.	Sandwiches & Salads → Salads ¹³³	wrap ⁸²⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
merza-amsterdam.nl	Merza	Merza offers various sauces, which are served with the ordered dishes, including Shoarma sauces and yogurt sauces.	Turkish Cuisine → Fast Food ³²²²	mezze ³⁹ shoarma ²⁵⁴ kebab ²⁷⁶ rice ⁶³⁵ salad ²⁴⁴⁴	North-Holland → Amsterdam ⁴¹²⁵³
mister-burger-shake-hilversum.nl	Mister Burger & Shake	The dishes are served with various sauces, including mustard sauce and Mr. Burger N' Shake sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
mosob-arnhem.nl	Mosob Arnhem	The dishes are served with different sauces, such as tomato sauce, cream sauce, and spicy sauce.	Pastries & Baked Goods → Menus ²²³ Cooking & Recipes → Cuisine ¹¹⁴⁷	injera ²¹ vegetarian dishes ³⁴ meat dishes ⁶⁶ pasta ¹³⁸⁹	Gelderland → Arnhem ⁸⁶⁸⁰
otacos-den-haag-loosduinen.nl	O'Tacos Den Haag Loosduinen	Various sauces are available for the tacos and fries, such as BBQ, Algerian and Fuego sauce.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → Mexican ¹⁵¹	nugget ¹⁴ taco ⁹² tender ³²⁹ meat ²⁰⁵⁵ fries ²⁷⁵³	The Hague → Loosduinen ³⁹⁵
otacosleeuwarden-leeuwarden.nl	O'Tacos Leeuwarden	The website describes a wide range of sauces that can be added to the tacos or fries.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	tenders ⁷⁵ taco ⁹² bowl ⁴⁸² cheese ¹²⁰⁵ fries ²⁷⁵³	Friesland → Leeuwarden ⁶⁰⁶⁸
pastamani.nl	Pastamani	Pastamani offers a selection of different sauces, including Ragu alla Bolognese and Amatriciana, to serve with the pasta.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Sauces & Condiments → Sauces ⁴⁹	pasta ¹³⁸⁹ meal ¹⁶³⁸ recipe ⁵¹⁴² video ⁶⁷¹⁴
patty-n-bun-maastricht.nl	Patty 'n Bun	The menu includes various sauces, such as buffalo sauce, BBQ sauce, and gochujang mayo, which enhance the flavors of the dishes.	Fast Food → Burgers ⁶⁸⁷	smashburger ¹⁷ tortilla ²² wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹	Limburg → Maastricht ⁶⁰⁰⁸
pittigeten.nl	PITTIGETEN.NL	The site introduces various spicy sauces, often in combination with the used peppers.	Horticulture & Floristry → Crops ⁹⁶ Agriculture → Greenhouse & Protected Cultivation ¹⁵⁸	pepper ⁵⁵ recipe ⁵¹⁴² blog ¹³³⁹²
restariathof-eindhoven.nl	Restaria 't Hof	The website offers various sauces that are presented with the dishes	European → Dutch ⁴⁸	main course ¹⁰² burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
sevenburgers-roermond.nl	Seven Burgers	Various sauces are available to top the burgers.	Japanese → Sushi ⁹⁷¹ Online Retail → Food Retail ³⁴⁰	side dish ¹¹⁸ burger ¹⁴³¹ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Limburg → Roermond ²⁶⁰²
shoarmaboer-haarlem.nl	Angry Burger	The website describes various sauces such as sweetchili-mayonnaise, honeylemon-sauce, and barbecue sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	bun ²⁷ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
slagerijvetamsterdam.nl	Slagerij Vet	The dishes are enhanced with a diverse selection of sauces, including Zeedijk sauce and honey mustard sauce.	Quick Bites → Cafeteria ⁹⁰⁶ Grilling & Steaks → Meat Restaurants ⁵⁷	meat products ²⁷² bread ¹⁶²² sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
snackbar-de-achterstraat.nl	Snackbar de Achterstraat	The website describes a diverse range of sauces, such as curry, mayonnaise, peanut sauce, and garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken satay ²⁶ milkshake ¹⁹⁵ shoarma ²⁵⁴ burger ¹⁴³¹ fries ²⁷⁵³	Utrecht → Woerden ²⁶⁴²
snackbistrostadhuisplein-almere.nl	Snackbistro Stadhuisplein	Various sauces are offered, including apple sauce, french fries sauce, satay sauce and vegan mayonnaise.	Fast Food → Fries ⁹⁴⁹	family pack ²⁴ menus ²²¹ appetizer ⁵⁵⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Flevoland → Almere ⁷⁷⁶⁵
snackroom101.nl	Snackroom 101 Deventer	The website describes the various sauces used with the dishes, such as spicy sauce and satay sauce.	Catering & Ready Meals → Takeaway ⁴⁰⁹	points ⁶¹² wrap ⁸²⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Overijssel → Deventer ⁴⁷⁵¹
tvlammetjeaalsmeer.nl	t Vlammetje	The website offers a wide selection of sauces, including satay sauce and various chili sauce variations.	Catering & Ready Meals → Takeaway ⁴⁰⁹	spring roll ⁸² wok ²³¹ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Aalsmeer ¹⁷¹⁰
uncle-joes-hulst.nl	Uncle Joe's Hulst	The website describes the different sauces used in the dishes, such as hamburger sauce and BBQ sauce.	Fast Food → FEBO ²⁴	burger ¹⁴³¹ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zeeland → Hulst ⁷⁴¹
universalspices.nl	Universal Spices	Universal Spices supplies high-quality sauces to professionals in the culinary world.	E-Commerce → B2B ¹¹⁸ Sauces & Condiments → Asian Food ¹⁵	chili ¹⁰ netherlands ¹³⁷⁶ ingredients ²³⁴⁶ restaurant ¹¹²¹⁵	North-Brabant → Eindhoven ¹¹⁸⁴⁵
veranda-cooking.nl	Veranda-Cooking	The website offers recipes for many different sauces, such as garlic sauce, Hoisin sauce and Satay sauce.	Cuisine → Vegetarian ⁶⁹⁷ Fine Dining & Gastronomy → Gastronomy ⁵⁹⁹	stew ⁶² kebab ²⁷⁶ grill ⁵⁶² bread ¹⁶²² dish ⁵⁹³⁶
snackbarrondeweibos.nl	Pay Fast Forward B.V.	A variety of sauces are available such as mayonnaise, curry, ketchup, and peanut sauce.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Snacks ⁶⁹³	milkshake ¹⁹⁵ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Voorne aan Zee → Rockanje ²⁹⁸
lapuertaarnhem.nl	La Puerta Arnhem	Various sauce variations are offered, such as curry, chili sauce, and mayonnaise.	Fast Food → Fries ⁹⁴⁹ Online Ordering → Restaurant Orders ¹⁸	rib ¹⁹¹ shrimp ²¹⁹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
lunchroom-panache-tilburg.nl	Lunchroom Panache	A variety of sauces are offered, from classic mayonnaise and mustard to specialty sauces such as satay sauce and garlic sauce.	Lunch → Sandwiches ⁴⁶⁶ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	omelet ²⁰ hamburger ³⁶⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
misueno-amsterdam.nl	Mi Sueno	A wide range of sauces is available, from pepper sauce to Mexican sauce.	International Cuisine → Spanish ³⁶ Cuisine → Vegetarian ⁶⁹⁷	spareribs ²¹³ steak ³³⁵ burger ¹⁴³¹ salad ²⁴⁴⁴ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
leqrpuur.nl	Leqrpuur	Leqrpuur makes a wide range of homemade sauces, including tomato sauce and arrabiata, using fresh ingredients.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	granola ⁶⁵ soup ¹⁰⁴³ ingredients ²³⁴⁶ recipe ⁵¹⁴²
bades-denhaag.nl	Bades	The menu offers a wide selection of sauces, such as Anchovy sauce, Samurai sauce, Sambal, Garlic sauce and Mayonnaise.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	shake ¹¹² panini ¹⁵⁶ wrap ⁸²⁶ burger ¹⁴³¹ salad ²⁴⁴⁴	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbarholendrecht-amsterdam.nl	Snackbar Holendrecht	Various sauces are available to serve with the dishes, such as BBQ sauce, satay sauce and curry sauce.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
pizza-express-snackpoint.nl	Snackpoint de Korenbloem	A wide range of sauces are available, such as friesauce, chili sauce and jollop sauce.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Ede → Bennekom ⁵⁵⁷
cafetariasjors-utrecht.nl	Cafetaria Sjors	A variety of sauces are available to be used with the dishes.	Cafeteria → Dutch Cafeteria ¹²² Sandwiches & Salads → Snacks ⁶⁹³	croquette ¹³⁶ wok ²³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
osfa.nl	OSFA	The website describes a particularly garlic sauce, ‘The Best Garlic Sauce in the World’, which is presented as effective against vampires.	Fast Food → Burgers ⁶⁸⁷ Coffee & Tea → Beverages ⁴⁴⁵³	burger ¹⁴³¹ ai ²¹⁸¹ recipe ⁵¹⁴²
jeanbaton.nl	Jean Bâton	The shop offers a wide variety of cold and warm sauces of different types.	Wholesale → Food Products ³⁰³ Sauces & Condiments → Sauces ⁴⁹	mayonnaise ²⁷ truffle ³³ dress ⁴⁰⁵ barbecue ¹¹⁷⁵ recipe ⁵¹⁴²
sharepointgeek.nl	Pizza Bak	The website provides instructions on making a traditional tomato sauce and other sauces suitable for pizza.	Food Delivery → Italian Restaurant ¹⁰⁴⁰	dough ¹²³ toppings ¹⁵³ technique ²¹⁵⁷ pizza ⁴¹⁵⁸
woktogorotterdam.nl	Wok to Go Rotterdam	A wide range of sauces are offered, like Teriyaki, Sweet Chili, and Red Curry, adding to the variety of available dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Food Delivery → Delivery ²²²⁷	wok ²³¹ points ⁶¹² chicken ⁹⁴⁴ deals ¹⁰⁷⁰ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
mypasta.nl	My Pasta Home	The restaurant offers an extensive selection of flavorful sauces that complement the pasta dishes.	Italian → Pasta ²¹³	pasta ¹³⁸⁹ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
vleminckxdesausmeester.nl	Vleminckx de Sausmeester	The shop distinguishes itself by offering an extensive and diverse selection of sauces to complement the fries.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	fries ²⁷⁵³ shop ⁶⁴⁸³	North-Holland → Amsterdam ⁴¹²⁵³
reitz.nl	Reitz	The restaurant offers an extensive selection of sauces, both cold and hot.	Fast Food → Fries ⁹⁴⁹ Context ¹⁶¹³⁹⁴	tradition ⁷³⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Maastricht ⁶⁰⁰⁸
amesi.nl	Amesi Delicatessen	A wide range of Italian sauces, such as pesto, tomato sauce, and truffle sauce, are available.	Dairy & Cheese → Delicacies ¹²⁷ Spirits & Oils → Olive Oil ¹³⁴	delicacies ²⁷³ olive oil ³⁴⁶ gift package ⁵³⁰ pasta ¹³⁸⁹ wine ⁴⁴⁷⁶
goudasglorie.nl	Gouda’s Glorie	Gouda’s Glorie offers a variety of sauces, such as snack and mayonnaise varieties, suitable for different dishes and snacks.	Sauces & Condiments → Sauces ⁴⁹	foodservice ³³ bread ¹⁶²²
babylon-hoogeveen.nl	Babylon Hoogeveen	Various sauces, such as garlic sauce and whiskey sauce, are offered to enhance the dishes.	Turkish Cuisine → Fast Food ³²²² Bars & Pubs → Casual Dining ²¹⁷	kebab ²⁷⁶ shawarma ³³⁵ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸
franggo.nl	Franggo	Franggo offers a variety of sauces, including a free first sauce.	Fast Food → Burgers ⁶⁸⁷ Turkish Cuisine → International ¹²⁰⁷	side ⁷⁴ grill ⁵⁶² chicken ⁹⁴⁴ family ⁶⁴⁶²	South-Holland → Rotterdam ²⁵⁰⁴⁸
chickentonight.nl	Zwanenberg	The website offers a range of 8 different sauces that can serve as the base for various dishes.	Cuisine → Vegetarian ⁶⁹⁷ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	chicken ⁹⁴⁴ meal ¹⁶³⁸ recipe ⁵¹⁴²
heertjefriet.nl	Heertje Friet	Heertje Friet offers a wide selection of sauces with the fries.	Fast Food → Fries ⁹⁴⁹ Context ¹⁶¹³⁹⁴	vegan ⁵⁰⁸ potato ⁵⁴² fries ²⁷⁵³	Amsterdam → Center ⁹⁹⁰
supperfood.nl	Supperfood	Various sauces are offered, including Sambal, Soy Sauce, and Wok Sauce.	Wholesale → Food Products ³⁰³	dressings ¹⁰ canned goods ¹⁷ syrups ³⁰ oil ⁹⁷⁰ production ⁴⁵⁸²
saucecompany.nl	Saucecompany B.V.	Saucecompany produces various types of sauces based on client needs.	Engineering → Product Development ⁵⁴³	private label ¹⁸⁴ product development ²⁵⁶ packaging ²²³⁶	North-Brabant → Deurne ¹³²⁹
spiceitup.nl	Spice it up!	The website offers a diverse range of delicious sauces, suitable for various dishes and as a dip.	Sandwiches & Salads → Prepared Foods ³⁹ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	package ⁶¹¹² kitchen ⁶⁴⁴³	Lochem → Gorssel ²⁸³
hawaiipokebowl.nl	Hawaii Poké Bowl	Customers can personalize their bowls by selecting from a selection of homemade sauces.	Cafes → Dutch Restaurants ¹⁰³¹ Mexican & South American → Mexican ¹⁵¹	salmon ¹⁸⁵ poke bowl ³⁰⁸ ingredients ²³⁴⁶ reservation ³³⁷³	South-Holland → The Hague ¹⁹⁸⁹⁸
frietdistrict.nl	Friet District	The restaurant offers a variety of homemade sauces such as truffle mayonnaise, peanut sauce, and lemon mayonnaise.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ restaurant ¹¹²¹⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
vrijdagburgerdag.nl	N/A	Recipes for various sauces, from BBQ sauce to chili sauce, are included to enhance the flavor of the hamburgers.	Blogs → Food Blogs ²⁴⁶ Cuisine → Vegetarian ⁶⁹⁷	top ³⁷⁷ burger ¹⁴³¹ recipe ⁵¹⁴²
vandils.nl	Van Dils worsten & saus	Van Dils' warm curry sauce is a signature product that has been popular since 1965, especially known from the German Oktoberfest.	Suppliers → Food Suppliers ¹⁹ Food → Sausage Products ¹²	sausage ²⁵⁶ craftsmanship ¹⁸⁵⁸
smashbro.nl	Smash Bro’s Rotterdam	The dishes are served with homemade sauce, such as hot sauce and burger sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
wokforgo.nl	Wok for Go Nijmegen	The website describes six different sauces that customers can choose from, ranging from sweet to super spicy.	Food Delivery → Asian ²⁷²³	bami ¹⁴⁴ wok ²³¹ ingredients ²³⁴⁶ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
ramenbrothers.nl	Ramen Brothers Noodle Bar	Ramen Brothers utilizes a homemade base sauce, or ‘motodare’, to give their ramen a distinctive flavor, influenced by a renowned Singaporean ramen chef.	Asian → Japanese ¹⁴⁸⁸ Fine Dining & Gastronomy → Dining ⁶⁷⁷	broth ³⁷ ramen ¹⁰⁶ noodles ¹⁹¹ beer ²⁸⁸⁷ restaurant ¹¹²¹⁵	North-Holland → Haarlem ⁸⁶⁷⁴
theindianbowlcompany.nl	The Indian Bowl Company Amsterdam	The website offers a variety of sauces, including tandoori spices, mint yogurt sauce, and chili-mango sauce.	Cuisine → Vegetarian ⁶⁹⁷	vegetarian ³³⁷ bowl ⁴⁸² rice ⁶³⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
paradijshof.nl	PARADIJSHOF	A ‘Sauces’ category is included, indicating a diverse range of sauce offerings.	Food Delivery → Indian Cuisine ⁵⁴³ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	marinades ¹⁹ chutney ²⁶ ayurveda ³⁰¹ curry ³⁵⁵ tea ¹¹⁴⁶
dik-en-lang-verse-vlaamse-friet-eindhoven.nl	Dik en Lang Verse Vlaamse Friet	The website offers a wide selection of sauces to enhance the meal.	Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cafetaria-t-vosje-groningen.nl	Cafetaria 't Vosje Groningen	A wide variety of sauces are available to pour over the dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Grilling & Steaks → Grillroom ⁸⁷	shoarma ²⁵⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
pizzapazzani.nl	Pizzapazzani B.V.	The website sells different types of sauces, including pizza and pasta sauces.	Kitchen → Kitchen Appliances ⁷²⁴ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	pizza dough ¹³ olive oil ³⁴⁶ pizza ⁴¹⁵⁸ accessories ¹²⁹⁷⁵
holkamp.nl	Martin	The website covers various sauces, including mushroom sauce, Saoto soup and a homemade hoisin sauce with peanut butter.	Cuisine → Vegetarian ⁶⁹⁷ Cooking & Recipes → Cooking Techniques ²⁵	side dish ¹¹⁸ soup ¹⁰⁴³ meal ¹⁶³⁸ film ³⁰⁰⁷ recipe ⁵¹⁴²
tokoasiaonline.nl	Toko Asia Online	Toko Asia Online offers a large selection of Asian sauces, such as oyster sauce and gado gado sauce.	Kitchen → Kitchen Supplies ¹⁰⁵ Food Delivery → Asian ²⁷²³	spices ³⁴⁰ rice ⁶³⁵ ingredients ²³⁴⁶ dish ⁵⁹³⁶
hetpleintjedemeern.nl	Cafetaria 't Pleintje Meern	Various sauces are offered to top the fries, such as garlic sauce, mayonnaise, and 'oorlog' sauce.	Quick Bites → Cafeteria ⁹⁰⁶ Turkish Cuisine → Fast Food ³²²²	portion ³³ meal ¹⁶³⁸ fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Vleuten - De Meern → De Meern ⁵⁴¹
nasq.nl	NasQ	The store offers a variety of BBQ sauces, such as the NOSKOS Original BBQ Sauce.	Tools → Knives ¹⁰⁷ Dogs → Supplies ¹⁰⁰⁵	knife ²⁴² gloves ²⁹²
hamburgerrecepten.nl	Hamburgerrecepten.nl	The website describes recipes for hamburger sauce, including classic, special and spicy varieties.	Cuisine → Vegetarian ⁶⁹⁷	top ³⁷⁷ burger ¹⁴³¹ recipe ⁵¹⁴² blog ¹³³⁹²
pidecenter-arnhem.nl	Pide Center	The dishes are served with various sauces, including a basic sauce and special sauces for specific dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	pide ⁵⁶ beverage ⁵⁸⁶ box ¹⁹⁸² pizza ⁴¹⁵⁸	Gelderland → Arnhem ⁸⁶⁸⁰
partyservicefrijns.nl	Partyservice Frijns	A variety of sauces are available, such as garlic sauce, cocktail sauce and satay sauce.	Parties → Party Supplies ¹¹⁰⁸ Supermarkets & Grocery → Butchers ⁷⁴⁷	party box ³⁵ sausage ²⁵⁶ meat products ²⁷² bbq ⁹⁰⁸ buffet ¹⁷⁴⁷
sepupu.nl	Sepupu	Sepupu offers a variety of sauces in different flavors, packaged in cups and weckpots.	Sandwiches & Salads → Snacks ⁶⁹³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	spring rolls ¹⁴¹ handmade ²⁷⁰ online shop ¹³¹⁰ ingredients ²³⁴⁶
thekapsalonfactory-nijmegen.nl	Smash Burger Nijmegen	The website describes a wide range of sauces, including war, joppiesaus and total sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Nijmegen ⁹³⁸⁴
monopolyburger.nl	Monopoly Burger Amsterdam	Various sauces, including Monopoly Sauce, BBQ Sauce, and Chili Mayo, are offered as toppings for the burgers.	Fine Dining & Gastronomy → Dining ⁶⁷⁷ Grilling & Steaks → American ⁸⁵	chicken ⁹⁴⁴ burger ¹⁴³¹ table ¹⁷⁷⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
woktogo-utrecht.nl	Wok To Go Utrecht Mariaplaats	Various sauces are available for the wok dishes, such as teriyaki sauce and curry sauce.	Asian → Chinese ⁴¹⁵	wok ²³¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
lamsbout.nl	BlueBird Media BV	The website describes various sauces that accompany lamb loin, such as a balsamic sauce, to enhance the dish’s flavor.	Meat → Lamb ¹⁴	feast ²² herbs ⁹²⁴ recipe ⁵¹⁴²
grillroomindie-groningen.nl	Grillroom Indië	Several sauces are available to combine with the dishes, including spicy sauce and garlic sauce.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Quick Bites → Cafeteria ⁹⁰⁶	main course ¹⁰² shawarma ³³⁵ hamburger ³⁶⁴ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
kwalitaria-zwolle.nl	Kwalitaria AA Landen	Various sauces are used with the dishes, such as peanut sauce, BBQ sauce, and pesto mayo.	Fast Food → Burgers ⁶⁸⁷ Pastries & Baked Goods → Menus ²²³	shawarma ³³⁵ chicken ⁹⁴⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³	Overijssel → Zwolle ⁷³⁹⁵
reneindekeuken.nl	René in de Keuken	Various sauces, such as peanut sauce and gochujang sauce, play an important role in the recipes.	Blogs → Food Blogs ²⁴⁶ Cooking & Recipes → Outdoor Cooking ²⁹	wrap ⁸²⁶ vegetables ¹⁴¹⁶ camp ²⁴⁶⁶ recipe ⁵¹⁴²
bbqshopflakkee.nl	BBQ Shop Flakkee	BBQ Shop Flakkee offers a wide range of BBQ sauces to suit every taste.	Outdoor → Barbecues ⁷⁴⁴	rub ²³ charcoal ¹³⁸ cookbook ²⁶⁰ brand ¹⁷⁷³⁷	South-Holland → Goeree-Overflakkee ¹⁷⁵⁷
norubbish.nl	No Rubbish	The website offers a selection of flavorful BBQ sauces in various flavors, such as sweet, spicy and smoky.	Coffee & Tea → Specialties ¹⁶⁴ Outdoor → Barbecues ⁷⁴⁴	rub ²³ honey ⁴³²	Noordoostpolder → Emmeloord ¹⁶⁴⁹
sohmirotterdam.nl	Sohmi Rotterdam	The website offers various sauces, such as chili sauce, sriracha and spicy soy sauce.	Japanese → Sushi ⁹⁷¹ Asian → Thai ³⁰¹	side dish ¹¹⁸ wok ²³¹ soup ¹⁰⁴³ sushi ¹⁶⁹⁵ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-hout.nl	Cafetaria ’t Hout	All sauces are homemade with fresh ingredients.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶	Helmond → Mierlo-Hout ⁶²
cafetaria-klundert.nl	Cafetaria Klundert	The website offers a variety of sauces to top the fries and other dishes.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Moerdijk → Klundert ¹²¹
route-66.nl	My shop	A wide range of sauces, such as BBQ sauce and blue mayonnaise, is offered as accompanying products.	Lunch → Sandwiches ⁴⁶⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
elite-webshop.nl	Elite B.V.	The dispensers are designed to dispense Elite sauces.	Hospitality → Suppliers ¹⁰⁵⁷ Sauces & Condiments → Condiments ¹⁷	horeca ¹¹⁵ dispenser ¹⁸² promotional material ²¹⁷	Berkelland → Neede ³⁰⁰
happyfrites-welten.nl	Happy Frites Welten	The fry shop offers a variety of homemade sauces, such as satay sauce, which is an essential part of the flavors.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	sauerkraut ¹⁰ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Heerlen ²⁷⁵⁵
cicekvissnacks-denhaag.nl	Cicek Vis & Snacks	The website has a diverse range of sauces, including garlic sauce and atjam sauce.	Turkish Cuisine → Fast Food ³²²² Restaurants & Dining → Seafood Restaurants ⁶¹²	platters ⁵⁴ döner ⁶⁷³ fish ¹¹²¹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
lavolante.nl	La Volante Deventer	The website offers a wide selection of sauces, including classic and more exotic flavors, to enhance dishes as desired.	Coffee & Tea → Beverages ⁴⁴⁵³ Sauces & Condiments → Sauces ⁴⁹	beverage ⁵⁸⁶ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Overijssel → Deventer ⁴⁷⁵¹
tabara.nl	Tabara Horecagroothandel	Tabara’s basic sauce is presented as the best base for garlic sauce, highlighting the quality of their products.	Fast Food → Fries ⁹⁴⁹ Wholesale → Food Products ³⁰³	doner kebab ²³ hospitality ³⁴⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
ctjbcs.nl	Jbc Scheveningen	The website offers various sauces, including cheddar sauce, cheese sauce, and chili sauce.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → Mexican ¹⁵¹	taco ⁹² bucket ¹¹³ chicken ⁹⁴⁴ burger ¹⁴³¹ drink ⁵¹⁹¹	The Hague → Scheveningen ¹⁶²⁵
cafetariabonnafritura.nl	Cafetaria Bonna Fritura	The restaurant is famous for its homemade tomato sauce, a popular choice for customers.	Fast Food → Burgers ⁶⁸⁷	oven ³²⁴ fries ²⁷⁵³ history ⁷²⁸⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	's-Hertogenbosch → Rosmalen ¹⁰⁵⁹
lasagnemaken.nl	LasagneMaken.nl	The website provides instructions for making different types of lasagna sauce, ranging from classic bolognese to vegetarian sauces.	Fast Food → Burgers ⁶⁸⁷ Cooking & Recipes → Dishes ³³⁵	lasagna ²³ variation ⁷⁵ ingredients ²³⁴⁶ recipe ⁵¹⁴²
alexandriahaarlem.nl	Alexandria Haarlem	A selection of sauces is offered, such as garlic sauce, onion sauce, and sambal.	Fast Food → Burger Restaurants ³⁴⁶	shoarma ²⁵⁴ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
shoarma-grillroom-mama.nl	Shoarma Grillroom Mama	Shoarma Grillroom Mama offers a wide range of sauces, including garlic sauce, sambal sauce and mushroom sauce.	Fast Food → Burger Restaurants ³⁴⁶	shoarma ²⁵⁴ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
samsamtopsnacksarnhem.nl	Sam Sam Topsnacks	The website offers diverse sauces to use with the fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Arnhem ⁸⁶⁸⁰
liansleven.nl	Thema Cube	There are several sauces registered, including tzatziki and homemade mayonnaise.	Dishes → Soups ⁸⁷ Disease & Treatment → Conditions ¹⁷⁴	cucumber ³⁵ fibromyalgia ⁴³ egg ³³⁵ soup ¹⁰⁴³ recipe ⁵¹⁴²
4stargrill-dordrecht.nl	4stargrill	A wide variety of sauces are available for the dishes.	Fast Food → Grill Restaurant ¹²⁹	grill dishes ⁴⁶ milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Dordrecht ⁴⁵³¹
arasoss.nl	Aras	The wraps and kapsalons are served with various sauces, such as curry, mayonnaise and special sauce.	Cafes → Dutch Restaurants ¹⁰³¹ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	doner ¹³¹ kapsalon ⁵⁰⁹ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸	North-Brabant → Oss ²⁹⁶²
bacloi-breda.nl	Loempia & Bubble Tea	Homemade sauces, such as sweet sauce and sambal sauce, are offered.	Fast Food → Fries ⁹⁴⁹ Meal Solutions → Food Businesses ⁵⁷	spring rolls ¹⁴¹ bubble tea ¹⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
balifood.nl	Bali Food B.V.	Bali Food produces and supplies an extensive collection of homemade Indonesian sauces and sambal.	Wholesale → Food Products ³⁰³ Catering & Ready Meals → Indonesian Restaurant ³⁹²	sambal ⁵⁴ snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹
betawi-amsterdam.nl	Betawi	Many dishes are served with special sauces, such as Balinese sauce or coconut curry sauce.	Cuisine → Vegetarian ⁶⁹⁷ Food Delivery → Indonesian ⁵⁰²	bami ¹⁴⁴ shrimp ²¹⁹ vegetarian ³³⁷ rice ⁶³⁵ dish ⁵⁹³⁶
beurremeilleur.nl	BeurreMeilleur	In addition to butter, BeurreMeilleur also supplies a range of sauces, designed to enhance culinary dishes.	Fast Food → Fries ⁹⁴⁹	butter ⁶¹ flavor ¹⁰³² dish ⁵⁹³⁶
brabantsehap.nl	Cafetaria de Brabantse Hap	The cafeteria makes its own special sauces and warm sauces, and also offers gluten-free options.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Waalwijk ¹⁷⁴⁴
brasserie-restaurant-la-vache.nl	Brasserie Restaurant La Vache	The website mentions the presence of sauces, such as sweet-chili sauce and teriyaki sauce, to enhance the dishes.	Lunch → Sandwiches ⁴⁶⁶ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	lunchboxes ⁴¹ bread ¹⁶²² sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Groningen → Veendam ⁸⁹⁶
broodjetogo-arnhem.nl	Broodje To Go	The website sells various sauces, including mayonnaise, andalouse sauce and truffle mayo.	Fast Food → Burgers ⁶⁸⁷ Brasseries & Bistros → Bistro ⁵⁹⁴	wrap ⁸²⁶ bread ¹⁶²² salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	Gelderland → Arnhem ⁸⁶⁸⁰
burgerenpizza-amsterdam.nl	Mixed Kitchen 020	Various sauces, including Alfredo and Simba sauce, are used to garnish the dishes.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Pastries & Baked Goods → Menus ²²³	pasta ¹³⁸⁹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
cafe-t-plein.nl	Cafe 't Plein	A variety of sauces are offered, including french fries sauce, curry and chili sauce.	Cafes → Dutch Restaurants ¹⁰³¹	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Lopik → Benschop ¹²⁶
cafetariaatlasalphenaandenrijn.nl	Cafetaria Atlas	A variety of sauces are available to the customers.	Quick Bites → Cafeteria ⁹⁰⁶	shawarma ³³⁵ hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
cafetariabijnathuiswijlre.nl	Cafetaria Bijna Thuis	The cafeteria offers a variety of sauces, including mayonnaise, curry, gypsy sauce, mushroom sauce, and satay sauce.	Fast Food → Fries Restaurants ⁸⁷ Coffee & Tea → Beverages ⁴⁴⁵³	loaded fries ⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Gulpen-Wittem → Wijlre ⁶⁶
cafetariaeglantierapeldoorn.nl	Cafetaria Eglantier	An important part of the offering is the large selection of sauces to cover the fries and snacks.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
cafetariagoofyscorner-ede.nl	Cafetaria Goofy’s Corner	A wide assortment of sauces are offered with fries, sandwiches and snacks.	Fast Food → Fries ⁹⁴⁹ Coffee & Tea → Beverages ⁴⁴⁵³	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Ede ⁵¹⁰⁴
cafetariahatert-nijmegen.nl	Cafetaria Hatert	The dishes are served with a selection of sauces, such as mayonnaise, curry and war sauce.	Quick Bites → Snack Bar ⁵⁸⁰	chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Gelderland → Nijmegen ⁹³⁸⁴
cafetariakennedyplein.nl	Cafetaria Kennedyplein Ulft	A variety of sauces are offered, including ketchup, curry and jopiesa sauce.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Oude IJsselstreek → Ulft ³⁹²
cafetariamingmmm-steyl.nl	Cafetaria Ming MMM	Various sauces are offered to season fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Lunch → Sandwiches ⁴⁶⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Venlo → Steyl ⁹⁵
cafetariasvreeshof-tilburg.nl	Reeshof Burgers and Kip	Various types of sauces are offered, including BBQ sauce, sesame sauce, and truffle sauce.	Fast Food → Burgers ⁶⁸⁷	chicken burger ¹⁸ wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
cafetariavanjet-leeuwarden.nl	Cafetaria van Jet Leeuwarden	A wide variety of sauces are available with the fries.	Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ potato ⁵⁴² burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Friesland → Leeuwarden ⁶⁰⁶⁸
chickenpalaceleiden-leiden.nl	Chicken Palace Leiden Sophiastraat	Burgers and chicken chunks can be combined with various sauces.	Fast Food → Burger Restaurants ³⁴⁶	nugget ¹⁴ hotwings ¹⁹ chicken ⁹⁴⁴ burger ¹⁴³¹	South-Holland → Leiden ⁷⁰⁸⁹
chickymoon-amsterdam.nl	Chickymoon Amsterdam	Various sauces, such as Royal sauce and moon sauce, are offered with the dishes.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ beer ²⁸⁸⁷ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
choosetogo-mijdrecht.nl	Choose To Go Mijdrecht	A wide selection of sauces is available to enhance the dishes to your liking.	Fast Food → Fries ⁹⁴⁹ Ready-To-Eat Meals → Wraps ¹⁰²	turkish pizza ⁶³ panini ¹⁵⁶ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶	De Ronde Venen → Mijdrecht ⁷⁰⁰
cynthiauwkookpartner-vlissingen.nl	Cynthia Uw Kookpartner	The website describes a diverse assortment of ‘sauces’ such as mayonnaise, chili sauce and mustard.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	smashburger ¹⁷ burger ¹⁴³¹ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Zeeland → Vlissingen ¹⁶¹⁴
dadawan-tilburg.nl	DaDa Wan Tilburg	The restaurant uses various sauces, including Dadawan sauce and teriyaki sauce.	Online Ordering → Delivery Restaurants ⁷² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	curry ³⁵⁵ rice ⁶³⁵ sushi ¹⁶⁹⁵	North-Brabant → Tilburg ⁸⁷⁵⁹
degegrildekip-winterswijk.nl	De Gegrilde Kip	Various sauces are available to top the dishes, such as piri piri and satay sauce.	Turkish Cuisine → Takeout Restaurant ⁸¹ Meat → Chicken ¹²⁷	chicken ⁹⁴⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Gelderland → Winterswijk ¹²²¹
dekoningkookt.nl	The Koning Kookt	The 'Triple Z' sauce is a new product in the online shop, with a unique flavor profile and diverse applications.	Cooking & Recipes → Cooking Classes ²⁹² Cooking & Recipes → Culinary Arts ³⁵	catering ⁶⁴⁵⁶ shop ⁶⁴⁸³ workshop ¹⁹³²⁵	Netherlands → Groningen ²³⁷³⁴
deluxebbq-utrecht.nl	Deluxe BBQ	Various sauces are offered, such as white sauce, orange sauce, and truffle mayo, which enhance the dishes.	Mexican & South American → International Cuisine ⁴¹¹	streetfood ¹⁵¹ chicken ⁹⁴⁴ soup ¹⁰⁴³ burger ¹⁴³¹ fries ²⁷⁵³	Netherlands → Utrecht ⁴⁸⁹⁰¹
doncercenter-europaplein-dongen.nl	Donercenter Dongen	Various sauces, such as garlic sauce and andalouse sauce, are used with the dishes.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ döner ⁶⁷³ wrap ⁸²⁶ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸	North-Brabant → Dongen ⁸⁵¹
eatopiaamsterdam.nl	Eatopia	There is an extensive selection of sauces, including mayonnaise, ketchup, and various specialty sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
efesgrillroom.nl	Efes Grillroom Shoarma afhaalcentrum	A variety of Turkish sauces are offered alongside the dishes.	Sandwiches & Salads → Snacks ⁶⁹³ Turkish Cuisine → Fast Food ³²²²	dürüm ⁹⁷ shoarma ²⁵⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Tilburg → Oud-Noord ⁹⁹
elias-grill.nl	Elias Grill	A selection of sauces is available, such as garlic sauce and chili sauce.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	pita ¹⁹⁹ döner ⁶⁷³ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Friesland → Leeuwarden ⁶⁰⁶⁸
erciyeshalalonline.nl	Erciyes Halal Food Nederland	Erciyes offers a wide range of halal sauces, from spicy sambals to rich, authentic sauces.	Delicacies & Specialty Foods → Halal Food ¹²		North-Brabant → Tilburg ⁸⁷⁵⁹
familiezaakbroodjesenmeer-soest.nl	Familiezaak Broodjes en Meer	A wide variety of sauces, such as samurai, sambal, and mustard, enhances the flavor of the sandwiches.	Bakery & Food Production → Bread ⁷⁶⁵ Sandwiches & Salads → Sandwich Shops ²²⁹	grill plate ¹⁶ top ³⁷⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Utrecht → Soest ²⁰²⁷
fastyburgers-amsterdam.nl	Fasty Burgers Ceintuurbaan	There is a selection of sauces, such as Hellmann's mayonnaise, Heinz ketchup, Fasty sauce and honey mustard sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
fatphills-tilburg.nl	Fat Phills Tilburg	There is an extensive selection of sauces, including 'Phill's sauce' and 'Buffalo hot sauce'.	Fast Food → Burgers ⁶⁸⁷ Fast Food → FEBO ²⁴	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
fatphillsleidschendam.nl	Fat Phills Leidschendam	The website describes various sauces, including Phill's sauce, buffalo hot sauce, and smoky BBQ sauce.	Fast Food → FEBO ²⁴ Food Delivery → Delivery ²²²⁷	shake ¹¹² burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
febo-nijmegen.nl	FEBO Nijmegen	Various sauces are available with the dishes, such as mustard sauce and satay sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → FEBO ²⁴	croquette ¹³⁶ milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
febo-zwolle.nl	FEBO	Various sauces, such as mustard sauce and satay sauce, are offered with the dishes.	Fast Food → FEBO ²⁴	croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
febogroningen.nl	FEBO	The website describes various types of sauces, such as mustard sauce and curry sauce, which are used with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	shake ¹¹² croquette ¹³⁶ burger ¹⁴³¹ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
febotilburg.nl	FEBO Tilburg	Various sauces are offered, such as mustard sauce and satay sauce.	Fast Food → Burgers ⁶⁸⁷	croquette ¹³⁶ milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
flavours-voorthuizen.nl	Flavours Voorthuizen	The restaurant uses various homemade sauces, such as a specific BBQ sauce.	Fast Food → Burgers ⁶⁸⁷	chicken burger ¹⁸ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Barneveld → Voorthuizen ⁵⁴¹
foodiez-amsterdam.nl	Foodiez Amsterdam	Foodiez Amsterdam uses a number of different sauces, such as Foodiez Burger Sauce and BBQ sauce, to enhance their dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	North-Holland → Amsterdam ⁴¹²⁵³
foodmaster-wilnis.nl	Foodmaster Wilnis	The website describes a wide selection of sauces that can be ordered with the various dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	De Ronde Venen → Wilnis ²²²
gozlemeenschede.nl	Gözleme	There is a diverse range of sauces, such as garlic sauce, curry, and mayonnaise, to flavor the dishes.	Turkish Cuisine → Fast Food ³²²² Catering & Ready Meals → Takeaway ⁴⁰⁹	dönerbox ³³ lahmacun ⁹³ döner ⁶⁷³ fries ²⁷⁵³	Overijssel → Enschede ⁵⁵⁵⁴
grillbikkel.nl	De Grillbikkel	The Grillbikkel pairs well with various sauces such as Honey Mustard sauce and Fries sauce.	Sandwiches & Salads → Snacks ⁶⁹³ Online Retail → Food Retail ³⁴⁰	fry ⁵⁹ spices ³⁴⁰ cheese ¹²⁰⁵
haarlemfebo.nl	FEBO Haarlem Paul Krugerstraat	Various sauces such as mustard sauce and satay sauce are mentioned and offered with burgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → FEBO ²⁴	shake ¹¹² croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
hbc-den-haag.nl	HBC Den Haag	The website offers a range of homemade sauces, such as chicken sauce and Mexican salsa sauce, which are served with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ wrap ⁸²⁶ chicken ⁹⁴⁴ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
heertjefriet-amsterdam.nl	Heertje Friet	A wide selection of sauces is available, including fries sauce, mayonnaise, curry ketchup, and peanut sauce.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	frikandel ¹⁸ croquette ¹³⁶ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
het-nieuwe-jagertje-mijnsheerenland.nl	Het Nieuwe Jagertje	Various sauces, such as peanut sauce and special sauce, are available to combine with the dishes.	Fast Food → Fries Restaurants ⁸⁷	hamburger ³⁶⁴ meal ¹⁶³⁸ salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	Hoeksche Waard → Mijnsheerenland ¹³⁸
hethapjebyferry-denhaag.nl	Het Hapje by Ferry	The website mentions various sauces, such as peanut sauce, chili sauce, katjang sauce and mayo, which can be used with the dishes.	Quick Bites → Cafeteria ⁹⁰⁶	vegetarian ³³⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
incheon-korean-fried-chicken-nijmegen.nl	Incheon Korean Fried Chicken Nijmegen	The website offers a varied assortment of Korean sauces, including sweet and sour, soy and honey sauces, to enhance the dishes to your liking.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Korean Restaurants ³³	tenders ⁷⁵ drink ⁵¹⁹¹	Gelderland → Nijmegen ⁹³⁸⁴
incheon-korean-fried-chicken-waalwijk.nl	Incheon Korean Fried Chicken Waalwijk	The dishes are served with various sauces, such as soy and honey sauce, Gulao sauce and Korean sweet and sour sauce.	Food Delivery → Korean Restaurants ³³	tenders ⁷⁵ bowl ⁴⁸² rice ⁶³⁵ chicken ⁹⁴⁴	North-Brabant → Waalwijk ¹⁷⁴⁴
jackandjonespizza-amsterdam.nl	Jack and Jones Pizza Amsterdam	The website offers a variety of sauces, including tomato sauce, satay sauce and garlic sauce.	Asian → Vietnamese ¹²⁴ Online Retail → Food Retail ³⁴⁰	shrimp ²¹⁹ herbs ⁹²⁴ chicken ⁹⁴⁴ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	North-Holland → Amsterdam ⁴¹²⁵³
johnnys-burger-company-den-haag-wateringen.nl	Johnny's Burger Company Den Haag Wateringen	The website offers various sauces, such as Johnny's sauce, piri piri sauce and bbq sauce.	Turkish Cuisine → Fast Food ³²²²	side ⁷⁴ burger ¹⁴³¹ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Westland → Wateringen ⁵³⁶
laz-kebab-amsterdam.nl	Laz Kebab	Garlic sauce and sambal are common sauces served with the dishes.	Turkish Cuisine → Fast Food ³²²²	lahmacun ⁹³ doner ¹³¹ wrap ⁸²⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
leboeuf-aalsmeer.nl	Le Boeuf	The dishes are served with various sauces, such as barbecue sauce and truffle mayonnaise.	Fast Food → Burgers ⁶⁸⁷ Ready-To-Eat Meals → Wraps ¹⁰²	falafel ¹⁰⁸ wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹	North-Holland → Aalsmeer ¹⁷¹⁰
maes-pasta-place-vlaardingen.nl	Mae's Pasta Place	The website mentions various sauces, including cream sauce, tomato sauce and pesto, which are used with the pasta dishes.	Fast Food → Burgers ⁶⁸⁷	shrimp ²¹⁹ chicken ⁹⁴⁴ pasta ¹³⁸⁹ bread ¹⁶²²	South-Holland → Vlaardingen ¹⁸⁵³
malva-amsterdam.nl	Malva	The website emphasizes the use of special sauces, such as Malva special sauce and harissa sauce.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	wrap ⁸²⁶ chicken ⁹⁴⁴ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
miami-fried-chicken-den-haag.nl	Miami Fried Chicken	The website offers various sauces, including garlic sauce and satay sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Chicken Dishes ⁹²	beverage ⁵⁸⁶ chicken ⁹⁴⁴ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
mirindaamsterdam.nl	Mirínda	Mirínda uses various homemade sauces, such as the secret house sauce and the chimichurri sauce, which contribute to the flavor of its dishes.	Fast Food → Burgers ⁶⁸⁷ Grilling & Steaks → American ⁸⁵	beef ³¹⁹ wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹	North-Holland → Amsterdam ⁴¹²⁵³
miyagi-jones-arnhem.nl	Miyagi & Jones Arnhem	A variety of sauces are offered, such as teriyaki, Thai chili, coffee Oriental, Gochujang, Asian soy, and hoisin sauce.	Catering & Ready Meals → Asian Cuisine ¹³⁷ Activities → Dining Out ¹⁸¹	rice bowl ¹⁷ rice ⁶³⁵ chicken ⁹⁴⁴ sushi ¹⁶⁹⁵ salad ²⁴⁴⁴	Gelderland → Arnhem ⁸⁶⁸⁰
otacos-schiedam.nl	O'Tacos Schiedam	The website offers a large selection of ‘Sauces’ that can be added to the ‘Tacos’ and ‘Fries’.	Websites → Ordering Sites ⁷⁵ Turkish Cuisine → Fast Food ³²²²	taco ⁹² bowl ⁴⁸² fries ²⁷⁵³	South-Holland → Schiedam ²²⁴⁹
pinoytoko.nl	PinoyToko	A selection of Filipino sauces, such as Silver Swan soy sauce, are available for purchase.	Turkish Cuisine → International ¹²⁰⁷	frozen products ¹⁶ dessert ⁴⁹⁶ snack ²⁹¹⁶ ship ⁵¹⁰³
pizzalicious-amsterdam.nl	Pizzalicious	The website describes different types of sauce used in the pizzas, such as tomato sauce and barbecue sauce.	Japanese → Poke ¹⁹ Fast Food → Burger Restaurants ³⁴⁶	toppings ¹⁵³ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
pizzeria-crossa.nl	Crossa	Various sauce options are available with the dishes, such as tomato sauce and garlic sauce.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	top ³⁷⁷ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Limburg → Maastricht ⁶⁰⁰⁸
pizzeriarestaurantluigis-zeist.nl	Pizzeria Restaurant Luigi's	The dishes are served with a variety of sauces, including tomato sauce and cream sauce.	Italian → Pasta ²¹³ Online Services → Ordering ¹²¹	pasta ¹³⁸⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Utrecht → Zeist ²⁶⁴⁴
restaria-t-stationneke-deurne.nl	Restaria 't Stationneke	The website lists a large number of different sauces, including mayonnaise, curry, ketchup, and satay sauce.	Food Delivery → Delivery ²²²⁷ Quick Bites → Hair Salon ¹¹²	croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Deurne ¹³²⁹
restaurantboerengoeds-hertogenbosch.nl	Restaurant Boerengoed	A selection of sauces, such as BBQ sauce and garlic sauce, are added to the dishes.	Dutch Restaurants → Brabant ³²	rib ¹⁹¹ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ wine ⁴⁴⁷⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
rhodosgrieksrestaurant-tiel.nl	Greek Specialities Restaurant Rhodos	Customers can choose from a wide assortment of sauces with their order.	International → Greek ⁴⁶⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	pita ¹⁹⁹ meat ²⁰⁵⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
schnitzelkoningtiel-tiel.nl	Schnitzel Koning Tiel	A variety of sauces are offered to serve with the schnitzels.	Quick Bites → Cafeteria ⁹⁰⁶ Fine Dining & Gastronomy → Dining ⁶⁷⁷	schnitzel ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
shutupandeat-spaubeek.nl	Shut up and eat	An extensive selection of sauces is available to refresh the fries and other dishes.	Turkish Cuisine → Fast Food ³²²²	dürüm ⁹⁷ menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Beek → Spaubeek ⁸⁶
skillszkitchen-rotterdam.nl	SkillszKitchen Rotterdam	A variety of sauces are available, such as chili sauce, curry, and cheese sauce.	Cafes & Lunch → Lunchroom ⁴⁴⁶	dessert ⁴⁹⁶ lunch ¹⁵³⁴ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
smokeysbbqenschede.nl	Smokey's BBQ	The dishes are served with various sauces, such as steakhouse fries sauce and Caribbean marinade.	Fast Food → Burger Restaurants ³⁴⁶ Outdoor → Barbecues ⁷⁴⁴	children's menu ¹⁷ hamburger ³⁶⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
snackbarardy-almelo.nl	Snackbar Ardy	A wide range of sauces, such as fries sauce, curry and peanut sauce, are available.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Almelo ²⁶⁹⁶
snackbarpeterloeffenoss.nl	Snackbar Peter Loeffen	Snackbar Peter Loeffen offers various sauces, such as chili sauce and truffle mayonnaise, to garnish the fries.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	top ³⁷⁷ kapsalon ⁵⁰⁹ fries ²⁷⁵³	North-Brabant → Oss ²⁹⁶²
snackhouse-twins.nl	Snackbar Twins Zeist	There is an extensive selection of sauces, such as peanut sauce, curry sauce and special sauce.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	spring rolls ¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Zeist ²⁶⁴⁴
snackpoint-poeldijk.nl	Snackpoint Poeldijk	A wide range of sauces are available, including classics such as apple sauce and more exotic options such as satay roll.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Westland → Poeldijk ²⁸⁰
tastewollerich.nl	Taste Wollerich	The sauces from Taste Wollerich are crafted by chef Gerard Wollerich and are designed to add a refined flavor to any dish.	Dairy & Cheese → Delicacies ¹²⁷ Meat → Meat Products ²¹¹	soup ¹⁰⁴³ craftsmanship ¹⁸⁵⁸ ingredients ²³⁴⁶ assortment ⁷⁷⁹⁹ sustainability ¹⁸⁴⁵¹
tasty-delivery-houten.nl	Tasty Delivery	The website offers a diverse selection of sauces, including garlic oil, pesto and thousand island sauce.	Fast Food → Burger Restaurants ³⁴⁶ Quick Bites → Hair Salon ¹¹²	fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Utrecht → Houten ¹⁶⁷⁷
tensum-restaurant-tilburg.nl	Tensum Restaurant	The website offers various types of sauces, such as satay sauce and teriyaki sauce.	Food Delivery → Delivery ²²²⁷	cracker ²⁵ spring roll ⁸² dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
the-doner-house-berkel.nl	The Doner House Berkel	Various sauces are offered to enhance the taste of the dishes.	Cafes & Lunch → Lunch ⁵⁹¹ Turkish Cuisine → Fast Food ³²²²	doner kebab ²³ turkish pizza ⁶³ wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Lansingerland → Berkel and Rodenrijs ⁹²⁹
thebucketlist-enschede.nl	The Bucket List	A wide assortment of sauces, including mayonnaise, ketchup, and spicy sauces, is available.	Online Ordering → Delivery Restaurants ⁷²	bucket ¹¹³ vegan ⁵⁰⁸ beverage ⁵⁸⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶	Overijssel → Enschede ⁵⁵⁵⁴
thefatpelican-leiden.nl	The Fat Pelican	The website describes the various sauces served with the dishes, such as cranberry sauce, remoulade sauce and fatty's sauce.	Cuisine → Vegetarian ⁶⁹⁷ Cooking & Recipes → Dishes ³³⁵	bitterballs ⁴¹ dessert ⁴⁹⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Leiden ⁷⁰⁸⁹
theindianchef-schiedam.nl	The Burger Chef Schiedam	Various sauces are offered, including The Burger Chef sauce and Andalouse sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ burger ¹⁴³¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Schiedam ²²⁴⁹
time4burgers-middelburg.nl	De Nachtkeuken	Various sauces, such as Burger sauce and Samurai sauce, are used with the burgers.	Japanese → Poke ¹⁹ Fast Food → FEBO ²⁴	burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Zeeland → Middelburg ²³⁴²
twenty-eight-hoensbroek.nl	Twenty Eight	Customers can customize their toasties and sandwiches with various sauces such as curry, mayo, and chili sauce.	Lunch → Sandwiches ⁴⁶⁶	toastie ⁴⁵ lunchbox ⁵⁰ pancakes ⁵⁶⁸ soup ¹⁰⁴³ sandwich ⁴⁰⁹⁸	Heerlen → Hoensbroek ³⁷¹
vishandeltheomuys-zwolle.nl	Vishandel Theo Muys Dobbe	Various sauces such as ragout sauce, piri piri sauce and mustard-dill sauce are offered.	Restaurants & Dining → Seafood Restaurants ⁶¹² Supermarkets & Grocery → Fish Shops ¹⁹¹	herring ¹⁵⁶ fish ¹¹²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
wajoburgervlaardingen.nl	Wajo! Burger	The menu describes various sauce options, including Wajo sauce, barbecue sauce, and andalouse sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken ⁹⁴⁴ cheese ¹²⁰⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
wok-noodle-bar-utrecht.nl	Wok & Noodle Bar	Dishes are served with different flavorful sauces, such as teriyaki sauce and curry sauce.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Asian Restaurant ¹⁶³	wok ²³¹ soup ¹⁰⁴³ vegetables ¹⁴¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
bigrabbitenschede.nl	Big Rabbit	A wide range of sauces are offered, including soy sauce, wasabi, teriyaki sauce, and gochujang sauce.	Japanese → Sushi ⁹⁷¹	bibimbap ¹⁶ teppanyaki ⁵⁸ ramen ¹⁰⁶ poke bowl ³⁰⁸ sushi ¹⁶⁹⁵	Overijssel → Enschede ⁵⁵⁵⁴
calandfood.nl	Caland Food	The website describes Caland Food as an expert in developing and producing various types of sauces.	Food & Beverage → Food Industry ⁸³⁵ Business → Business Services ¹¹⁵³⁷⁹	craft ⁵³⁸ salad ²⁴⁴⁴	Rijssen-Holten → Rijssen ¹⁰⁴⁸
snackbar-t-trefpunt-voorschoten.nl	Snackbar 't Trefpunt	The menu also includes various sauces such as satay sauce and tartar sauce.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Voorschoten ⁸³⁰
privatelabel-sauzen.nl	héMax	The website specializes in the development of various types of sauces, such as cold and warm sauces.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	partner ⁴²⁷² innovation ⁴⁶⁵⁹
arasguldonercenterdenhaag.nl	Aras Gul Dönercenter	The website offers a variety of sauces, including extra sauce cups.	Fast Food → Döner ²³⁸	kapsalon ⁵⁰⁹ döner ⁶⁷³ wrap ⁸²⁶ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
alportohoorn.nl	Portofino Roode Steen	The dishes are served with various sauces, including tomato sauce, cream sauce, and pesto.	Italian → Pasta ²¹³ Dairy → Cheese ⁵³⁰	cheese ¹²⁰⁵ pasta ¹³⁸⁹ ingredients ²³⁴⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹²	North-Holland → Hoorn ³⁰⁹⁰
eva-chicken-rotterdam.nl	Eva Chicken Rotterdam	The website has a wide selection of sauces, such as Samurai sauce and garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	bucket ¹¹³ chicken ⁹⁴⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
bella-ciao-amsterdam.nl	Bella Ciao Amsterdam	Various sauces, such as BBQ, classic, curry and bella ciao sauce, are used with the dishes.	Fast Food → Fries ⁹⁴⁹	hotdog ³⁵ butter ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸	North-Holland → Amsterdam ⁴¹²⁵³
roastchickenbar-haarlem.nl	Roast Bar	Roast Bar makes a range of homemade sauces, including a hot sauce and a garlic mayo.	Fast Food → Burger Restaurants ³⁴⁶	coleslaw ¹⁰ rib ¹⁹¹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	North-Holland → Haarlem ⁸⁶⁷⁴
petitcafemoriaan-maastricht.nl	Petit Café Moriaan	A selection of sauces is available, such as mayonnaise, mustard, ketchup, and a special hamburger sauce.	Lunch → Sandwiches ⁴⁶⁶ Catering & Ready Meals → Takeaway ⁴⁰⁹	hamburger ³⁶⁴ salad ²⁴⁴⁴ beer ²⁸⁸⁷ drink ⁵¹⁹¹	Limburg → Maastricht ⁶⁰⁰⁸
snackbardespits-rotterdam.nl	Snackbar de Spits	The website offers a wide range of sauces, such as mayonnaise, curry, and peanut sauce.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
luckylucsnacks-maastricht.nl	Lucky Luc Snacks	There is an extensive selection of sauces, including mayonnaise, curry, and special sauces.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Limburg → Maastricht ⁶⁰⁰⁸
deblogvanchris.nl	Chris	The blog contains an article about making sauce, specifically pasta sauce, which is described as a delicious invention to flavor food.	Social → Personal Blog ²⁷¹⁸	bubble ⁶⁰ accident ³³⁰ lock ³⁶⁸	Velsen → IJmuiden ¹¹⁰⁹
jlsportswear.nl	Today Recipes	Shrimp with peanut sauce is defined by its harmonious blend of savory and sweet flavors, originating from Southeast Asian cuisine.	Beverages → Cocktails ¹⁴⁴ History → Social Sciences ¹⁰⁷⁸⁶	cocktail ⁹²⁵ flavor ¹⁰³² recipe ⁵¹⁴²
lunchdepartment.nl	LUNCHDEPARTMENT	Various sauces, such as pesto and satay sauce, are available with the dishes.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Food Trucks ⁶²³	wrap ⁸²⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	North-Holland → Uithoorn ⁹⁴⁰
pastacarbonara.nl	pastacarbonara.nl	The carbonara sauce is an essential part of authentic pasta carbonara, and the website describes how this sauce is made.	Italian → Pasta ²¹³	pasta ¹³⁸⁹ ingredients ²³⁴⁶ recipe ⁵¹⁴²
meatandchips.nl	Meat And Chips	The website describes the different types of sauces that can be added to the fries and burgers.	Fast Food → Burgers ⁶⁸⁷	toppings ¹⁵³ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶
pa-tatjes.nl	Pa-Tatjes on Tour	Pa-Tatjes on Tour uses delicious sauces from Oliehoorn and homemade peanut sauces to enhance the taste of the fries.	Fast Food → Fries Restaurants ⁸⁷	potato ⁵⁴² fries ²⁷⁵³ party ⁵⁹²⁸ catering ⁶⁴⁵⁶
franggo-west-amsterdam.nl	Franggo West	The website offers a variety of homemade sauces, including Piri-Piri, Butter Lemon and Pirinaise.	Fast Food → Burgers ⁶⁸⁷	side dish ¹¹⁸ dessert ⁴⁹⁶ chicken ⁹⁴⁴ bread ¹⁶²² drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
groentebroertjes.nl	Groentebroertjes	The website introduces the unique sauce Twentse Zaligheid, a creamy and mild garlic sauce.	Vegetables → AGF ¹³ Produce & Vegetables → Fruit ⁸⁰¹	fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶ hospitality ³⁴⁹¹ recipe ⁵¹⁴² assortment ⁷⁷⁹⁹
verstegen.nl	Verstegen	The ‘Guilt Free’ sauces are vegan and free from artificial additives.	Context → Environment ⁵⁴⁴³⁷	spices ³⁴⁰ recipe ⁵¹⁴² sustainability ¹⁸⁴⁵¹
vuurenrook.nl	Vuur & Rook	Vuur & Rook offers a diverse range of BBQ sauces, from spicy to sweet, to complete any dish.	Outdoor → Barbecues ⁷⁴⁴	rub ²³ smoker ⁶⁸ charcoal ¹³⁸ bbq ⁹⁰⁸ app ⁴⁵⁹⁵
foodelicious.nl	Foodelicious	Foodelicious sells a wide variety of sauces for various purposes.	Kitchen → Kitchen Supplies ¹⁰⁵ Vegetables → Olives ¹²	balsamic ¹⁴ spices ³⁴⁰ olive oil ³⁴⁶ nuts ⁴¹⁷ pasta ¹³⁸⁹
vishandeldrum.nl	Vishandel Jan Drum En Zonen	The fish shop makes its own delicious sauces, which are served with the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹² Supermarkets & Grocery → Fish Shops ¹⁹¹	oven dish ¹⁶ cod ³⁴ fish ¹¹²¹ salad ²⁴⁴⁴	Edam-Volendam → Volendam ⁹⁴⁸
bunrotterdam.nl	BUN Rotterdam	BUN offers a variety of sauces with the sandwiches, including the popular BUN’s Hot Sauce.	Sandwiches & Salads → Sandwich Shops ²²⁹ TravelContent → Maps ¹⁴¹	lettuce ²⁶ tuna ³⁶ dough ¹²³ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
sonmat.nl	SONMAT	SONMAT offers a variety of sauces, including a sweet-spicy one for its Korean fried chicken, catering to different flavor preferences.	Asian → Korean ⁵¹ Food Delivery → Korean Restaurants ³³	korean fried chicken ¹⁸ kimchi ²³ cuisine ⁶⁶⁶ restaurant ¹¹²¹⁵	Netherlands → Utrecht ⁴⁸⁹⁰¹
burgerbrothersreeshof.nl	Burger Brothers Reeshof	Burger Brothers Reeshof uses homemade sauces to enhance the flavor of the burgers.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ ingredients ²³⁴⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
dekkerpepper.nl	Dekker Pepper	The website offers an extensive selection of homemade and commercial spicy sauces.	Cooking & Recipes → Spices ¹⁴⁴ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	pepper ⁵⁵ challenge ¹⁶⁹⁷ ship ⁵¹⁰³ order ⁶⁹¹²
alledagenlekker.nl	Alledagen Lekker	Freshly prepared sauces are available in jars, for easy addition to dishes.	Dishes → Soups ⁸⁷	takeaway ⁶⁵³ soup ¹⁰⁴³ meal ¹⁶³⁸ menu ¹³⁸⁵⁶	Gooise Meren → Bussum ²²⁰¹
orientalwebshop.nl	Amazing Oriental	The website offers a comprehensive assortment of sauces.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	spices ³⁴⁰ store ³⁹⁰¹ recipe ⁵¹⁴² drink ⁵¹⁹¹
ernievanderkolk.nl	Tuinderij Ernie van der Kolk	In addition to jam, sauces are also made from the fruit.	Farms & Farm Businesses → Farm Shops ¹⁷²	jam ¹²² farm shop ²⁰⁴ fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶
umbertogastronomia.nl	Umberto Gastronomia	Various fresh sauces are available, including those for pizza.	Dairy & Cheese → Delicacies ¹²⁷ Dairy & Cheese → Delicatessens ⁶¹⁷	antipasti ⁷⁴ delicacies ²⁷³ cheese ¹²⁰⁵ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸	Gelderland → Harderwijk ²²⁴⁰
manobowls.nl	Mano Bowls	The website offers diverse sauces to flavor the Poké Bowl, such as chili mayo and wasabi mayo.	Asian → Japanese ¹⁴⁸⁸ Food Delivery → Delivery ²²²⁷	base ⁸⁴ toppings ¹⁵³ poké bowl ¹⁶⁹ rice ⁶³⁵ catering ⁶⁴⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
wiboseatcounter.nl	Wibo's Eatcounter	Wibo’s Eatcounter is known for its homemade sauces.	Vegetables → Potatoes ¹⁰⁰ Quick Bites → Cafeteria ⁹⁰⁶	potato ⁵⁴² meat ²⁰⁵⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Southwest-Friesland → Sneek ¹⁹²¹
dehaerlemschevlaamse.nl	Snackbar Haarlem	The snack bar offers 19 different sauces, including homemade sambal-mayo and special sauce.	Quick Bites → Cafeteria ⁹⁰⁶ Turkish Cuisine → Fast Food ³²²²	patat ²¹ fries ²⁷⁵³ building ³²⁰⁴ staff ³⁴⁰⁵	North-Holland → Haarlem ⁸⁶⁷⁴
eco-idee.nl	Biofrutas	The website sells various fruit and tomato sauces, often based on syrup.	Markets → Local Markets ¹⁵³ Produce & Vegetables → Fruit ⁸⁰¹	puree ¹⁴ syrup ⁵⁴ jam ¹²² juice ²⁰⁷ herbs ⁹²⁴	North-Brabant → Breda ⁹⁰⁰³
barbecuerecepten.nl	Barbecue Recepten	The website contains several sauces, such as Spanish herb butter and remoulade sauce.	Sandwiches & Salads → Appetizers ⁴⁰ Outdoor → Barbecues ⁷⁴⁴	shrimp ²¹⁹ barbecue ¹¹⁷⁵ recipe ⁵¹⁴²
kiooms.nl	Kiooms Salad Dressing	In addition to dressings, there are also sauces such as the Salmon-Dill sauce, expanding Kiooms' culinary range.	Healthy Eating → Organic Food ²¹⁹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	dress ⁴⁰⁵ oil ⁹⁷⁰ ingredients ²³⁴⁶ recipe ⁵¹⁴²
pastametspinazie.nl	Pastametspinazie.nl	Pasta room sauce is an option to cook the pasta with flavor.	Italian → Pasta ²¹³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	spinach ¹⁶ pasta ¹³⁸⁹ recipe ⁵¹⁴²
burgermasters-utrecht.nl	Burger Masters	The website describes the various sauces used with the burgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ burger ¹⁴³¹ fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
van-ton.nl	van TON	Van TON’s sauce is awarded with delicious and honest flavors.	Wholesale → Food Products ³⁰³ Sauces & Condiments → Sauces ⁴⁹	mayonnaise ²⁷ mustard ³³ recipe ⁵¹⁴² webshop ⁸⁶⁴⁸
henri.nl	Henri Henri	Henri Henri produces a variety of sauces suitable for various dishes and recipes.	Food & Beverage → Food Industry ⁸³⁵ Essential → Food ⁴⁷⁹⁹⁹	soup ¹⁰⁴³ meal ¹⁶³⁸ recipe ⁵¹⁴² sustainability ¹⁸⁴⁵¹
bellemarie.nl	BelleMarie	In addition to fresh herbs, BelleMarie produces various sauces based on their own grown herbs.	Agriculture → Organic Farming ⁵⁶⁰ Natural Medicine → Herbs ²⁶¹	biodynamic ²⁶ grassland ⁷¹ herbs ⁹²⁴ farm ²⁶²²
ji-nos-enschede.nl	JI-NOS	Burgers are served with various homemade sauces, such as sweet pepper sauce and garlic sauce.	Fast Food → Burgers ⁶⁸⁷	chicken burger ¹⁸ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
bazaaro.nl	Bazaaro	The website offers various Turkish sauces, including sambals and Turkish sauce.	Dairy & Cheese → Specialty Food Stores ⁶⁴	baked goods ¹⁴⁸ spices ³⁴⁰ gift package ⁵³⁰
bloomfield.nl	Bloomfield Dairy	Bloomfield Dairy produces premium cheddar sauces in addition to slices, designed to complement their signature cheese.	Dairy → Cheese ⁵³⁰ Food & Beverage → Food Industry ⁸³⁵	packaging ²²³⁶ restaurant ¹¹²¹⁵
burgersenbeers.nl	Burgers & Beers	The website highlights the use of a signature burger sauce.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ fries ²⁷⁵³ beer ²⁸⁸⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Limburg → Venlo ⁴¹⁵⁸
burritos-anonymous.nl	Burritos Anonymous	The website offers a variety of homemade sauces and salsas, including unique combinations like Lime/Mint and Tamarind/Chili.	Mexican & South American → Mexican ¹⁵¹ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	burrito ⁶² salsa ²⁴⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
fourseasonsfood.nl	Four Seasons Food B.V.	Four Seasons Food develops and produces various vegetable and meat sauces, such as hollandaise.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Online Retail → Food Retail ³⁴⁰	soup ¹⁰⁴³ meal ¹⁶³⁸ recipe ⁵¹⁴²	Heusden → Nieuwkuijk ¹⁷²
de-beruchte-broodjes-amsterdam.nl	De Beruchte Broodjes	The website offers various sauces to enhance the sandwiches and salads, including the ‘beruchte sauce’.	Cafes & Lunch → Lunch ⁵⁹¹	carpaccio ⁴⁷ shake ¹¹² salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
bar-b.nl	Bar B	Bar B makes their own sauces as part of their commitment to using fresh ingredients and providing a unique culinary experience.	Bars → Beer Bars ³⁵ Grilling & Steaks → American ⁸⁵	instagram ¹²¹⁶ burger ¹⁴³¹ fries ²⁷⁵³ beer ²⁸⁸⁷
lua-ede.nl	Lúa Ede	A variety of sauces are offered to accompany the dishes and enhance their flavor.	Asian → Vietnamese ¹²⁴ Sandwiches & Salads → Snacks ⁶⁹³	pho ²⁷ dumpling ⁴⁹ spring rolls ¹⁴¹ bubble tea ¹⁵³
chopcheesehilversum.nl	Chop & Cheese Hilversum	The website describes the ‘Smash Sauce’ as an explosion of flavor that enhances the burger.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ reviews ³¹⁷² menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
jpversepatat-hellevoetsluis.nl	JP Verse Patat	The website offers individual sauces, including the popular 'American sauce' from McDonald's.	Quick Bites → Hair Salon ¹¹²	beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Voorne aan Zee → Hellevoetsluis ⁹⁷²
mijn-friettent.nl	Mijn Friettent	The website states that they are focused on delivering the best tastes.	Fast Food → Fries ⁹⁴⁹ Local & Regional Focus → Local Businesses ¹⁰⁷⁷	potato ⁵⁴² ice cream ¹⁰⁰⁰ fries ²⁷⁵³
cappadocie-groningen.nl	Cappadocië Groningen	The website offers a wide range of sauces to dip into or over the dishes.	Turkish Cuisine → Fast Food ³²²²	wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Netherlands → Groningen ²³⁷³⁴
thaibychin.nl	Thai by Chin	The website also offers a selection of authentic Thai sauces that can be ordered online.	Food Delivery → Asian ²⁷²³	thai dishes ²⁸ pad thai ³¹ restaurant ¹¹²¹⁵
sushitubbergen.nl	Sushi Tubbergen	There is a selection of sauces, such as Kewpie Mayo, Spicy Mayo, Teriyaki and Wasabi Mayo.	Asian → Japanese ¹⁴⁸⁸ Meal Solutions → Food Online Shops ⁸⁰	side ⁷⁴ poké bowl ¹⁶⁹ sushi ¹⁶⁹⁵ menu ¹³⁸⁵⁶	Overijssel → Tubbergen ⁸⁸⁵
eetwinkeldefrietkroam.nl	Eetwinkel De Frietkroam	The website describes the diverse sauces served with the fries, such as curry and apple sauce.	Sandwiches & Salads → Snacks ⁶⁹³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	fry ⁵⁹ gift ⁶⁴⁴² assortment ⁷⁷⁹⁹	Bergen → Siebengewald ⁵⁵
smokeys-spareribs.nl	Smokey's Spareribs Den Haag	A variety of sauces are available, such as garlic sauce and peanut sauce.	Fast Food → Burger Restaurants ³⁴⁶ Grilling & Steaks → American ⁸⁵	side dish ¹¹⁸ spareribs ²¹³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
houseoffrites.nl	House of Frites	The restaurant offers a wide range of traditional and homemade sauces.	Fast Food → Fries ⁹⁴⁹	organic ⁴⁷¹ vegan ⁵⁰⁸ potato ⁵⁴² chicken ⁹⁴⁴ fries ²⁷⁵³	South-Holland → Delft ⁵³⁰⁹
mburgervlijmen.nl	MBurger	The homemade sauces, such as the chili sauce with the Chicken Tenders, are an important part of the dishes.	Fast Food → Burgers ⁶⁸⁷	halal ¹⁶⁵ chicken ⁹⁴⁴ burger ¹⁴³¹ bread ¹⁶²² salad ²⁴⁴⁴	Heusden → Vlijmen ³⁸⁹
bellamyfood.nl	Bellamy’s	The website offers an extensive assortment of artisanal sauces, suitable for various culinary applications.	Wholesale → Food Products ³⁰³ Local & Regional Focus → Local Businesses ¹⁰⁷⁷	private label ¹⁸⁴ soup ¹⁰⁴³
mistrix-recepten.nl	admin-recepten	The sauce is cooked to the correct thickness.	Grilling & Steaks → Meat Dishes ⁴⁰ Cooking & Recipes → Cuisine ¹¹⁴⁷	onion ¹¹¹ mushroom ²²³ meat ²⁰⁵⁵ recipe ⁵¹⁴²
deschalksevlaming.nl	Frituur De Schalkse Vlaming	The frituur offers an extensive selection of sauces to combine with fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Dishes ³³⁵	croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶
freekschilder.nl	Freek Schilder Vissnacks BV	Freek Schilder also supplies a variety of sauces, alongside the fish snacks and salads.	Sandwiches & Salads → Snacks ⁶⁹³ Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ packaging ²²³⁶ salad ²⁴⁴⁴ production ⁴⁵⁸²	Edam-Volendam → Volendam ⁹⁴⁸
bijderonde.nl	Bij De Ronde	Various sauces are offered to accompany fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	family pack ²⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶
detussenstop.nl	Snackbar DE TUSSENSTOP	A wide range of sauces is offered, such as curry, ketchup, and special sauces.	Family Activities → Outings ⁷⁶³ Quick Bites → Cafeteria ⁹⁰⁶	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ family ⁶⁴⁶² menu ¹³⁸⁵⁶	Midden-Drenthe → Hooghalen ¹⁰⁷
johnnysteak.nl	Johnny’s Steakhouse	A variety of sauces, such as mushroom and garlic sauce, are available with the dishes.	Fast Food → Grill Restaurant ¹²⁹	spareribs ²¹³ steak ³³⁵ reservation ³³⁷³ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Woensdrecht → Ossendrecht ¹³⁶
bakkervanpizza.nl	Bakker van Pizza	Various sauces, such as tomato sauce and Aïoli, are described on the website and combined with pizza.	Italian → Pasta ²¹³ Context ¹⁶¹³⁹⁴	dough ¹²³ pizza ⁴¹⁵⁸ recipe ⁵¹⁴²
suvi-amsterdam.nl	C&C Asian Market	A variety of Asian sauces, such as ketjap and chili sauce, can be found on the website.	Food Delivery → Asian ²⁷²³ Catering & Ready Meals → Asian Cuisine ¹³⁷	noodles ¹⁹¹ vegetables ¹⁴¹⁶ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
exotic-plaza.nl	Exotic Plaza	A wide range of African sauces are available to enhance the flavors of the dishes.	Food Delivery → Indonesian ⁵⁰² Supermarkets & Grocery → Specialty Stores ⁷⁰	peanut butter ²⁵ spices ³⁴⁰ rice ⁶³⁵ recipe ⁵¹⁴²	Gelderland → Arnhem ⁸⁶⁸⁰
hapwatalkmaar.nl	HapWat	Various sauces are available to complement the dishes.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Sandwich Shops ²²⁹	croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Alkmaar ⁶⁵⁰⁷
hudson-rotterdam.nl	Hudson Rotterdam	The website describes the specific sauces used, such as the famous Hudson sauce and BBQ sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	vegetarian ³³⁷ burger ¹⁴³¹ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
keuken-van-linn.nl	Keuken van Linn	Alfredo sauce is one of the used sauces in the pasta dishes, often in combination with other ingredients such as cheese or chicken.	Cafes → Dutch Restaurants ¹⁰³¹ Catering & Ready Meals → Asian Cuisine ¹³⁷	bami ¹⁴⁴ shrimp ²¹⁹ nasi ²⁴² pasta ¹³⁸⁹	North-Holland → Amsterdam ⁴¹²⁵³
mrgyros.nl	Mr Gyros	The dishes are served with various sauces such as tzatziki and other specific Greek sauces.	International → Greek ⁴⁶⁵ Mediterranean & Middle Eastern → Takeout ²⁸⁶	gyro ⁹⁵ fries ²⁷⁵³ menu ¹³⁸⁵⁶
remiaindustrie.nl	Remia	Remia produces a wide range of sauces for various applications.	Administrative Support → Family Businesses ⁶⁶⁴ Food & Beverage → Food Industry ⁸³⁵	oil ⁹⁷⁰ customization ¹⁷²³ innovation ⁴⁶⁵⁹
bierbbq.nl	Bier BBQ	Various sauces, such as an Asian-style remoulade sauce, are used in the recipes.	Internet → Forums & Communities ¹⁵⁹⁹ Cooking & Recipes → BBQ ²³⁶	kamado ¹⁰³ bbq ⁹⁰⁸ meat ²⁰⁵⁵ beer ²⁸⁸⁷ recipe ⁵¹⁴²
aandehavenhautefriture.nl	Aan de Haven Haute Friture	A wide variety of sauces are available to use with the fries.	Quick Bites → Snack Bar ⁵⁸⁰ Cafes & Lunch → Lunch ⁵⁹¹	lunch menu ²⁰ top ³⁷⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	South-Holland → Leiden ⁷⁰⁸⁹
cafetaria-mercurius-enschede.nl	Cafetaria Mercurius	A wide range of sauces is available to accompany the fries and other dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken satay ²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
iza-sushi-wok.nl	Iza Sushi & Wok	Various sauces are used, including sweet and sour, spicy, Thai curry and oyster sauce.	Japanese → Sushi ⁹⁷¹ Food Delivery → Delivery ²²²⁷	wok ²³¹ vegetables ¹⁴¹⁶ sushi ¹⁶⁹⁵ box ¹⁹⁸²	Utrecht → Amersfoort ⁸⁰¹¹
lovelyspice.nl	Lovely Spice®	The website offers various sauces, such as hot sauce and pepper jelly, that accompany the peppers.	Websites → Gift Shops ¹³ Cooking & Recipes → Spices ¹⁴⁴	pepper ⁵⁵	North-Holland → Amsterdam ⁴¹²⁵³
dedrankgroothandel.nl	De Drankgroothandel	The website sells various flavorful sauces in bulk packaging.	Coffee & Tea → Beverages ⁴⁴⁵³	beverage ⁵⁸⁶ packaging ²²³⁶ coffee ³⁸³⁸ cleaning ⁴⁵⁶⁷ assortment ⁷⁷⁹⁹
devogelenzang.nl	Cafetaria de Vogelenzang	Various sauces are available, including mayonnaise, curry, and peanut sauce.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Food Businesses ⁵⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Neder-Betuwe → Echteld ⁶⁶³
piet-de-wit.nl	Pierre le Blanc B.V.	The Pierre le Blanc peanut sauce is unique and has won prizes, demonstrating the popularity of the product among customers.	Meat → Meat Products ²¹¹ Food → Foodservice & Catering ⁵⁷⁷	meat ²⁰⁵⁵ certification ³³⁸⁰ hospitality ³⁴⁹¹
braamcateringhomemade.nl	Braam Catering	The company initially started by producing various sambals and spicy sauces.	Pastry → Cakes ⁸²⁶ Outdoor → Barbecues ⁷⁴⁴	gift box ²⁴³ foodtruck ⁶¹³ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Nijkerk → Achterhoek ¹⁷³⁰
wokhaohao.nl	Wok Hao Hao	The website offers a selection of sauces to allow customers to determine the flavor of their wok meal.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	wok ²³¹ takeaway ⁶⁵³ vegetables ¹⁴¹⁶ ingredients ²³⁴⁶ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
flamed-almere.nl	Bistro Rood	The spareribs can be served with different sauces, such as spicy or sweet.	Cafes → Dutch Restaurants ¹⁰³¹ Cooking & Recipes → BBQ ²³⁶	carpaccio ⁴⁷ spareribs ²¹³ burger ¹⁴³¹ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
cigkoftem-den-bosch.nl	Çigköftem Den Bosch	Various sauces, such as pomegranate sauce and biber turşusu, are available to accompany the dishes.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	falafel ¹⁰⁸ wrap ⁸²⁶ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
itre.nl	i’TRE	With the sauces from i’TRE, you achieve the taste sensation you can only experience in a Michelin-starred restaurant.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	caviar ⁴³ salmon ¹⁸⁵ spices ³⁴⁰ olive oil ³⁴⁶
ramenheaven.nl	RamenHeaven	The website offers various Asian sauces, including soy sauce, gochujang and curry.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Sauces & Condiments → Asian Food ¹⁵	ramen ¹⁰⁶ noodles ¹⁹¹ ingredients ²³⁴⁶ snack ²⁹¹⁶
northeastkitchen.nl	Northeast Kitchen	Tossed Sweet Potato Vermicelli is served with a sesame sauce, representing a common ingredient and flavor profile.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	seasoning ¹⁵ pork ⁸⁷ cuisine ⁶⁶⁶ tradition ⁷³⁶ chicken ⁹⁴⁴	North-Holland → Amsterdam ⁴¹²⁵³
cafetaria-leidse-hof.nl	Cafetaria Leidse Hof	Customers can add their wok meals and noodles to their liking with different sauces.	Quick Bites → Cafeteria ⁹⁰⁶	noodles ¹⁹¹ wok ²³¹ beverage ⁵⁸⁶ vegetables ¹⁴¹⁶	South-Holland → Leiden ⁷⁰⁸⁹
kivitsbv.nl	Kivits B.V.	The website mentions various sauces as part of their assortment.	Online Retail → Food Retail ³⁴⁰ Dairy & Cheese → Specialty Food Stores ⁶⁴	poultry ¹⁸⁰ meal ¹⁶³⁸ game ²⁸⁰⁷	South-Holland → Zoetermeer ⁴⁰⁴⁶
frietjefred.nl	Frietje fred	Frietje fred offers a diverse selection of sauces to top the fries with.	Fast Food → Fries ⁹⁴⁹	plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Heerlen → Hoensbroek ³⁷¹
chowshoekie.nl	Chow's Hoekie	Various sauces are offered such as mayonnaise, ketchup, and spicy variants.	Bars → Pubs ⁵⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	pub ¹⁸⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Aa en Hunze → Gasselternijveen ⁶⁸
tippelinn.nl	Kwaliteits Cafetaria Tippel Inn	The cafeteria offers a variety of homemade sauces, such as peanut sauce and garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Sandwiches & Salads → Snacks ⁶⁹³	ice cream ¹⁰⁰⁰ meat ²⁰⁵⁵ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Epe → Vaassen ⁴⁷⁷
falafelhuis-zaandam.nl	Falafel huis	The restaurant offers a selection of sauces to complement its falafel dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	falafel ¹⁰⁸ beverage ⁵⁸⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
snackbarharte.nl	Snackbar Harte	Various sauces are mentioned as an option with the fries.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	frikandel ¹⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Maashorst → Uden ¹⁵⁴⁰
dethaiemmen.nl	DeThaiEmmen	There is a wide selection of Thai sauces, such as Sriracha and Hoisin.	Asian → Thai ³⁰¹ Catering & Ready Meals → Asian Cuisine ¹³⁷	noodles ¹⁹¹ catering ⁶⁴⁵⁶	Coevorden → Meppen ⁷⁰
friethuysgroeneveld.nl	t'Friethuys Groeneveld	There is an extensive selection of sauces, ranging from peanut sauce to vegan mayonnaise.	Fast Food → Fries Restaurants ⁸⁷ Events → Places ¹²¹⁹	fry ⁵⁹ potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶ staff ³⁴⁰⁵	North-Holland → Alkmaar ⁶⁵⁰⁷
balianverhuur.nl	Balian B.V.	Customers can choose from a wide selection of sauces to serve with the fries.	Dogs → Supplies ¹⁰⁰⁵ Rental Services → Car Rental ¹⁰⁴⁷	refrigerator ⁴⁷⁵ cooking ⁸⁰¹ package ⁶¹¹² price ⁸³²⁸	North-Brabant → Land van Cuijk ³²⁸⁷
kipkamer-amsterdam.nl	Kipkamer	A wide range of sauces are offered, from mayonnaise to piri piri sauce.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	saté ³⁷ kapsalon ⁵⁰⁹ chicken ⁹⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
smultenthethaantje.nl	Smultent 't Haantje	A wide range of sauces is available for the orders.	Fast Food → Burgers ⁶⁸⁷	milkshake ¹⁹⁵ menus ²²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Smallingerland → Drachten ²⁰⁵²
oztad-nootdorp.nl	Öztad	The website emphasizes the use of homemade sauces, such as garlic and sambal, to enhance the flavors.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	pita ¹⁹⁹ döner ⁶⁷³ burger ¹⁴³¹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Pijnacker-Nootdorp → Nootdorp ⁵⁶⁵
kingbezorgd.nl	King Burger Chicken	Various sauces, such as garlic sauce, mayonnaise, ketchup, and curry, are available to complement the dishes.	Fast Food → Burgers ⁶⁸⁷ Grilling & Steaks → Meat Dishes ⁴⁰	shawarma ³³⁵ plate ⁷⁸⁷ chicken ⁹⁴⁴ burger ¹⁴³¹	North-Holland → Den Helder ¹⁸⁸⁶
cafetariazielhorst-amersfoort.nl	Cafetaria Zielhorst	A wide range of sauces such as mayonnaise, ketchup and curry are available to accompany the meals.	Quick Bites → Snack Bar ⁵⁸⁰	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Utrecht → Amersfoort ⁸⁰¹¹
kapadokya-purmerend.nl	Kapadokya Purmerend	The website offers an extensive selection of sauces, including various Turkish and Italian flavors, that can be added to the dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Sandwiches & Salads → Italian Cuisine ⁹⁹	calzone ⁹⁰ shawarma ³³⁵ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Holland → Purmerend ²⁶²⁰
aspergesak.nl	Aspergesak	The Hollandaise sauce is an important component of several of the suggested recipes.	Cuisine → Vegetarian ⁶⁹⁷ Restaurants & Dining → Seafood Restaurants ⁶¹²	casserole ¹² asparagus ¹⁸⁶ bag ²³⁹⁹ recipe ⁵¹⁴²
kipzaak-raalte.nl	Kipzaak	The website offers a rich assortment of sauces to enhance the dishes.	Fast Food → Burger Restaurants ³⁴⁶ Fast Food → Chicken Dishes ⁹²	wrap ⁸²⁶ chicken ⁹⁴⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Raalte ¹⁷⁷¹
erciyeshalal.nl	Erciyes Halal Food – OR-KIN BV	The company is also a producer of various types of sauces, which is an important part of the product range.	Meat → Meat Products ²¹¹	meat products ²⁷² assortment ⁷⁷⁹⁹
hetsmulpaleisoosterpoort-nijkerk.nl	Het Smulpaleis Oosterpoort	The website has a wide range of Turkish sauces, such as sambal, mayonnaise and curry.	Sandwiches & Salads → Snacks ⁶⁹³ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ hair salon ⁷¹⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gelderland → Nijkerk ³⁶⁰⁸
donerix-zevenaar.nl	Donerix Zevenaar	A variety of sauces are available to enhance the dishes to your liking.	International → Turkish ⁴¹⁶	doner ¹³¹ barbershop ⁵¹² plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gelderland → Zevenaar ¹⁵⁰⁸
bbqboutique.nl	BBQ Boutique	The website offers a selection of BBQ sauces, including the award-winning Croix Valley Private Stock sauce.	Garden → Grills ⁶⁵ Outdoor → Barbecues ⁷⁴⁴	kamado ¹⁰³ charcoal ¹³⁸ recipe ⁵¹⁴² accessories ¹²⁹⁷⁵	Neder-Betuwe → Casterhoven ²⁴⁸
mrdambanhmi-groningen.nl	Mr. Dam Banh Mi Astraat	Various sauces, such as Vietnamese sauces and sesame seeds, are used to flavor the dishes.	Asian → Vietnamese ¹²⁴	banh mi ²¹ noodles ¹⁹¹ vegetables ¹⁴¹⁶ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸	Netherlands → Groningen ²³⁷³⁴
fritureboom.nl	WebZuid.nl	The restaurant offers various sauces, including satay sauce and vinegar.	Fast Food → Burger Restaurants ³⁴⁶ Sandwiches & Salads → Snacks ⁶⁹³	fries ²⁷⁵³ snack ²⁹¹⁶	Maasgouw → Maasbracht ²⁴⁸
manfriet.nl	Manfriet	The truck offers a variety of sauces such as mayonnaise, ketchup, and satay sauce.	Fast Food → Fries ⁹⁴⁹ Freight & Logistics → Trucks ⁸⁹⁹	truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
oscarnordic.nl	OSCAR A/S	OSCAR® produces ready-made sauces that enhance the flavor of dishes.	Cuisine → Vegetarian ⁶⁹⁷ Sauces & Condiments → Condiments ¹⁷	recipe ⁵¹⁴² brand ¹⁷⁷³⁷ sustainability ¹⁸⁴⁵¹
wokki-wok.nl	Wokki Wok	Customers can choose from a variety of sauces to flavor their wok dish to their liking.	Asian → Chinese ⁴¹⁵	halal ¹⁶⁵ wok ²³¹ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵	Lansingerland → Bergschenhoek ⁵⁶⁸
marvinssnackcorner.nl	Marvin’s Snackcorner	Various sauces, such as peanut sauce and friesauce, are offered to enhance the meals.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶
zeeuwsgrill.nl	Zeeuws Grill	The burgers and chicken dishes are served with various sauces, such as BBQ, cheddar, and Japanese sauce.	Fast Food → Burgers ⁶⁸⁷	tomato ¹⁴⁴ chicken ⁹⁴⁴ burger ¹⁴³¹ salad ²⁴⁴⁴
enkhuizerfriethuys.nl	Enkhuizer Friethuys	Enkhuizer Friethuys offers a selection of special sauces, including the sauces from Oliehoorn, to enhance the flavor of the fries.	Fast Food → Fries ⁹⁴⁹	potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶	North-Holland → Enkhuizen ¹⁰⁶⁴
defrietwagon.nl	DeFrietwagon	Sauce options include mayonnaise, curry, and mustard.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	fry cart ¹⁹ fries ²⁷⁵³ snack ²⁹¹⁶ arrangement ³¹⁰⁴	North-Brabant → Tilburg ⁸⁷⁵⁹
cafetariacharlyarnhemseweg-apeldoorn.nl	Cafetaria Charly Arnhemseweg	Many different sauces are available to top the fries and snacks.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	combo meal ⁶⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
afhaalrestaurantpikantochicken-rotterdam.nl	Pikanto Chicken & Burgers	Various sauces are offered such as mayonnaise, spicy sauce and crispy sauce.	Fast Food → Burgers ⁶⁸⁷	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
alibabadieren.nl	Alibaba Dieren	A wide range of sauces is available for the dishes.	Lunch → Sandwiches ⁴⁶⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	toastie ⁴⁵ hair salon ⁷¹⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Rheden → Dieren ⁴⁶²
antilliaansegrillhouse-lelystad.nl	Antilliaanse Grillhouse	The ‘signature sauce’ is an important part of the dishes, a unique homemade sauce that enhances the flavors.	Turkish Cuisine → International ¹²⁰⁷ Activities → Dining Out ¹⁸¹	bbq ⁹⁰⁸ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	Flevoland → Lelystad ³¹⁸⁰
asianfoodcity-deurne.nl	Asian Food City	The menu includes a wide variety of sauces and spices.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Asian Cuisine ¹³⁷	noodles ¹⁹¹ vegetables ¹⁴¹⁶ ingredients ²³⁴⁶ dish ⁵⁹³⁶	North-Brabant → Deurne ¹³²⁹
bellies-utrecht.nl	Bellies Soulfood	The dishes are served with various sauces, such as BBQ sauce and Belliessaus.	Fast Food → Burger Restaurants ³⁴⁶ Cafes → Dutch Restaurants ¹⁰³¹	toppings ¹⁵³ chicken ⁹⁴⁴ pasta ¹³⁸⁹ fries ²⁷⁵³ dish ⁵⁹³⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
bistro-more.nl	Cafetaria Bistro & More Steenwijk	Various sauces, such as ‘garlic sauce’ and ‘tzatziki sauce’, are offered with the dishes.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Steenwijkerland → Steenwijk ⁸⁷⁶
bobbys-burgers-nieuwegein-nieuwegein.nl	Bobby's Burgers Nieuwegein	Bobby's Burgers offers a wide range of sauces to enhance the burgers.	Fast Food → FEBO ²⁴	burger ¹⁴³¹ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
boodschappendranktogo-doetinchem.nl	De Schnitzelhut	The dishes are served with different sauces, such as teriyaki sauce and satay sauce.	Fine Dining & Gastronomy → Dining ⁶⁷⁷ Produce & Vegetables → Vegetables ¹⁰⁷⁰	lettuce ²⁶ carpaccio ⁴⁷ sandwich ⁴⁰⁹⁸	Gelderland → Doetinchem ²⁷⁰⁶
bosbragafishsmokehouse-weesp.nl	Braga Fish	A wide range of sauces are available to flavor the fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Restaurants & Dining → Seafood Restaurants ⁶¹²	hamburger ³⁶⁴ fish ¹¹²¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Amsterdam → Weesp ¹⁰⁰⁵
bullion-breda.nl	Bullion	Bullion offers a variety of homemade sauces with their dishes.	Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
burgerboys-amsterdam.nl	Wok, Rice & Spice	Various sauces, such as teriyaki and Hong Kong sauce, are used in the wok dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	wok ²³¹ rice ⁶³⁵ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
burgerking-zwolle.nl	Burger King Zwolle	Various special sauces, such as the Whiskey Master sauce and Barbecue Master sauce, are applied to the burgers.	Fast Food → Burger Restaurants ³⁴⁶	combo ⁵⁹ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
burgermania.nl	Burger Mania	The website offers various sauces to pour over the burgers.	Fast Food → Burgers ⁶⁸⁷ Pastries & Baked Goods → Menus ²²³	menus ²²¹ dessert ⁴⁹⁶ burger ¹⁴³¹	Flevoland → Almere ⁷⁷⁶⁵
burgers-frites-rotterdam.nl	Burgers & Frites Rotterdam	The website offers a variety of sauces to enhance the dishes to taste.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
caeliiapitii.nl	Caelii Apitii	Sauces are being developed with both beef and calf-filled options.	Cafes → Dutch Restaurants ¹⁰³¹ Cooking & Recipes → Cuisine ¹¹⁴⁷	mashed potatoes ²⁶ asparagus ¹⁸⁶ menu ¹³⁸⁵⁶
cafetaria-charly-ugchelen.nl	Cafetaria Charly Ugchelen	Various sauces, such as mayonnaise, peanut sauce, and curry, are available for the fries.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Apeldoorn → Ugchelen ¹⁹⁷
cafetaria-de-rooie-brug-utrecht.nl	Cafetaria De Rooie Brug	Various sauces are offered with the dishes, such as mayonnaise, satay sauce and joppie sauce.	Quick Bites → Cafeteria ⁹⁰⁶	schnitzel ⁶¹ spring roll ⁸² burger ¹⁴³¹ fries ²⁷⁵³	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetaria-tang-utrecht.nl	Cafetaria Tang	Various sauces, such as satay sauce and mayonnaise, can be added to the order.	Cafeteria → Dutch Cafeteria ¹²²	combination ¹⁸⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariadehoef-alkmaar.nl	Cafetaria de Hoef	A selection of different sauces is available, including peanut sauce and joppie sauce.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
cafetariaelifonline.nl	Cafetaria Elif Nijmegen	Various sauces are available, such as garlic and chili sauce.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
cafetariakennedyplein-ulft.nl	Cafetaria Kennedyplein	The website describes a wide selection of sauces that can be served with the dishes.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	menus ²²¹ sausage ²⁵⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Oude IJsselstreek → Ulft ³⁹²
cafetariakennys-geleen.nl	Cafetaria Kenny's	There is an extensive selection of sauces to accompany the dishes.	Websites → Local Businesses ⁸⁵ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Sittard-Geleen → Munstergeleen ⁶⁶
cafetariamulti.nl	Cafetaria Multi Nijmegen	There is a wide selection of sauces to flavor the dishes to your liking.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	kapsalon ⁵⁰⁹ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Nijmegen ⁹³⁸⁴
cafetariatbakhuuszilverkamp-huissen.nl	Cafetaria 't Bakhuus Zilverkamp	The website offers a wide range of sauces, including mayonnaise, curry, and peanut sauce.	Fast Food → Fries Restaurants ⁸⁷	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Lingewaard → Huissen ⁵³⁷
cateringnoordveluwe.nl	Cafetaria and Catering van den Berg	The website offers a wide range of sauces, suitable for different types of fries.	Fast Food → Fries ⁹⁴⁹ Meal Solutions → Food Online Shops ⁸⁰	takeaway ⁶⁵³ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Gelderland → Harderwijk ²²⁴⁰
chaco-bussum.nl	Chaco	Customers can choose from various Argentinian sauces to complement their meal.	International Cuisine → Latin American ²⁵ Food → Meat ¹¹²³	spareribs ²¹³ shrimp ²¹⁹ meat ²⁰⁵⁵ menu ¹³⁸⁵⁶	Gooise Meren → Bussum ²²⁰¹
charleys-nederhorst-den-berg.nl	Charley's Nederhorst den Berg	The menu offers various sauces, including piccalilly-mayonnaise, sambal and American garlic sauce.	Sandwiches & Salads → Salads ¹³³	main course ¹⁰² burger ¹⁴³¹ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Wijdemeren → Nederhorst den Berg ²⁰⁷
charliesburger-amersfoort.nl	Charlie's Burger	There is a choice of different sauces to drizzle over the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Utrecht → Amersfoort ⁸⁰¹¹
chickenway-leiden.nl	Chicken Way	The website mentions the use of various sauces with the dishes, such as Chicken Way’s own sauce.	International → Turkish ⁴¹⁶ Cooking & Recipes → Dishes ³³⁵	bucket ¹¹³ wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	South-Holland → Leiden ⁷⁰⁸⁹
chicknchick-amsterdam.nl	Chick 'n Chick	The website offers various sauces, including ‘regular’, ‘spicy’, ‘cheese’ and ‘ranche’.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹²	North-Holland → Amsterdam ⁴¹²⁵³
cigkoftem-utrecht.nl	Çigköftem Utrecht	The website offers various types of sauces, including pomegranate sauce.	Fast Food → Döner ²³⁸	dessert ⁴⁹⁶ döner ⁶⁷³ drink ⁵¹⁹¹ package ⁶¹¹²	Netherlands → Utrecht ⁴⁸⁹⁰¹
cigkoftemzaandam-zaandam.nl	Çigköftem Zaandam	Various sauces are offered as accompaniments to the different menu items.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	ayran ¹⁰ falafel ¹⁰⁸ wrap ⁸²⁶	Zaanstad → Zaandam ²⁷⁴⁰
da-capo-zwolle.nl	Da Capo	Various types of sauce are used in the pizzas, such as tomato sauce and cream sauce.	Fast Food → Chicken Dishes ⁹² Food Delivery → Delivery ²²²⁷	chicken ⁹⁴⁴ meal ¹⁶³⁸ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
dapinoschnitzelkoning-montfoort.nl	Da Pino Schnitzelkoning	The website describes the different sauces served with the schnitzels, such as peanut sauce and Jägersauce.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Food Delivery → Delivery ²²²⁷	schnitzel ⁶¹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Utrecht → Montfoort ⁶⁷³
de-driehoek-terwijde.nl	De Driehoek Terwijde	Various sauces are available to accompany the dishes.	Cafes → Dutch Restaurants ¹⁰³¹ Sandwiches & Salads → Snacks ⁶⁹³	halal ¹⁶⁵ roti ³⁰³ rice ⁶³⁵ burger ¹⁴³¹ fries ²⁷⁵³	Netherlands → Utrecht ⁴⁸⁹⁰¹
de-frietzaak-den-bosch.nl	De Frietzaak Den Bosch	A wide selection of sauces is available, from traditional Dutch fried sauce to exotic variations.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	loaded fries ⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
de-smaak-van-afrika.nl	De Smaak van Afrika	Many dishes are served with various sauces, such as peanut sauce and mustard sauce.	Food Delivery → Delivery ²²²⁷	lentils ¹⁶ rice ⁶³⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
de-vriendschap-boxmeer.nl	De Vriendschap	The website offers a large selection of different sauces for fries and other dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Land van Cuijk → Boxmeer ⁸⁶¹
debakkersbingolkebabhuis-oudewetering.nl	De Bakkers Bingol Kebab Huis	A variety of sauces, such as garlic sauce and sambal, are offered.	Fast Food → Döner ²³⁸ Fast Food → Fries ⁹⁴⁹	doner ¹³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Kaag en Braassem → Old Watering ⁶⁰
defrietketel.nl	De Frietketel	The website offers a wide range of sauces to top the fries.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	pickup ⁷³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Waalwijk → Waspik ¹⁴²
denieuweviersprong-vlaardingen.nl	De Nieuwe Viersprong	The website offers a wide selection of different sauces to combine with the fries.	Fast Food → Fries ⁹⁴⁹ Cafes → Dutch Restaurants ¹⁰³¹	hamburger ³⁶⁴ beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶	South-Holland → Vlaardingen ¹⁸⁵³
depremiere-lelystad.nl	De Premiere	A variety of sauces are available to flavor the dishes, such as garlic sauce and mayonnaise.	Cafeteria → Dutch Cafeteria ¹²²	spareribs ²¹³ satay ³²⁰ menu ¹³⁸⁵⁶	Flevoland → Lelystad ³¹⁸⁰
diegaststube-joure.nl	Die Gaststube	The website describes a wide variety of sauces that can be served with the schnitzels.	Fast Food → Burger Restaurants ³⁴⁶ Regional Cuisine → German ¹⁷	schnitzel ⁶¹	De Fryske Marren → Joure ⁶⁸⁹
dilaysfoodtruck-zaandam.nl	Dilay's Foodtruck	Various sauces are available to top the dishes, such as garlic sauce and sambal.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Food Trucks ⁶²³	doner ¹³¹ wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Zaanstad → Zaandam ²⁷⁴⁰
doneribo-vessem.nl	Doner Ibo	The website offers a selection of different sauces, including sambal and garlic sauce.	Fast Food → Fries ⁹⁴⁹ International → Turkish ⁴¹⁶	döner kebab ⁸¹ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Eersel → Vessem ¹¹⁶
eethuissnackbaroscars-emmen.nl	Eethuis & Snackbar Oscars	Various sauces are available for separate ordering.	Fast Food → Fries Restaurants ⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	milkshake ¹⁹⁵ plate ⁷⁸⁷ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³	Drenthe → Emmen ³³⁴⁸
el-mamma.nl	El Mamma	Various sauces are available with spareribs and other dishes to enhance the flavor.	International → Turkish ⁴¹⁶ Food Delivery → Delivery ²²²⁷	turkish pizza ⁶³ spareribs ²¹³ shoarma ²⁵⁴ menu ¹³⁸⁵⁶	South-Holland → Rijswijk ²⁰⁵⁴
ethiopisch-restaurant-eindhoven.nl	Ethiopian Restaurant Eindhoven	The dishes are served with various sauces, both spicy and mild.	Vegan & Vegetarian → Vegan ³⁹⁰ Mexican & South American → International Cuisine ⁴¹¹	lentils ¹⁶ injera ²¹ salad ²⁴⁴⁴ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
falafelhouse-veenendaal.nl	Falafel House	Customers can choose from a variety of sauces to combine with their fries or other dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	falafel ¹⁰⁸ wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Utrecht → Veenendaal ²⁶⁴¹
fishchips-noordwijk.nl	Fish & Chips Noordwijk	The website offers a selection of different sauces, such as cocktail sauce, ragout sauce, and mayonnaise.	Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ order ⁶⁹¹²	South-Holland → Noordwijk ²⁵⁰⁷
flitsbites-hilversum.nl	FlitsBites	The website offers a wide range of sauces, including classic options such as ketchup and various specialty sauces.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	vegetarian dishes ³⁴ beverage ⁵⁸⁶ chicken ⁹⁴⁴ fish ¹¹²¹ fries ²⁷⁵³	North-Holland → Hilversum ⁴³⁹⁷
foodysdoelsteeg-breda.nl	Foodys	Various sauces, such as andalouse sauce and samurai sauce, are offered with the dishes.	Fast Food → Burgers ⁶⁸⁷ Cafes → Dutch Restaurants ¹⁰³¹	loaded fries ⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
frankyseindhoven.nl	Franky's fish chips & snacks	Free sauce is offered with all products.	Snacks → Chips ¹⁹ Fast Food → Fries ⁹⁴⁹	kibbeling ¹¹⁵ ice cream ¹⁰⁰⁰ fries ²⁷⁵³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
freakyloadedfries-eindhoven.nl	Freaky Loaded Fries	A variety of sauces, including mayonnaise and specialty sauces, are available.	Food → Restaurants & Dining ²⁷³²⁵	dessert ⁴⁹⁶ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
freddyfrydaywestamsterdam.nl	Freddy Fryday West	The website offers a variety of sauces for the fries and dishes.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Snacks ⁶⁹³	pulled pork ¹⁶ milkshake ¹⁹⁵ vegan ⁵⁰⁸ fries ²⁷⁵³	North-Holland → Amsterdam ⁴¹²⁵³
frenchtacos-roermond.nl	French Tacos and More	The website offers a wide selection of Sauces, which can be chosen to personalize a Taco or Burger.	Fast Food → Burger Restaurants ³⁴⁶	taco ⁹² burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³	Limburg → Roermond ²⁶⁰²
frietboutique-rotterdam.nl	Frietboutique Rotterdam	The website features a wide selection of sauces, including mayonnaise, curry and satay sauce.	Quick Bites → Hair Salon ¹¹²	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
frietboutiquehillegersberg-rotterdam.nl	Frietboutique Hillegersberg	The website offers a variety of sauces, such as ketchup, mayonnaise, curry and truffle mayonnaise.	Fast Food → Fries ⁹⁴⁹ Fast Food → Chicken Dishes ⁹²	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹²	South-Holland → Rotterdam ²⁵⁰⁴⁸
frietpantersbreda.nl	Friet Panters	Various sauces, such as curry, ketchup and satay sauce are available.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Delivery ²²²⁷	mayonnaise ²⁷ croquette ¹³⁶ sausage ²⁵⁶ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Brabant → Breda ⁹⁰⁰³
friturepeters-amstenrade.nl	Friture Peters	The website offers various 'sauces', including hot and cold sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	schnitzel ⁶¹ taco ⁹² fries ²⁷⁵³ drink ⁵¹⁹¹	Beekdaelen → Amstenrade ⁷²
gips-afwerking.nl	Derrick's Gipsafwerking	The website offers the option to have gypsum finishing applied with a sauce finish.	Construction Companies → Finishing Contractors ³⁸³	gypsum ³⁰ finish ⁷⁴⁷ class ²⁰⁷⁶
goatfoodconcepts.nl	G.O.A.T Food Concepts	G.O.A.T Food Concepts specializes in creating gastronomic sauces that elevate dishes to a higher level.	Food & Beverage → Food Industry ⁸³⁵	spices ³⁴⁰ fruit ¹¹⁶⁶ concept ³³³⁸ innovation ⁴⁶⁵⁹
happyfood-lopik.nl	HappyFood Lopik	A wide range of sauces are available with the order.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	poke bowl ³⁰⁸ satay ³²⁰ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Utrecht → Lopik ⁴⁶⁴
hi-freshdelft.nl	Hi-Fresh	The website describes the different sauces used in the dishes.	International → Turkish ⁴¹⁶	kapsalon ⁵⁰⁹ pasta ¹³⁸⁹ ingredients ²³⁴⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Delft ⁵³⁰⁹
holy-grill-purmerend.nl	Holy-grill Ribs & Burgers	A variety of sauces are available to combine with the hamburgers and spareribs.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	side dish ¹¹⁸ spareribs ²¹³ hamburger ³⁶⁴ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Purmerend ²⁶²⁰
horecalinebv.nl	Horecaline	Various sauces and marinades, such as Goude's Glorie and Zaanse, are offered.	Wholesale → Food Products ³⁰³ Fish & Seafood → Fresh Food ⁵²	meat products ²⁷² potato ⁵⁴² pasta ¹³⁸⁹ packaging ²²³⁶
incheon-korean-fried-chicken-almere.nl	Incheon Korean Fried Chicken Almere	There is a selection of Korean sauces such as Gulao and Honey-soy sauce used with the dishes.	Asian → Korean ⁵¹	side dish ¹¹⁸ bowl ⁴⁸² rice ⁶³⁵ chicken ⁹⁴⁴	Flevoland → Almere ⁷⁷⁶⁵
incheon-korean-fried-chicken-hoensbroek.nl	Incheon Korean Fried Chicken Hoensbroek	A wide range of sauces, including mayonnaise and Korean sweet and sour sauces, are available for orders.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Korean Restaurants ³³	korean fried chicken ¹⁸ bowl ⁴⁸² beverage ⁵⁸⁶	Heerlen → Hoensbroek ³⁷¹
incheon-korean-fried-chicken-rucphen-rucphen.nl	Incheon Korean Fried Chicken Rucphen	Various Korean sauces are used, including Gulao and soy-honey sauce.	Food Delivery → Korean Restaurants ³³	tenders ⁷⁵ bowl ⁴⁸² rice ⁶³⁵ chicken ⁹⁴⁴	North-Brabant → Rucphen ⁵³⁶
indianfoodcorner-utrecht.nl	Indian Food Corner	The dishes are served with various sauces, such as sweet tamarind chutney, sweet chili sauce, and a very spicy sauce.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Casual ¹⁶	roti ³⁰³ vegetarian ³³⁷ curry ³⁵⁵ rice ⁶³⁵ chicken ⁹⁴⁴	Stichtse Vecht → Maarssen ¹⁰⁵¹
ipinke-tilburg.nl	I Pin Ke	The website offers various sauces, such as spicy sauce and sweet and sour sauce, with the dishes.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷ Catering & Ready Meals → Indonesian Restaurant ³⁹²	nasi goreng ⁶⁵ rice table ²⁷⁷ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
jerusalem-denhaag.nl	Jerusalem Den Haag	Various sauces are available for the dishes and sandwiches.	International Cuisine → Middle Eastern Cuisine ⁷² Food Delivery → Delivery ²²²⁷	meat ²⁰⁵⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
joopssnackcorner.nl	Joop's Snackcorner	A large assortment of sauces is available to combine with the dishes.	Fast Food → Burgers ⁶⁸⁷	plate ⁷⁸⁷ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Kampen ²¹⁶¹
kinky-streetfood-amsterdam.nl	Kinky Streetfood	The website offers various sauces to complement the dishes, such as Kinky burger sauce and garlic sauce.	Websites → Ordering Sites ⁷⁵	pita ¹⁹⁹ wrap ⁸²⁶ vegetables ¹⁴¹⁶ burger ¹⁴³¹ fries ²⁷⁵³	North-Holland → Amsterdam ⁴¹²⁵³
kostadianakersloot.nl	Kostadian	The website offers a variety of sauces, such as Cheddar Cheese Sauce, Guacamole and Salsa.	Mexican & South American → Mexican ¹⁵¹	quesadilla ¹¹ burrito ⁶² taco ⁹² dessert ⁴⁹⁶	Castricum → Akersloot ²⁴²
la-porta-gouda.nl	La Porta Gouda	The website mentions several sauces, such as mayonnaise and chili sauce, which are used in the dishes.	Cafes → Dutch Restaurants ¹⁰³¹ Activities → Dining Out ¹⁸¹	wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶	South-Holland → Gouda ³⁵²¹
lbchickn-hoogeveen.nl	LB Chick'n	The website offers a variety of sauces, including BBQ mayo, sweet chili dip, and garlic sauce.	Fast Food → Chicken Dishes ⁹² Cooking & Recipes → Dishes ³³⁵	chicken dishes ²⁶ bucket ¹¹³ burger ¹⁴³¹ fries ²⁷⁵³	Drenthe → Hoogeveen ²²⁹⁴
lunchroomspiespetitrestaurant-driel.nl	Lunchroom Spies Petit Restaurant	There is a choice of different sauces, such as mayonnaise, curry, peanut sauce and tomato ketchup.	Cafeteria → Dutch Cafeteria ¹²² Turkish Cuisine → Fast Food ³²²²	entree ¹⁵ croquette ¹³⁶ soup ¹⁰⁴³ fries ²⁷⁵³ snack ²⁹¹⁶	Overbetuwe → Driel ¹⁵⁹
mavin-king-waalwijk-grotestraat.nl	Mavin King Waalwijk	Customers can choose from a wide range of sauces, such as garlic sauce, sambal, and mayonnaise.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	dürüm ⁹⁷ döner ⁶⁷³ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Waalwijk ¹⁷⁴⁴
merosburger-schiedam.nl	Mero's Burger	The website describes an assortment of sauces that can be served with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	South-Holland → Schiedam ²²⁴⁹
naegelke-sittard.nl	Cafetaria 't Naegelke	There is an extensive selection of sauces, both hot and cold.	Quick Bites → Cafeteria ⁹⁰⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Sittard-Geleen → Sittard ¹⁹⁹⁷
oses-cigkofte-alkmaar.nl	Oses Çigköfte Alkmaar	Various sauces are offered with the çiğköfte packages and kapsalons, such as garlic sauce and sambal.	Turkish Cuisine → Fast Food ³²²²	turkish pizza ⁶³ kapsalon ⁵⁰⁹ wrap ⁸²⁶ fries ²⁷⁵³	North-Holland → Alkmaar ⁶⁵⁰⁷
otties-assen.nl	Ottie's	The website offers different sauces to flavor the meals, such as Ottie's sauce and satay sauce.	Fast Food → Burgers ⁶⁸⁷	top ³⁷⁷ bowl ⁴⁸² wrap ⁸²⁶ meal ¹⁶³⁸ salad ²⁴⁴⁴	Drenthe → Assen ³⁵¹⁶
paninodipino-vleuten.nl	Panino di Pino Vleuten	Panini are served with various homemade sauces.	Lunch → Sandwiches ⁴⁶⁶ Cooking & Recipes → Dishes ³³⁵	panini ¹⁵⁶ ingredients ²³⁴⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Vleuten - De Meern → Vleuten ⁵⁷⁴
pannenkoekrestaurantdeappelschehofappelscha.nl	Pannenkoekrestaurant De Appelsche Hof	Various sauces, such as barbecue sauce and chili sauce, enhance the flavors of the dishes.	Family & Themed Dining → Pancakes ⁴⁹ Cooking & Recipes → Dishes ³³⁵	main course ¹⁰² appetizer ⁵⁵⁶ pancakes ⁵⁶⁸ fries ²⁷⁵³	Ooststellingwerf → Appelscha ³³¹
papaganush-geleen.nl	Papa Ganush	Papa Ganush offers various sauces with the dishes, such as BBQ, traiteur, satay sauce, and tzatziki.	Fast Food → Grill Restaurant ¹²⁹	main course ¹⁰² grill ⁵⁶² sandwich ⁴⁰⁹⁸	Sittard-Geleen → Geleen ⁹⁷⁸
pasta-recepten.nl	pasta-recepten.nl	Different sauces, such as carbonara and pesto, are used in the pasta recipes.	Italian → Pasta ²¹³	spinach ¹⁶ salmon ¹⁸⁵ chicken ⁹⁴⁴ pasta ¹³⁸⁹ recipe ⁵¹⁴²
paulsfrituur-nijmegen.nl	Paul’s Frituur	Paul’s Frituur offers an extensive selection of sauces, including mayonnaise, curry and satay sauce.	International → Middle Eastern ¹¹⁶	soft drinks ⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
pieperz-eerde-veghel.nl	Pieperz Eerde	The website lists various sauces that can be served with the dishes, such as mayonnaise, barbecue sauce, and chili sauce.	Fast Food → Chicken Dishes ⁹²	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Meierijstad → Veghel ¹²⁸⁸
pietfriet-lelystad.nl	Piet Friet	The website offers a wide range of sauces to serve with fries and other dishes.	Fast Food → Fries ⁹⁴⁹	croquettes ¹⁰⁸ chip ¹³⁸ hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	Flevoland → Lelystad ³¹⁸⁰
pizzeriamavi-veenendaal.nl	Pizzeria Mavi	The dishes are served with various sauces, including cream sauce and salads.	Italian Restaurant → Pizza Restaurant ³⁵¹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	falafel ¹⁰⁸ plate ⁷⁸⁷ chicken ⁹⁴⁴ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	Utrecht → Veenendaal ²⁶⁴¹
pizzeriapotenza-biddinghuizen.nl	Pizzeria Potenza	The website describes various sauces, such as BBQ and Mad sauce, which are used with the dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Sandwiches & Salads → Sandwich Shops ²²⁹	smashburger ¹⁷ wrap ⁸²⁶ burger ¹⁴³¹ pizza ⁴¹⁵⁸	Dronten → Biddinghuizen ⁴⁰⁶
pizzeriasorrentinoenschede.nl	Pizzeria Sorrentino	The menu includes descriptions of the different sauces used with the dishes.	Italian → Pasta ²¹³ Online Services → Ordering ¹²¹	pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
plein89-ede.nl	Plein 89	The website offers a selection of sauces, such as 'mayonnaise', 'ketchup' and 'peanut sauce', which can be added to fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Coffee & Tea → Beverages ⁴⁴⁵³	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Ede ⁵¹⁰⁴
poelshorecafacilitairedienstverlening-teraar.nl	Poels Horeca & Facilitaire Dienstverlening	A variety of sauces are available, such as mayonnaise, ketchup, curry, and truffle mayonnaise.	Bakery & Food Production → Bread ⁷⁶⁵	smoothie ³⁸⁴ beverage ⁵⁸⁶ wrap ⁸²⁶ pastries ⁹⁴⁶ sandwich ⁴⁰⁹⁸	Nieuwkoop → Ter Aar ²⁷⁰
poke-specials-utrecht.nl	Poke Specials	The website offers a variety of sauces to enhance the dishes.	Food Delivery → Asian ²⁷²³ Mexican & South American → International Cuisine ⁴¹¹	poke bowl ³⁰⁸ vegan ⁵⁰⁸ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
pokeperfect-denhaag.nl	Poké Perfect Den Haag	The website offers a wide range of different sauces.	Asian → Chinese ⁴¹⁵ Asian → Japanese ¹⁴⁸⁸	combo meal ⁶⁵ poké bowl ¹⁶⁹ vegan ⁵⁰⁸ ingredients ²³⁴⁶ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
princedonerzaakvoorburg.nl	Prince Doner Zaak	The website offers a variety of sauces, such as garlic sauce, sambal, and peanut sauce.	Fast Food → Burger Restaurants ³⁴⁶ Coffee & Tea → Beverages ⁴⁴⁵³	doner ¹³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Leidschendam-Voorburg → Voorburg ¹²³⁴
ragazziitaliani-breda.nl	Ragazzi Italiani	The dishes are served with various sauces such as tomato sauce, pesto, and gorgonzola fondue.	Italian → Pasta ²¹³ Food Delivery → Delivery ²²²⁷	bruschetta ¹³ dessert ⁴⁹⁶ pasta ¹³⁸⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Breda ⁹⁰⁰³
rebelsebroodjes-enschede.nl	Rebelse Broodjes & Pokébowls	The menu includes a diverse selection of sauces, such as Rebelse sauce, garlic-dill sauce, and teriyaki.	Lunch → Sandwiches ⁴⁶⁶	poké bowl ¹⁶⁹ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
ricardosdeventer.nl	Ricardos Snackcorner Deventer	The website offers a diverse range of sauces, such as mayonnaise, ketchup and curry sauce.	Fast Food → Burger Restaurants ³⁴⁶	milkshake ¹⁹⁵ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Overijssel → Deventer ⁴⁷⁵¹
saladeriabennys.nl	Saladeria en Benny's	Various types of sauces are used with the dishes, such as dill sauce, mayonnaise, and special sauces.	Fast Food → Fries ⁹⁴⁹ Online Retail → Food Retail ³⁴⁰	salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Limburg → Roermond ²⁶⁰²
sjonbats.nl	Sjon Bats AGF	Various sauces and dressings are available for topping up dishes.	Vegetables → AGF ¹³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	lettuce ²⁶ fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶ salad ²⁴⁴⁴
slagerijaminleidscherijn-utrecht.nl	Slagerij Amin Leidsche Rijn	A diverse selection of sauces is available, including homemade curry and Andalouses sauce.	Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Woerden → Leidsche Rijn ⁴³⁰
smikkelhuukske.nl	Cafetaria 't Smikkelhuukske	A diversity of sauces are available for the fries.	Quick Bites → Cafeteria ⁹⁰⁶ Catering & Ready Meals → Takeaway ⁴⁰⁹	portion ³³ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹
snackbar-schoon-schip-rotterdam.nl	Snackbar Schoon-Schip	A wide range of sauces is available to accompany the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	fingerfood ⁴¹ hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbardelimbeek-eindhoven.nl	Snackbar de Limbeek	The website offers a variety of sauces to accompany the fries.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
snackbardewalenburger-rotterdam.nl	Snackbar De Walenburger	A wide range of sauces are available to enhance the dishes.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	falafel ¹⁰⁸ kapsalon ⁵⁰⁹ döner ⁶⁷³ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackservice-rotterdam.nl	Snackservice Rotterdam	A wide selection of sauces is available, such as mayonnaise, ketchup, and special sauce.	Food Delivery → Delivery ²²²⁷ Cuisine → Vegetarian ⁶⁹⁷	halal ¹⁶⁵ vegetarian ³³⁷ vegan ⁵⁰⁸ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
snacktotake-almerehaven.nl	Snack to Take	The website offers a wide variety of sauces.	Fast Food → Fries Restaurants ⁸⁷	surinamese ⁴¹ fry ⁵⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Almere → Almere Haven ²¹⁶
soepeltjes.nl	Soepeltjes	In addition to soups, Soepeltjes also supplies a wide assortment of delicious sauces.	Japanese → Poke ¹⁹ Asian → Thai ³⁰¹	soup ¹⁰⁴³	North-Brabant → Oosterhout ²⁰⁸⁶
spareribslijnroosendaal.nl	Spareribslijn Roosendaal	BBQ sauce and garlic sauce are standard side dishes.	Lunch → Sandwiches ⁴⁶⁶ Activities → Dining Out ¹⁸¹	coleslaw ¹⁰ bread roll ²⁸ spareribs ²¹³ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Roosendaal ²⁶⁷⁷
sterdoner-lelystad.nl	SterDoner	A wide range of sauces are available to enhance the dishes, including garlic sauce, sambal, and mayonnaise.	Fast Food → Burger Restaurants ³⁴⁶	doner ¹³¹ plate ⁷⁸⁷ wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Flevoland → Lelystad ³¹⁸⁰
sukusuku-amsterdam.nl	Suku Suku	The noodle dishes are served with various sauces, such as teriyaki, hot Asia, and sweet and sour sauce.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Asian ²⁷²³	noodles ¹⁹¹ wok ²³¹ meat ²⁰⁵⁵ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
tadindacigkofte-denhaag.nl	Tadinda Cigköfte	Granaatappelsaus (pomegranate sauce) is a signature sauce often served with çiğköfte and sushi.	Turkish Cuisine → Fast Food ³²²² Catering & Ready Meals → Takeaway ⁴⁰⁹	dürüm ⁹⁷ sushi ¹⁶⁹⁵ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
talincatering-hoofddorp.nl	Talin Catering	Various sauces are offered, such as tahini sauce and garlic sauce.	Fast Food → Burger Restaurants ³⁴⁶ Cafes → Dutch Restaurants ¹⁰³¹	falafel ¹⁰⁸ hamburger ³⁶⁴ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
tang-wok-express-krommenie.nl	Tang Wok Express	Various sauce variations are offered with the wok boxes, such as gon-bao, black pepper, Balinese ketjap, and sweet and sour sauce.	Food Delivery → Indonesian ⁵⁰² Catering & Ready Meals → Asian Cuisine ¹³⁷	wok box ¹⁵ side dish ¹¹⁸ rice ⁶³⁵ meal ¹⁶³⁸	Zaanstad → Krommenie ⁴⁰⁹
tbrinkje-deventer.nl	t Brinkje	The website offers diverse sauces for fries, sandwiches, and other dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	kebab ²⁷⁶ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Deventer ⁴⁷⁵¹
tfriethuissliedrecht-sliedrecht.nl	t Friethuis Sliedrecht	The menu offers a selection of sauces, including mayonnaise, curry and special sauces.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	fry ⁵⁹ croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Sliedrecht ⁸⁶³
the-golden-stork.nl	Vegetarian Streetfood by TGS	The website offers an extensive selection of sauces, such as chili mayonnaise, kimchi mayonnaise and vegan garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Cuisine → Vegetarian ⁶⁹⁷	bun ²⁷ dessert ⁴⁹⁶ burger ¹⁴³¹	South-Holland → The Hague ¹⁹⁸⁹⁸
the-kebab-store.nl	The Kebab Store	A wide selection of sauces is available to enhance the dishes to taste.	Italian Restaurant → Pizza Restaurant ³⁵¹ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	lahmacun ⁹³ kebab ²⁷⁶ plate ⁷⁸⁷ box ¹⁹⁸² sandwich ⁴⁰⁹⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
the-pizzabus-geleen.nl	The Pizzabus	The website describes the various available sauces.	Fast Food → Fries Restaurants ⁸⁷ Lunch → Sandwiches ⁴⁶⁶	top ³⁷⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Sittard-Geleen → Geleen ⁹⁷⁸
theroastary-amstelveen.nl	The Roastary	The Roastary offers various sauces, including sauces for the chicken products.	Websites → Online Services ³⁰ Supermarkets & Grocery → Butchers ⁷⁴⁷	chicken products ¹⁷ ice cream ¹⁰⁰⁰ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amstelveen ³¹⁸⁰
tokoonshuis.nl	Toko ons Huis	Toko ons Huis sells a broad selection of sauces that complement various dishes.	Dairy & Cheese → Specialty Food Stores ⁶⁴	marinades ¹⁹ ship ⁵¹⁰³	Gelderland → Arnhem ⁸⁶⁸⁰
tuana-breda.nl	Tuana	Customers can supplement their plates and sandwiches with a wide range of sauces, such as sambal, onions, vegetables, satay sauce or mayonnaise.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Takeout Restaurant ⁸¹	plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
villa-don-amsterdam.nl	Villa Don	Villa Don offers a variety of sauces, including mayonnaise, ketchup, and satay sauce.	Fast Food → Fries Chain ⁴⁶ Sandwiches & Salads → Sandwich Shops ²²⁹	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
vishuysch-haarlem.nl	Vishuysch Haarlem	Customers have a choice of various sauces, such as cocktail, ragout, and garlic sauce.	Restaurants & Dining → Seafood Restaurants ⁶¹² Supermarkets & Grocery → Fish Shops ¹⁹¹	shrimp ²¹⁹ fish ¹¹²¹ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
visspecialistpasel-groningen.nl	Vis Specialist Pasel	A variety of sauces are available to complement the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹² Dairy & Cheese → Delicatessens ⁶¹⁷	kibbeling ¹¹⁵ herring ¹⁵⁶ fish ¹¹²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Netherlands → Groningen ²³⁷³⁴
webshop-cucinafrancesca.nl	Cucina Francesca	The shop provides a wide assortment of sauces, including various spices and pickling products.	Italian → Italian Products ²³	olive oil ³⁴⁶ pasta ¹³⁸⁹
eethuisluciensamsterdam.nl	Eethuis Lucien's	Various sauces are offered, including mayonnaise, ketchup, and curry sauce.	Fast Food → Burger Restaurants ³⁴⁶ Grilling & Steaks → American ⁸⁵	pancakes ⁵⁶⁸ burger ¹⁴³¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
hira-pide-rotterdam.nl	Hira Pide	Various sauces are offered with the orders.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Food Delivery → Delivery ²²²⁷	pide ⁵⁶ kapsalon ⁵⁰⁹ döner ⁶⁷³ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
fritureflipper-sittard.nl	Friture Flipper	The website describes the various sauces available with the fries.	Fast Food → Burger Restaurants ³⁴⁶	fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Sittard-Geleen → Sittard ¹⁹⁹⁷
steakhouse-pizzeria-bos-en-lommer.nl	Steakhouse Pizzeria Bos en Lommer	The menu indicates the different types of sauces, such as tomato sauce, cream sauce, and pesto.	Fast Food → Fries Restaurants ⁸⁷ Activities → Dining Out ¹⁸¹	top ³⁷⁷ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
nazareth-hhw.nl	Nazareth	A wide range of sauces is available to accompany the dishes.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Dishes ³³⁵	family package ¹⁷ döner kebab ⁸¹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
teparosthaiwok-haarlem.nl	Teparos Thai Wok	The website describes different sauces, including a natural tomato sauce and Thai peanut sauce.	Asian → Thai ³⁰¹ Food Delivery → Delivery ²²²⁷	noodles ¹⁹¹ curry ³⁵⁵ vegetables ¹⁴¹⁶	North-Holland → Haarlem ⁸⁶⁷⁴
cafekralingseveer-rotterdam.nl	Cafetaria Kralingse Veer	The website offers a large selection of sauces, such as mayonnaise, curry, and Joppiesauce.	Fast Food → Fries ⁹⁴⁹ Lunch → Sandwiches ⁴⁶⁶	croquettes ¹⁰⁸ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ package ⁶¹¹²	South-Holland → Rotterdam ²⁵⁰⁴⁸
receptonline.nl	ReceptOnline.nl	A characteristic of the ‘Burnt Ends of Frikandel’ recipe is the sticky barbecue sauce.	Cooking & Recipes → BBQ ²³⁶	frikandel ¹⁸ bbq ⁹⁰⁸ recipe ⁵¹⁴²
frituurdeheeg.nl	Frituur De Heeg	The frituur offers a variety of homemade sauces.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	vegetarian ³³⁷ hamburger ³⁶⁴ plate ⁷⁸⁷ fries ²⁷⁵³	Limburg → Maastricht ⁶⁰⁰⁸
broodjearnhemnoord-arnhem.nl	Broodje Arnhem Noord	The website has an overview of the available sauces.	Fast Food → Burgers ⁶⁸⁷ Sandwiches & Salads → Sandwich Shops ²²⁹	toastie ⁴⁵ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
vlaamsfriteshuisloket13-apeldoorn.nl	Vlaams Friteshuis 't Brinkje	A wide variety of sauces are available to garnish the dishes.	Fast Food → Fries ⁹⁴⁹ Online Retail → Food Retail ³⁴⁰	loaded fries ⁴¹ spring roll ⁸² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Apeldoorn ⁶⁹⁹⁶
akdaggroothandel.nl	Akdag Groothandel B.V.	Akdag Groothandel supplies a wide range of sauces.	Dairy & Cheese → Dairy ⁷⁶³	bakery products ¹³ frozen products ¹⁶ dairy products ⁴¹ packaging ²²³⁶ ingredients ²³⁴⁶
restaurant-japas.nl	Restaurant Japas Nijkerk	The order can be customized by adding or removing specific sauces, such as soy sauce and wasabi.	Asian → Japanese ¹⁴⁸⁸	bowl ⁴⁸² sushi ¹⁶⁹⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Gelderland → Nijkerk ³⁶⁰⁸
desnackerijhaarlem.nl	De Snackerij	A wide range of sauces, such as mayonnaise, peanut sauce and curry, is available to enhance the dishes.	Fast Food → Fries ⁹⁴⁹	menus ²²¹ potato ⁵⁴² snack ²⁹¹⁶	North-Holland → Haarlem ⁸⁶⁷⁴
weertvenezia.nl	Venezia Online bestellen	There are various sauces available to use with the dishes.	Food Delivery → Delivery ²²²⁷ Cooking & Recipes → Dishes ³³⁵	italian ³²⁰ appetizer ⁵⁵⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	Limburg → Weert ²⁰³⁰
chefsburger2.ordersys.nl	Chef's Burger II	The website offers a selection of different sauces, including curry, garlic sauce and peanut sauce.	Fast Food → Burger Restaurants ³⁴⁶ Meal Solutions → Food Businesses ⁵⁷	döner ⁶⁷³ burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶
wokdayandnight.ordersys.nl	Wok Day & Night	The dishes are served with various homemade sauces, such as sweet chili and Hong Kong sauce.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	noodles ¹⁹¹ shrimp ²¹⁹ wok ²³¹ chicken ⁹⁴⁴	North-Holland → Amsterdam ⁴¹²⁵³
sfinxonline.nl	Sfinx	A variety of sauces are available to order.	Italian Restaurant → Pizza Restaurant ³⁵¹	pasta ¹³⁸⁹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Dordrecht ⁴⁵³¹
dickkokzuurwaren.nl	Dick Kok Zuurwaren	The website details a wide range of homemade sauces, specifically designed for use with fish.	Restaurants & Dining → Seafood Restaurants ⁶¹² Administrative Support → Family Businesses ⁶⁶⁴	preserve ¹⁵ family business ⁷⁹³ fish ¹¹²¹ assortment ⁷⁷⁹⁹	Edam-Volendam → Volendam ⁹⁴⁸
deheerenvankatwijck.nl	De Heeren van Katwijck	A wide range of sauces, such as mayonnaise, ketchup and curry, is offered with the fries and snacks.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	croquette ¹³⁶ potato ⁵⁴² fries ²⁷⁵³	South-Holland → Oegstgeest ⁸⁰⁰
bar-bamsterdam.nl	Bar-B, Burgers 'N' Beer	Burgers are served with various sauces, such as ketchup, mayonnaise, and truffle mayonnaise.	Fast Food → Burgers ⁶⁸⁷ Directories → Web Portals ²⁴⁰	chicken ⁹⁴⁴ cheese ¹²⁰⁵ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
lasenegalaise.nl	La Senegalaise	The website introduces Madame Jeanette, a hot sauce available at festivals.	Produce & Vegetables → Vegetables ¹⁰⁷⁰ Regions → Africa ⁷¹³	rice ⁶³⁵ vegetables ¹⁴¹⁶ recipe ⁵¹⁴² catering ⁶⁴⁵⁶ workshop ¹⁹³²⁵
gangnamchicken.nl	GANGNAM CHICKEN	The restaurant utilizes a variety of sauces to enhance the flavor profile of their chicken dishes.	Websites → Business Websites ¹⁸⁸ Fast Food → Burgers ⁶⁸⁷	navigation ³³⁰ cookie ⁶⁰² chicken ⁹⁴⁴
vangoghfrites.nl	Frituur Van Gogh	The frituur offers a variety of sauces.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	artisan ⁹⁴ croquette ¹³⁶ foodtruck ⁶¹³ fries ²⁷⁵³ workshop ¹⁹³²⁵	Amersfoort → City Center ²³
apollofood.nl	Apollo	The website describes various sauces, dressings and glazes, intended to elevate dishes.	Hospitality → Suppliers ¹⁰⁵⁷ Administrative Support → Family Businesses ⁶⁶⁴	marinades ¹⁹ onion ¹¹¹ spices ³⁴⁰ recipe ⁵¹⁴²
barbecuebus.nl	The Barbecuebus	Various sauces are available to enhance the meat dishes.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Outdoor → Barbecues ⁷⁴⁴	barbecue package ¹⁷ meat ²⁰⁵⁵ salad ²⁴⁴⁴ package ⁶¹¹²	Amsterdam → North ⁶⁵⁷
defrituurhal.nl	De Frituurhal	The Frituurhal makes various fresh sauces.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ restaurant ¹¹²¹⁵	North-Brabant → Eindhoven ¹¹⁸⁴⁵
bbqbuddies.nl	BBQBuddies	The webshop offers a variety of sauces for barbecue dishes.	Fuel & Energy → Fuels ²²⁴	wood chips ⁴⁰ charcoal ¹³⁸ spices ³⁴⁰ barbecue ¹¹⁷⁵ accessories ¹²⁹⁷⁵	Utrecht → Veenendaal ²⁶⁴¹
pandfriet.nl	PAND Friet	PAND Friet has an extensive selection of 7 different sauces to serve with the fries.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	potato ⁵⁴² burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Haarlem → Schalkwijk ²¹⁴
turnpikebbq.nl	Turnpike Barbecue	Sauces are award-winning blends that Turnpike Barbecue develops and distributes, and are a key part of their product range.	Barbecues → Barbecue Supplies ¹⁹	rub ²³ thermometer ⁵⁹ knife ²⁴² barbecue ¹¹⁷⁵ brand ¹⁷⁷³⁷
woktogether.nl	Wok Together Weesp	Customers can choose from a selection of sauces to complete their wok dish.	Food Delivery → Asian ²⁷²³	wok ²³¹ vegan ⁵⁰⁸ chef ⁶³¹ ingredients ²³⁴⁶ menu ¹³⁸⁵⁶	Amsterdam → Weesp ¹⁰⁰⁵
delicieuxbroodjesenschede.nl	Delicieux	The website describes a unique, own sauce as an important part of the flavor experience of their sandwiches.	Sandwiches & Salads → Sandwich Shops ²²⁹	instagram ¹²¹⁶ ingredients ²³⁴⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²	Enschede → Usselo ⁴¹
paolos.nl	Paolo's Foodblog	The website contains various sauces, such as the original Bolognese sauce.	Cooking & Recipes → Cuisine ¹¹⁴⁷	lasagna ²³ main course ¹⁰² soup ¹⁰⁴³ pasta ¹³⁸⁹ recipe ⁵¹⁴²
vanbeekumspecerijen.nl	Van Beekum Specerijen	In addition to herbs and spices, the store also offers a selection of quality sauces.	Cooking & Recipes → Spices ¹⁴⁴ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	spices ³⁴⁰ herbs ⁹²⁴ order ⁶⁹¹²
voetsspecialiteiten.nl	Voets Specialiteiten	The website mentions the production of their own sauces and dips.	Dairy & Cheese → Delicacies ¹²⁷ Meat → Meat Products ²¹¹	delicacies ²⁷³ showroom ⁴⁸⁸³ newsletter ⁶⁵⁰⁴ assortment ⁷⁷⁹⁹
mannekenpis.nl	Manneken Pis	The website offers a wide selection of different sauces.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ job ²⁷⁹⁵ employee ⁴⁴²⁹ restaurant ¹¹²¹⁵	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
nondejuwalekker.nl	Nondeju, Wa Lekker!	In addition to dishes, the website also offers recipes for various sauces.	Context ¹⁶¹³⁹⁴	doughnuts ⁴³ brabant ²³⁵ ingredients ²³⁴⁶ recipe ⁵¹⁴²
rosita-foods.nl	Rosita's	The assortment includes fragrant sauces that complement the dishes.	Turkish Cuisine → International ¹²⁰⁷ Quick Bites → Food Trucks ⁶²³	pulled pork ¹⁶ spices ³⁴⁰ sandwich ⁴⁰⁹⁸ recipe ⁵¹⁴² atmosphere ⁵⁵⁹¹
kiraku.nl	Kiraku	Throughout its history, Kiraku has developed its own collection of homemade sauces to complement its dishes.	Japanese → Sushi ⁹⁷¹	tempura ²⁰ sushi ¹⁶⁹⁵ restaurant ¹¹²¹⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
samsgrillroom-lemmer.nl	Sam's Grillroom Lemmer	Customers can choose from two sauces with their order.	Fast Food → Burger Restaurants ³⁴⁶ Pastries & Baked Goods → Menus ²²³	chicken fillet ³⁵ shawarma ³³⁵ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	De Fryske Marren → Lemmer ¹¹⁸⁸
choux.nl	Choux Restaurant	Choux produces its own natural seasoning sauce, 621 Ferments, highlighting a commitment to sustainability.	Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	reservation ³³⁷³ wine ⁴⁴⁷⁶ menu ¹³⁸⁵⁶ sustainability ¹⁸⁴⁵¹	North-Holland → Amsterdam ⁴¹²⁵³
wokplaza-sluiskil.nl	Wokplaza Sluiskil	A variety of Eastern sauces are available to flavor the wok dishes.	Food Delivery → Asian ²⁷²³ Activities → Dining Out ¹⁸¹	wok ²³¹ birthday ²⁵² meal ¹⁶³⁸ buffet ¹⁷⁴⁷ drink ⁵¹⁹¹	Terneuzen → Sluiskil ⁴⁹
sinckamsterdam.nl	Sinck	The kitchen team focuses on preparing delicious dishes with a particular attention to sauces.	Catering & Ready Meals → European Cuisine ⁶¹ Performances & Entertainment → Nightlife ⁷⁰¹	wine bar ¹²⁸ wine ⁴⁴⁷⁶ restaurant ¹¹²¹⁵	North-Holland → Amsterdam ⁴¹²⁵³
cafetariafrietvanpiet.nl	Grandtaria Friet van Piet	A wide range of sauces, including homemade variations, is available.	Fast Food → Burger Restaurants ³⁴⁶ Quick Bites → Hair Salon ¹¹²	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
foodfellows.nl	Food Fellows	The website offers blends and sauces made from rescued vegetables.	Wholesale → Food Products ³⁰³ Food & Diet → Food Waste ⁶⁰	byproduct ¹⁵ vegetables ¹⁴¹⁶ sustainability ¹⁸⁴⁵¹
cigkoftem.nl	Çiğköftem	Various sauces are available, including spicy and less spicy options.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	falafel ¹⁰⁸ vegetables ¹⁴¹⁶ package ⁶¹¹²
hilverenbeek-kusadasi.nl	Kusadasi Hilvarenbeek	Customers can choose from a variety of sauces to combine with their plates or sandwiches.	Lunch → Sandwiches ⁴⁶⁶ Sandwiches & Salads → Appetizers ⁴⁰	plate ⁷⁸⁷ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	North-Brabant → Hilvarenbeek ⁸⁴³
pontneufamsterdam.nl	Pont Neuf	Pont Neuf offers exotic sauce combinations that customers absolutely must try.	Fast Food → Fries ⁹⁴⁹ Local & Regional Focus → Local Businesses ¹⁰⁷⁷	foodtruck ⁶¹³ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Amsterdam → Zunderdorp ⁷³¹
allesvoorkamado.nl	Allesvoorkamado B.V.	A selection of BBQ sauces is offered.	Outdoor → Barbecues ⁷⁴⁴	rub ²³ kamado ¹⁰³ charcoal ¹³⁸ accessories ¹²⁹⁷⁵
hela.nl	Hela Thissen B.V.	Hela offers a variety of snack sauces.	Sandwiches & Salads → Appetizers ⁴⁰ Marketing & Advertising → Business Information ²⁹⁴	dressings ¹⁰ recipe ⁵¹⁴²
zininvers.nl	Zin in Vers	The website offers a wide range of sauces and flavorings to enhance dishes.	Hospitality → Suppliers ¹⁰⁵⁷ Fish & Seafood → Fresh Food ⁵²	packs ⁵⁶ oyster ¹¹⁸ fish ¹¹²¹ meal ¹⁶³⁸ meat ²⁰⁵⁵
tastysalkmaar.nl	Tasty’s Alkmaar	There is a wide selection of sauces to combine with the fries.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	hotdog ³⁵ bread ¹⁶²² salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	North-Holland → Alkmaar ⁶⁵⁰⁷
loomansalades.nl	Looman Salades	Looman Salades offers delicious and creamy sauces with different flavors, such as garlic, curry and cocktail sauce.	Produce & Vegetables → Vegetables ¹⁰⁷⁰ Food & Beverage → Food Industry ⁸³⁵	chicken ⁹⁴⁴ salad ²⁴⁴⁴ recipe ⁵¹⁴²	North-Brabant → Oss ²⁹⁶²
snackbar-snoepy.nl	Snackbar Snoepy	Various sauces are available to choose from with the dishes.	Quick Bites → Snack Bar ⁵⁸⁰ Turkish Cuisine → Fast Food ³²²²	party box ³⁵ spareribs ²¹³ kapsalon ⁵⁰⁹ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
kipvanspit.nl	Kip van ‘t Spit – de Grill oet Grunn”	The food truck serves a variety of homemade sauces to customize the dishes to your liking.	Quick Bites → Food Trucks ⁶²³ Event Styling & Decoration → Event Equipment ⁷⁷⁵	foodtruck ⁶¹³ döner ⁶⁷³ chicken ⁹⁴⁴ fries ²⁷⁵³ event ⁴⁵¹⁹⁹	Netherlands → Groningen ²³⁷³⁴
frietvanriet.nl	Friet van Riet	The cafetaria offers an extensive selection of homemade sauces.	Cafeteria → Dutch Cafeteria ¹²²	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ family ⁶⁴⁶²	North-Brabant → Breda ⁹⁰⁰³
gyrosstraat-alkmaar.nl	Gyrosstraat	Various homemade sauces are available, including tzatziki and garlic sauce.	International → Greek ⁴⁶⁵ Sandwiches & Salads → Snacks ⁶⁹³	gyro ⁹⁵ pita ¹⁹⁹ salad ²⁴⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸	North-Holland → Alkmaar ⁶⁵⁰⁷
grillroomcleopatra-heerhugowaard.nl	Grillroom Cleopatra Heerhugowaard	The customer can choose from a variety of sauces when ordering their dish.	International → Turkish ⁴¹⁶ Restaurants & Dining → Mediterranean & Middle Eastern ¹¹⁰⁰	kebab ²⁷⁶ shawarma ³³⁵ plate ⁷⁸⁷ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Dijk en Waard → Heerhugowaard ²⁰¹¹
albafood.nl	Alba Food	Rimboe Sauzen is a brand of sauces inspired by Asian cuisine.	Essential → Food ⁴⁷⁹⁹⁹	wholesaler ²²⁵ distribution ¹⁰¹¹ food ³⁸⁷² collaboration ¹⁶⁰³⁶
de-ijsselsteinse-frietzaak-ijsselstein.nl	The IJsselsteinse Frietzaak	A wide selection of sauces is available to pour over the fries or other dishes.	Fast Food → Fries Restaurants ⁸⁷ Sandwiches & Salads → Sandwich Shops ²²⁹	top ³⁷⁷ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → IJsselstein ¹¹⁰⁷
ovenschotel.nl	ovenschotel.nl	The casserole dishes are often finished with a creamy sauce.	Cuisine → Dutch Cuisine ¹⁷⁹	cauliflower ¹⁰ casserole ¹² ravioli ¹⁴ shrimp ²¹⁹ potato ⁵⁴²
roweispecerijen.nl	Rowei Specerijen	A wide range of sauces and marinades are available for various purposes.	Wholesale → Foodstuffs ⁶⁴ Cooking & Recipes → Spices ¹⁴⁴	spice mixes ²¹ spices ³⁴⁰ herbs ⁹²⁴ meat ²⁰⁵⁵ package ⁶¹¹²
tokoazia.nl	Toko Azia	Various sauces are available from different cuisines.	Destinations → Asia ³⁷⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	noodles ¹⁹¹ spices ³⁴⁰ cosmetics ⁶⁴⁸ food ³⁸⁷² drink ⁵¹⁹¹
byoak.nl	By OAK	By OAK uses authentic sauces, developed and passed down through generations.	Food Delivery → Delivery ²²²⁷ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	wok dish ⁶⁶ streetfood ¹⁵¹ ingredients ²³⁴⁶ restaurant ¹¹²¹⁵	Southwest-Friesland → Sneek ¹⁹²¹
kindako.nl	Kindako	Kindako’s Takoyaki is topped with a homemade sauce, a crucial element of the traditional flavor profile.	Cooking & Recipes → Cuisine ¹¹⁴⁷	netherlands ¹³⁷⁶ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
flavorsdenhaag.nl	Flavor’s Den Haag	Flavor's uses homemade herbs and sauces to enhance its dishes.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵	rib ¹⁹¹ brasserie ⁷⁵² dish ⁵⁹³⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
rookmetsmaak.nl	ROOKmetSMAAK	Various sauces and rubs are offered to add more flavor to dishes.	Outdoor → Barbecues ⁷⁴⁴	smoking wood ¹¹ dutch oven ¹⁷ accessories ¹²⁹⁷⁵ blog ¹³³⁹²	Flevoland → Urk ⁷⁶²
haagens.nl	Haagens	Haagens uses a secret homemade sauce for the sandwiches, which is a key element of the flavor.	Cafes & Lunch → Lunch Spots ²³⁷	smoothie ³⁸⁴ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Northeast-Friesland → Dokkum ⁸⁴⁶
boeufamsterdam.nl	Boeuf Amsterdam	Home-made sauces are a key component of Boeuf's burger recipe, contributing to their unforgettable flavor.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ meat ²⁰⁵⁵ restaurant ¹¹²¹⁵	North-Holland → Amsterdam ⁴¹²⁵³
vleestomaat.nl	Van den Bosch	Tomatoes are often added to sauces, giving them an extra flavor and color.	Vegetables → Tomatoes ³² Produce & Vegetables → Fruit ⁸⁰¹	soup ¹⁰⁴³ barbecue ¹¹⁷⁵	Lansingerland → Bleiswijk ⁵⁷⁹
naturalnaturefood.nl	Natural Nature Food	The sauce assortment is prominently highlighted.	Wholesale → Food Products ³⁰³ Emergency & Safety → Natural Medicine ⁷⁶³	flavor enhancer ¹⁴ sambal ⁵⁴ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹
sushisjoerd.nl	SushiSjoerd	Sticks, napkins, soy sauce, wasabi, and ginger are standardly included with orders.	Japanese → Sushi ⁹⁷¹ Food Delivery → Delivery ²²²⁷	sushi ¹⁶⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Horst aan de Maas → Horst ⁴⁵⁴
frietpanters.nl	Friet Panters	The restaurant offers an extensive range of (gluten-free) luxury sauces.	Quick Bites → Cafeteria ⁹⁰⁶ Cooking & Recipes → Cuisine ¹¹⁴⁷	foodtruck ⁶¹³ fries ²⁷⁵³ snack ²⁹¹⁶ interior ⁸⁰⁹³ event ⁴⁵¹⁹⁹	North-Brabant → Breda ⁹⁰⁰³
smashrotterdam.nl	Smash Rotterdam	The restaurant’s signature sauces are a key component of their burger experience, adding to the overall flavor profile.	Fast Food → Burger Restaurants ³⁴⁶ Fine Dining & Gastronomy → Dining ⁶⁷⁷	burger ¹⁴³¹ fries ²⁷⁵³ atmosphere ⁵⁵⁹¹ community ⁷⁹³¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
pizzarotana.nl	Rotana Pizzaservice Nijmegen	The website offers various sauces to order for the pizzas.	Food Delivery → Delivery ²²²⁷	sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Nijmegen ⁹³⁸⁴
bitterbalbezorgen.nl	Bitterbal Bezorgen	Bitterballs are delivered with sauces.	Fast Food → FEBO ²⁴ Snacks → Bitterballs ²²	bitterballs ⁴¹ packaging ²²³⁶ drink ⁵¹⁹¹ brand ¹⁷⁷³⁷	North-Holland → Amsterdam ⁴¹²⁵³
koreanfriedchickentogo.nl	Korean Fried Chicken to Go	Customers can choose from various sauces, such as Sweet Kimchi, Honey Mustard and Wasabi Mayo.	Asian → Korean ⁵¹ Food Delivery → Korean Restaurants ³³	korean fried chicken ¹⁸ dish ⁵⁹³⁶ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
shoarmavanabi.nl	Shoarma van Abi	Shoarma van Abi has a range of homemade sauces that enhance the flavor of the shoarma.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Administrative Support → Business Models ¹⁹⁴	hummus ⁶⁴ shoarma ²⁵⁴ organic ⁴⁷¹ vegan ⁵⁰⁸ social media ³³⁴²	North-Holland → Amstelveen ³¹⁸⁰
vanwesterop.nl	Snackbar/Lunchroom van Westerop	A wide variety of sauces are available.	Quick Bites → Snack Bar ⁵⁸⁰ SpecificDestinations → Destinations ¹¹⁰⁵	burger ¹⁴³¹ bread ¹⁶²² fries ²⁷⁵³ drink ⁵¹⁹¹	Noordwijk → Noordwijk-Binnen ³⁹
grillburger-noordwijk.nl	GrillBurger	Customers can add their chosen burger or dish with a sauce of their choice.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Noordwijk ²⁵⁰⁷
amsterdampokebowl.nl	Amsterdam Poke Bowl	The website emphasizes the importance of the right sauce to complete a Poké Bowl.	Asian → Japanese ¹⁴⁸⁸ Meal Solutions → Meals ⁶⁹	poké bowl ¹⁶⁹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
ethems-tiel.nl	Ethem's	The menu offers a variety of sauces with fries and other dishes.	Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gelderland → Tiel ¹⁶⁶²
tokolayang.nl	Toko Layang Layang	Dishes are often served with ketjap, a sweet-spicy sauce.	Food Delivery → Indonesian ⁵⁰² Restaurants & Dining → Takeaway Restaurants ²⁴⁰	delivery service ²³⁶ rice table ²⁷⁷ satay ³²⁰ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Teylingen → Sassenheim ⁵⁹⁹
frietvanfiets.nl	Friet van Fiets	The food truck offers a wide range of homemade sauces to accompany the fries.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	bakfiets ³⁵ rate ²⁶⁰⁶ fries ²⁷⁵³ event ⁴⁵¹⁹⁹
cafetaria-oosterpark.nl	Cafetaria Oosterpark	Various types of sauces are offered, allowing customers to choose according to their preference.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	prize wheel ⁴⁰² burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
seven-burgers.nl	Seven Burgers	The restaurant highlights the creaminess of its homemade sauces as an important aspect of the flavor.	Fast Food → Burgers ⁶⁸⁷ Bus Services → Public Transportation ⁷⁸²	bun ²⁷ hamburger ³⁶⁴ takeaway ⁶⁵³ restaurant ¹¹²¹⁵	Limburg → Roermond ²⁶⁰²
gioscorner.nl	Gios Corner	A wide selection of sauces, from sweet to spicy, offers customers many options to season their meals.	Cooking & Recipes → Spices ¹⁴⁴	spices ³⁴⁰ tea ¹¹⁴⁶ drink ⁵¹⁹¹	Tynaarlo → Zuidlaren ⁴⁴⁵
cafetaria-corvers.nl	Eethuis Corvers	Corvers uses homemade sauces, such as sour meat and goulash, which are prepared in an artisanal way.	Quick Bites → Cafeteria ⁹⁰⁶ Family & Themed Dining → Family Restaurants ¹⁶⁹	potato ⁵⁴² cafe ¹⁶²² fries ²⁷⁵³ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Sittard-Geleen → Geleen ⁹⁷⁸
specerijenberg.nl	Specerijenberg	Rimboe sauces, sold by Specerijenberg, are popular at BBW (Bubbling Brown Sauce) and are used for satay.	Natural Medicine → Herbs ²⁶¹ Cooking & Recipes → Spices ¹⁴⁴	sambal ⁵⁴ spices ³⁴⁰ mix ³⁷⁷ herbs ⁹²⁴
hetkwekerijtjedekwakel.nl	De Kwakel	Sauces are offered to enhance the flavor of honey products.	Cooking & Recipes → Honey ¹⁰⁷	honey ⁴³² online shop ¹³¹⁰	Borger-Odoorn → Valthe ⁸³
fastfoodonline.nl	Fastfoodonline.nl	There are many different sauces available in small cups, including mayonnaise, curry and ketchup.	Fast Food → Fries ⁹⁴⁹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Teylingen → Sassenheim ⁵⁹⁹
patates.nl	Patates	The sauces that Patates offers are almost all gluten-free.	Fast Food → Fries ⁹⁴⁹	salt ¹⁵⁰ potato ⁵⁴² fries ²⁷⁵³ sustainability ¹⁸⁴⁵¹	Utrecht → Amersfoort ⁸⁰¹¹
amon-ra.nl	Amon Ra	Extra cups of sauce are offered with the dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Quick Bites → Snack Bar ⁵⁸⁰	grill specialties ¹³ fries ²⁷⁵³ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Velsen → IJmuiden ¹¹⁰⁹
freddyfryday-amsterdam.nl	Freddy Fryday Snackbar	The website describes various sauces that can be used with the orders.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	pulled pork ¹⁶ toppings ¹⁵³ milkshake ¹⁹⁵ fries ²⁷⁵³ order ⁶⁹¹²	North-Holland → Amsterdam ⁴¹²⁵³
pommesmeister.nl	Pommes Meister	The restaurant provides 14 different sauces to enhance the fries or snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	waffle ²¹⁸ master ²¹⁹ potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Venlo ⁴¹⁵⁸
snackbar-deroef.nl	Snackbar de Roef	Various sauces are available to dip the fries with.	Websites → Local Businesses ⁸⁵ Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Leeuwarden → Grou ³⁶⁶
frietkar.nl	Frietkar.nl	The website offers various sauces with the fries.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	fry cart ¹⁹ fry ⁵⁹ snack ²⁹¹⁶ arrangement ³¹⁰⁴
toppice-apeldoorn.nl	Ribs Apeldoorn	A selection of different sauces is available with the dishes.	Grilling & Steaks → Meat Dishes ⁴⁰ Outdoor → Barbecues ⁷⁴⁴	spareribs ²¹³ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ drink ⁵¹⁹¹	Gelderland → Apeldoorn ⁶⁹⁹⁶
vishandelcamps.nl	Vishandel Eduard Camps	The website also sells a range of sauces and salads to accompany the fish.	Supermarkets & Grocery → Fish Shops ¹⁹¹ Supermarkets & Grocery → Online Supermarkets ⁵³	portion ³³ cod ³⁴ salmon ¹⁸⁵ fish ¹¹²¹
ribsburgers-kwintsheul.nl	RIBS & BURGERS	Various sauces are available for topping the burgers and ribs.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	chicken burger ¹⁸ rib ¹⁹¹ hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	Westland → Kwintsheul ¹⁵³
hbc-amsterdam.nl	The Burgery	The Burgery offers various homemade sauces that can be added to the ordered dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Chicken Dishes ⁹²	wrap ⁸²⁶ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
eem-aans-muntendam.nl	Eem Aans	The website offers various types of sauces to pour over the dishes.	Cafes → Dutch Restaurants ¹⁰³¹ Turkish Cuisine → Fast Food ³²²²	bread roll ²⁸ steak ³³⁵ wrap ⁸²⁶ burger ¹⁴³¹ salad ²⁴⁴⁴	Midden-Groningen → Muntendam ⁸⁶
ici-restaurant.nl	ICI Restaurant	Various homemade sauces are offered to complete the tepan dish, such as black & pepper, chili, teriyaki and Japanese curry sauce.	Catering & Ready Meals → Asian Restaurant ¹⁶³ Events & Hospitality → Reservations ³⁷	broth ³⁷ ramen ¹⁰⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
sandraskitchen.nl	Sandra's Kitchen	Sandra Alvarez Chin Sue develops biological sauces, such as Holy Aioli and Dear Spices, emphasizing unique and flavorful combinations.	Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	spices ³⁴⁰ recipe ⁵¹⁴² restaurant ¹¹²¹⁵ book ¹¹³⁹⁶	North-Holland → Amsterdam ⁴¹²⁵³
remiarecepten.nl	Remia	The website focuses on dishes prepared with Remia sauce, which defines the flavor of the dishes.	Food → Cooking & Recipes ³⁹⁸⁹	chicken ⁹⁴⁴ salad ²⁴⁴⁴ recipe ⁵¹⁴² dish ⁵⁹³⁶
timoskitchen.nl	Timo's Kitchen	Various cold sauces are included as standard with the gourmet packages.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ package ⁶¹¹²
cafetarialunchroomgraft-oisterwijk.nl	Cafetaria Lunchroom Graft	The cafeteria offers a variety of sauces with the ordered dishes.	Sandwiches & Salads → Sandwich Shops ²²⁹	omelet ²⁰ toast ³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Alkmaar → Graft ²⁸
broereijsseltein.nl	Broere	There is a large selection of sauces available with the various dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	schnitzel ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
devissalon-denhaag.nl	De Vissalon Den Haag	Various homemade sauces are available to enhance the dishes to your liking.	Restaurants & Dining → Seafood Restaurants ⁶¹² Cooking & Recipes → Dishes ³³⁵	fish dishes ⁴⁷ fries ²⁷⁵³ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
foodmaster-dokkum.nl	Foodmaster Avia Dokkum	The website mentions various sauces that can be combined with the fries, such as curry, ketchup and satay sauce.	Fast Food → Fries ⁹⁴⁹ Fast Food → Chicken Dishes ⁹²	menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Northeast-Friesland → Dokkum ⁸⁴⁶
la-familia-rotterdam.nl	La Familia Rotterdam	A sauce is a flavoring agent that serves to enhance dishes.	Fast Food → Burger Restaurants ³⁴⁶	soft drink ³⁹ taco ⁹² shawarma ³³⁵ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
sushivroomshoop.nl	Sushi Vroomshoop	Various sauces are available to combine with the sushi and poke bowls.	Japanese → Sushi ⁹⁷¹ Japanese → Poke ¹⁹	poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ box ¹⁹⁸² menu ¹³⁸⁵⁶	Twenterand → Stationslaan ²⁶⁶
ossburgers.nl	Os’s Burgers	The various sauces and toppings are used with the burgers and fries.	Fast Food → Burgers ⁶⁸⁷	rib ¹⁹¹ milkshake ¹⁹⁵ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Hillegom ⁸⁵¹
e2foods.nl	E2 Foods B.V.	In addition to BBQ Rubs, E2 Foods also supplies natural Sauces.	Engineering → Product Development ⁵⁴³	product development ²⁵⁶
iwfholland.nl	IWF Holland	The website offers a diverse range of Asian sauces.	Catering & Ready Meals → Asian Cuisine ¹³⁷ Sauces & Condiments → Asian Food ¹⁵	canned goods ¹⁷ noodles ¹⁹¹ rice ⁶³⁵
friethuys-nova.nl	Friethuys Nova	The restaurant offers a wide range of sauces to season the fries and snacks to taste.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	shopping center ⁴⁹¹ potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Southwest ²⁴⁷
antichepassioni.nl	My WordPress	The website offers a range of Italian sauces, such as Pesto and Tapenade.	Dairy & Cheese → Delicacies ¹²⁷	cured meats ³² sweets ²²⁹ herbs ⁹²⁴ cheese ¹²⁰⁵ bread ¹⁶²²
cigkoftem-vlugtlaan.nl	Çigköftem Amsterdam Vlugtlaan	Various types of sauce are offered to customize the dishes to taste.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	dürüm ⁹⁷ falafel ¹⁰⁸ bread ¹⁶²² drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
wawburger.nl	Waw Burger	The restaurant uses in-house sauces to complement its burgers and chicken, adding unique flavors to each dish.	Fast Food → Chicken Dishes ⁹² Entrepreneurship & Business → Local Businesses ³²	chicken ⁹⁴⁴ burger ¹⁴³¹ community ⁷⁹³¹	Rotterdam → Center ³⁸²
bedda-world.nl	bedda	The website offers various vegan sauces that can be used with various dishes.	Vegan & Vegetarian → Vegan ³⁹⁰ Online Retail → Food Retail ³⁴⁰	philosophy ⁵⁷⁰ packaging ²²³⁶ recipe ⁵¹⁴²
cairokatwijkonline.nl	Cairo Online bestellen	The website sells different sauces to accompany the ordered dishes.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Katwijk ²¹⁸³
juicyburgers.nl	Juicy Burgers	The website describes various sauces used in the hamburgers and paninis.	Fast Food → Burgers ⁶⁸⁷	panini ¹⁵⁶ points ⁶¹² burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Hoorn ³⁰⁹⁰
ribhousetexasbezorgd.nl	Ribhouse Texas Boekelo	Various sauces are available to flavor the dishes.	Beverages → Beer ¹⁰⁹⁵ Turkish Cuisine → Fast Food ³²²²	main course ¹⁰² bucket ¹¹³ rib ¹⁹¹ steak ³³⁵ appetizer ⁵⁵⁶	Enschede → Boekelo ¹⁷¹
gangnamchickenshop.nl	Gangnam Chicken	Customers particularly enjoy the spicy Korean pepper sauce served alongside the chicken.	Fast Food → Burgers ⁶⁸⁷ Destinations → Asia ³⁷⁷	side ⁷⁴ chicken ⁹⁴⁴ flavor ¹⁰³² restaurant ¹¹²¹⁵	Amsterdam → Nieuw-West ⁸⁴⁴
werkenbijhenri.nl	Henri B.V.	In addition to soups, Henri also produces a wide range of sauces used in various dishes.	Jobs → Vacancies ¹⁰⁹⁹ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	soup ¹⁰⁴³ job vacancies ¹²⁴¹ meal ¹⁶³⁸	Heusden → Drunen ⁶⁵²
la-reinita-empanadas-y-productos.nl	La Reinita empanadas y productos	A selection of sauces is offered, such as chimichurri and salsa picante.	International Cuisine → Latin American ²⁵ Food Delivery → Delivery ²²²⁷	sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
ermeloschefrietzaak.nl	Ermelosche Frietzaak	The burgers are finished with a special hamburger sauce, which contributes to the flavor experience.	Fast Food → Fries ⁹⁴⁹	artisan ⁹⁴ oil ⁹⁷⁰ burger ¹⁴³¹ fries ²⁷⁵³	Gelderland → Ermelo ¹²⁰⁷
goldcoastkitchenamsterdam.nl	GoldCoast Kitchen	Various sauces, such as Palaver sauce and Shito, are used to enhance the dishes.	Food Delivery → Indonesian ⁵⁰²	peanuts ³² streetfood ¹⁵¹ rice ⁶³⁵	North-Holland → Amsterdam ⁴¹²⁵³
oliversfoodtruck.nl	Oliver's Foodtrucks	Each sandwich and snack is served with a unique and handcrafted sauce.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
mrshoarma.nl	Mr. Shoarma	Various sauces are offered with the dishes, including 3 free sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Shoarma ⁹⁰	shoarma ²⁵⁴ burger ¹⁴³¹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Flevoland → Lelystad ³¹⁸⁰
dehliz.nl	Dehliz	The customer can choose from a range of sauces when ordering sandwiches and other dishes.	Fast Food → Döner ²³⁸ Quick Bites → Hair Salon ¹¹²	kebab ²⁷⁶ döner ⁶⁷³ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Sittard-Geleen → Geleen ⁹⁷⁸
cafetariajimmys.nl	Cafetaria Jimmy's	Various sauces are served with the different fries and snack combinations.	Fast Food → Fries ⁹⁴⁹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	sausage ²⁵⁶ hamburger ³⁶⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Vught ¹²³⁰
carelscafetaria-amstelveen.nl	Carel’s Cafetaria	A wide range of sauces are available, such as mayonnaise, ketchup, and curry.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amstelveen ³¹⁸⁰
zelfmayonaisemaken.nl	Zelfmayonaisemaken.nl	The homemade mayonnaise can be used as a base for making other sauces.	Cooking & Recipes → Dishes ³³⁵	mayonnaise ²⁷ ingredients ²³⁴⁶ recipe ⁵¹⁴²
tolenschilder.nl	Tol & Schilder	The website mentions the sauce assortment as an important component of the product offering.	Fast Food → Fries ⁹⁴⁹ Food → Foodservice & Catering ⁵⁷⁷	packaging ²²³⁶ coffee ³⁸³⁸ assortment ⁷⁷⁹⁹	North-Holland → Edam-Volendam ¹⁴²⁸
snackbar-dino.nl	Snackbar Dino Vlaardingen	The website describes the various sauces used with fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ wok ²³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Vlaardingen ¹⁸⁵³
jouhara.nl	Jouhara's Burgers	The website describes the various sauces that can be served with the burgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	halal ¹⁶⁵ milkshake ¹⁹⁵ hamburger ³⁶⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
el-nour.nl	El Nour	The website describes various sauces that can be used with wraps and pizzas.	International → Turkish ⁴¹⁶ Cafes → Dutch Restaurants ¹⁰³¹	doner ¹³¹ shawarma ³³⁵ wrap ⁸²⁶ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Limburg → Heerlen ²⁷⁵⁵
picklesenmayo.nl	Pickles and Mayo	Pickles and Mayo offers a wide variety of sauces, including various specific flavors.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Food Trucks ⁶²³	croquette ¹³⁶ potato ⁵⁴² oil ⁹⁷⁰ fries ²⁷⁵³ event ⁴⁵¹⁹⁹
pizzashoarmaexpress.nl	Pizza Expres	Various sauces are available to top the pizzas and other dishes.	Fast Food → Burger Restaurants ³⁴⁶	hotwings ¹⁹ pasta ¹³⁸⁹ meal ¹⁶³⁸ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Overijssel → Deventer ⁴⁷⁵¹
eethuiscyprushelmond.nl	Cyprus Helmond	Each dish is served with 3 sauces.	Food Delivery → Delivery ²²²⁷	pita bread ⁵⁰ doner ¹³¹ plate ⁷⁸⁷ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
asya-helmond.nl	Asya Helmond	The website mentions various sauces that can be used in the orders.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Quick Bites → Cafeteria ⁹⁰⁶	kapsalon ⁵⁰⁹ döner ⁶⁷³ plate ⁷⁸⁷ wrap ⁸²⁶ pizza ⁴¹⁵⁸	North-Brabant → Helmond ³⁰⁵⁸
cafetariasportpark.nl	Cafetaria Sportpark Doesburg	Various sauces are available to enhance the dishes.	Quick Bites → Snack Bar ⁵⁸⁰	ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Doesburg ⁶⁰⁰
chicken-palace-amsterdam.nl	Chicken Palace Amsterdam	Customers can customize their burger with various sauces, such as mayonnaise, ketchup or curry.	Fast Food → Burger Restaurants ³⁴⁶ Lunch → Sandwiches ⁴⁶⁶	chicken fillet ³⁵ toppings ¹⁵³ vegan ⁵⁰⁸ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
miami-haarlem.nl	Miami	The pizzas are served with tomato sauce, and customers can choose from different sauces.	Food Delivery → Delivery ²²²⁷	top ³⁷⁷ kapsalon ⁵⁰⁹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
mimamita.nl	Mi Mamita	A wide range of salsa and spicy sauces from Latin America are available.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	corn ¹⁰¹ spices ³⁴⁰ beer ²⁸⁸⁷ recipe ⁵¹⁴² drink ⁵¹⁹¹
nieuwebredanaar.nl	The New Bredanaar	A wide assortment of sauces is available with the dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Döner ²³⁸	kebab ²⁷⁶ pasta ¹³⁸⁹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Breda ⁹⁰⁰³
pizzeriatiamo.nl	Pizzeria Ti-Amo	The website offers a selection of different sauces.	Quick Bites → Snack Bar ⁵⁸⁰ Turkish Cuisine → Fast Food ³²²²	platter ⁶⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹
sultan-groningen.nl	Sultan Kebab Groningen	The website offers different types of sauces, which can be added to the order.	International Cuisine → Middle Eastern Cuisine ⁷² Fast Food → Döner ²³⁸	kebab ²⁷⁶ salad ²⁴⁴⁴ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
thijsco.nl	Friture Thijsco	In addition to fries and snacks, Friture Thijsco offers a wide selection of homemade sauces.	Fast Food → Burger Restaurants ³⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
restariamainstreet.nl	MainStreet	The burgers are served with a specific MainStreet sauce.	Fast Food → Fries ⁹⁴⁹ Grilling & Steaks → Meat Dishes ⁴⁰	stew ⁶² burger ¹⁴³¹ fries ²⁷⁵³ restaurant ¹¹²¹⁵	Bladel → Hoogeloon ⁹⁹
oranje-maastricht.nl	Griekse Grillroom pizzeria Oranje	The website offers a selection of sauces to combine with the dishes.	Lunch → Sandwiches ⁴⁶⁶ Ready-To-Eat Meals → Wraps ¹⁰²	beverage ⁵⁸⁶ plate ⁷⁸⁷ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Limburg → Maastricht ⁶⁰⁰⁸
qandyshop.nl	QandyShop.nl	The store offers various types of sauces for barbecues.	Cooking & Recipes → BBQ ²³⁶ Outdoor → Barbecues ⁷⁴⁴	rub ²³ wood chips ⁴⁰ charcoal ¹³⁸
butcherbrothers-alkmaar.nl	Butcher Brothers Europaboulevard	The website offers various sauces, including Butcher Brothers sauce, pesto and truffle mayonnaise.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	chicken ⁹⁴⁴ ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
debbqschuur.nl	The Shop Builders	The shop offers a selection of BBQ sauces.	Outdoor → Barbecues ⁷⁴⁴	rub ²³ charcoal ¹³⁸ bbq ⁹⁰⁸ accessories ¹²⁹⁷⁵
chickenandmore.nl	Chicken and More	The restaurant serves a range of its own sauces, which contribute to the flavor explosion of the dishes.	Fast Food → Burgers ⁶⁸⁷	loaded fries ⁴¹ wrap ⁸²⁶ burger ¹⁴³¹ ingredients ²³⁴⁶ atmosphere ⁵⁵⁹¹	North-Holland → Amstelveen ³¹⁸⁰
radjoeart-rotterdam.nl	Radjoe Art	A variety of Indonesian sauces are available to flavor the dishes.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	beverage ⁵⁸⁶ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
brandnewbbq.nl	Brand New BBQ	The store offers a wide range of sauces from various brands.	Garden → Grills ⁶⁵ Outdoor → Barbecues ⁷⁴⁴	charcoal ¹³⁸ knife ²⁴² bbq ⁹⁰⁸ meat ²⁰⁵⁵ accessories ¹²⁹⁷⁵	Flevoland → Dronten ¹⁶⁶⁷
driehoekvelserbroek.nl	De Driehoek Velserbroek	The website describes an extensive selection of sauces that can be served with fries and other products.	Fast Food → Burger Restaurants ³⁴⁶ Quick Bites → Hair Salon ¹¹²	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶
piccolinopatathuisje.nl	Piccolino	A diverse selection of sauces is offered.	Fast Food → Fries ⁹⁴⁹	potato ⁵⁴² hygiene ⁷⁰⁶ oil ⁹⁷⁰ fries ²⁷⁵³ snack ²⁹¹⁶
sparetiid.nl	Spare Tiid	Customers can choose their desired sauce to accompany their dishes.	Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	rib ¹⁹¹ fries ²⁷⁵³ reservation ³³⁷³ menu ¹³⁸⁵⁶	De Fryske Marren → Terherne ⁹⁸
steenwijkerribs.nl	Steenwijker Ribs	Steenwijker Ribs offers a selection of homemade sauces, including garlic, rib sauce, and shaslick.	Fast Food → Burger Restaurants ³⁴⁶	spareribs ²¹³ menu ¹³⁸⁵⁶	Steenwijkerland → Steenwijk ⁸⁷⁶
hetsmulpaleisgroesbeek.nl	Het Smulpaleis Groesbeek	The website offers a diverse selection of sauces, ranging from classic flavors to special combinations.	Cafes → Dutch Restaurants ¹⁰³¹	filled sandwiches ¹⁴ dönerbox ³³ barbershop ⁵¹² menu ¹³⁸⁵⁶	Berg en Dal → Groesbeek ⁶⁵³
qualityfood.nl	Quality Food	The company began with a special french fry sauce, which is now part of a larger product range.	Meat → Meat Products ²¹¹	wholesale ²⁸⁰ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹
babarestaurant.nl	Baba Restaurant	Baba Restaurant is known for its unique, homemade sauces which are a key component of its signature flavors.	International → Middle Eastern ¹¹⁶ Fast Food → Burger Restaurants ³⁴⁶	shawarma ³³⁵ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
culinerd.nl	culinerd.nl	The website offers a recipe for a lacto-fermented sauce, a flavorful addition to various dishes.	Cooking & Recipes → Dishes ³³⁵	bacon ²² fermentation ⁸⁹ wine ⁴⁴⁷⁶ recipe ⁵¹⁴²
lynnx.nl	Lynn	One of the recipes is Chimichurri, a flavorful Argentinian sauce.	Mexican & South American → Mexican ¹⁵¹	bread ¹⁶²² salad ²⁴⁴⁴ recipe ⁵¹⁴²
anatolia-ii.nl	Anatolia 23	The customer can choose from two sauces when ordering the dishes.	Turkish Cuisine → Fast Food ³²²²	kebab ²⁷⁶ döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸
devissalon.nl	De Vissalon	De Vissalon offers homemade sauces.	Restaurants & Dining → Seafood Restaurants ⁶¹²	menus ²²¹ fish ¹¹²¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
friethuisdevlaminck-heemstede.nl	Friethuis de Vlaminck	A wide range of sauces is available to enhance the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	croquette ¹³⁶ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Heemstede ¹¹⁷³
grillroomhaifarijswijk.nl	Haifa	The website offers a wide range of sauces with the order.	Turkish Cuisine → Fast Food ³²²² Sandwiches & Salads → Italian Cuisine ⁹⁹	shawarma ³³⁵ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rijswijk ²⁰⁵⁴
roffastreetfoodbar-rotterdam.nl	Roffa Streetfoodbar	Various sauces are offered, such as chipotle mayonnaise, chimichurri mayonnaise, and BBQ sauce.	Quick Bites → Street Food ¹²⁵	sausage ²⁵⁶ burger ¹⁴³¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
bedrijfscateringsmaeck.nl	Bedrijfscatering Smaeck	Smaeck offers a unique assortment of Belgian sauces alongside other products.	Snacks → Bitterballs ²²	bitterballs ⁴¹ croquettes ¹⁰⁸ canteen ²¹⁰ wine ⁴⁴⁷⁶ event ⁴⁵¹⁹⁹	Gelderland → Arnhem ⁸⁶⁸⁰
024vis-nijmegen.nl	024 VIS	The website mentions several homemade sauces for the dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Seafood Restaurants ⁶¹²	kibbeling ¹¹⁵ fish ¹¹²¹ salad ²⁴⁴⁴ beer ²⁸⁸⁷ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
247-pizza-delivery-amsterdam-amsterdam.nl	24/7 Pizza Delivery	Several sauces are available to complement the pizzas and other dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	side ⁷⁴ panini ¹⁵⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
adam-grill-leiden.nl	ADAM Grill	The website offers a selection of various sauces.	Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	South-Holland → Leiden ⁷⁰⁸⁹
alestafoods-zoetermeer.nl	Alesta Foods	The dishes are served with various sauces, including sambal and garlic sauce.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ plate ⁷⁸⁷ container ¹⁷⁰⁹ meat ²⁰⁵⁵ pizza ⁴¹⁵⁸	South-Holland → Zoetermeer ⁴⁰⁴⁶
ali-babaafhaalenbezorgcentrum-bergenopzoom.nl	Ali-Baba Afhaal en Bezorgcentrum Bergen op Zoom	A wide range of sauces are available to add to the order.	Turkish Cuisine → Fast Food ³²²² Catering & Ready Meals → Takeaway ⁴⁰⁹	döner ⁶⁷³ burger ¹⁴³¹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Bergen op Zoom ²²⁷⁴
american-spareribs-lijn.nl	Americaans Spareribs Line	Various sauces are offered to season the dishes.	Fast Food → Burger Restaurants ³⁴⁶ Grilling & Steaks → American ⁸⁵	rib ¹⁹¹ wrap ⁸²⁶ chicken ⁹⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	Zaanstad → Wormerveer ⁵³⁰
andyslunchroom.nl	Andy’s Lunchroom & Cafetaria	The menu describes various types of sauces used in the burgers and hot dogs.	Quick Bites → Cafeteria ⁹⁰⁶ Venues & Rentals → Space Rental ⁶⁴	burger ¹⁴³¹ rental ⁷²⁵⁷ menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
angelospizzaservice-rotterdam.nl	Angelo's Pizza	The website describes various sauces, including Andalouse and garlic sauce.	Fast Food → Burgers ⁶⁸⁷	top ³⁷⁷ dessert ⁴⁹⁶ burger ¹⁴³¹ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
arasafhaalservice-enschede.nl	Aras delivery and takeaway service	A wide variety of sauces is available for the plates.	Fast Food → Döner ²³⁸ Catering & Ready Meals → Takeaway ⁴⁰⁹	kebab ²⁷⁶ döner ⁶⁷³ plate ⁷⁸⁷ bread ¹⁶²² salad ²⁴⁴⁴	Overijssel → Enschede ⁵⁵⁵⁴
babylonpizza.nl	BABYLON Pizzeria shoarma	Customers can choose from various sauces.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	shoarma ²⁵⁴ plate ⁷⁸⁷ salad ²⁴⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
bakkerijnieuwendijk.nl	Bakkerij Nieuwendijk	A wide variety of sauces are available with the orders.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Web → Websites ²⁰²⁸	döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Altena → Nieuwendijk ¹²³
baroniedonerplacealphenaandenrijn.nl	Baronie Doner Place	A diverse assortment of sauces is available to accompany the dishes.	Fast Food → Burger Restaurants ³⁴⁶	wrap ⁸²⁶ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
bestelhas.nl	HAS Doner Kebab Rotterdam	Various sauces are offered to enhance the dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	family menu ¹² doner ¹³¹ kapsalon ⁵⁰⁹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
bestoftheribs-bilthoven.nl	Best of the Ribs Bilthoven	A wide range of sauces are available with the dishes.	Fast Food → Fries ⁹⁴⁹ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	rib ¹⁹¹ hamburger ³⁶⁴ grill ⁵⁶² fries ²⁷⁵³ menu ¹³⁸⁵⁶	De Bilt → Bilthoven ⁹²⁰
bikfrietwerk-denhaag.nl	BIK frietwerk	The website offers a wide selection of different sauces.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	kibbeling ¹¹⁵ fries ²⁷⁵³ beer ²⁸⁸⁷ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
bobbysburgersfood.nl	BobbysBurgers	Burgers are served with various sauces, such as Bobby's sauce.	Fast Food → Burgers ⁶⁸⁷ Grilling & Steaks → American ⁸⁵	side dish ¹¹⁸ wrap ⁸²⁶ burger ¹⁴³¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
bodrum-doetinchem.nl	Bodrum Doetinchem	The website offers the option to choose from various sauces with the ordered dishes.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Doetinchem ²⁷⁰⁶
bramfreshfood-wittem.nl	BRAM FRESHFOOD	The dishes are served with various sauces, such as truffle mayonnaise and garlic cream sauce.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	nachos ³⁵ main course ¹⁰² tapas ⁴⁶⁵ dessert ⁴⁹⁶ pasta ¹³⁸⁹	Gulpen-Wittem → Partij ⁵⁵
bredeklauw-rotterdam.nl	Brede Klauw	A wide range of sauces complete the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	panini ¹⁵⁶ wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
broodjesgrillhuisgalstjan-zwolle.nl	Broodjes & Grillhuis Galstjan Zwolle	The website offers a variety of sauces to enhance the meals to your liking.	International → Turkish ⁴¹⁶ Food Delivery → Delivery ²²²⁷	döner ⁶⁷³ pasta ¹³⁸⁹ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Overijssel → Zwolle ⁷³⁹⁵
broodjevanloontje-tilburg.nl	Broodje van Loontje	Different sauces are offered as an addition to the burgers and sandwiches.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
burger-brothers-tilburg.nl	Burger Brothers Tilburg	The website describes the unique homemade sauces used with the burgers.	Fast Food → Burgers ⁶⁸⁷	beef ³¹⁹ burger ¹⁴³¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
burger-nshake-amsterdam.nl	Burger 'n Shake Amsterdam Osdorp	The website describes the different flavors and ingredients of the various sauces.	Fast Food → Burgers ⁶⁸⁷	shake ¹¹² burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Amsterdam → Nieuw-West ⁸⁴⁴
burgerchef-hilversum.nl	Burger Chef Hilversum	The website offers a selection of sauces to enhance the dishes.	Fast Food → Burgers ⁶⁸⁷	chicken burger ¹⁸ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
burgerking-tilburg.nl	Burger King	The website describes different sauces, including a delicious sauce for the Whiskey Master menus.	Fast Food → Burger Restaurants ³⁴⁶	combo ⁵⁹ burger ¹⁴³¹ fries ²⁷⁵³	North-Brabant → Tilburg ⁸⁷⁵⁹
burgerkingfoodstrip-amsterdam.nl	Burger KING® Foodstrip	Various sauces are offered, including a special Whiskey Master sauce.	Fast Food → Burger Restaurants ³⁴⁶	combo ⁵⁹ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
burgersveggies-rotterdam.nl	Burgers & Veggies Rotterdam	The website describes a wide range of sauces that can be added to the ordered dishes.	Fast Food → Burgers ⁶⁸⁷ Sandwiches & Salads → Snacks ⁶⁹³	falafel ¹⁰⁸ hamburger ³⁶⁴ chicken ⁹⁴⁴ fries ²⁷⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-de-bulldog-waddinxveen.nl	Cafetaria De Bulldog Waddinxveen	Various sauces are available to enhance the dishes to your liking.	Online Services → Ordering ¹²¹ Quick Bites → Cafeteria ⁹⁰⁶	croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Waddinxveen ¹⁰⁴⁶
cafetaria-elite.nl	Cafetaria Elite Gennep	A variety of sauces are available to enhance the cafeteria's dishes.	Delivery → Home Delivery ¹⁹ Cafeteria → Dutch Cafeteria ¹²²	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Limburg → Gennep ⁵⁷⁴
cafetaria-rennemig.nl	Cafetaria Rennemig	There is a wide selection of sauces, both classic and special, to top the dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Limburg → Heerlen ²⁷⁵⁵
cafetaria-stratum-eindhoven-eindhoven.nl	Cafetaria Stratum Eindhoven	Various sauces are offered with the fries and sandwiches.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cafetariafamilycapelleaandenijssel.nl	Snackbar De Terp	A wide assortment of sauces is available to use with fries and snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
cafetariapassantje-wageningen.nl	Cafetaria Passantje Wageningen	The website describes various sauces served with the dishes.	Fast Food → Burger Restaurants ³⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Wageningen ¹⁹⁴⁹
cafetariatbraadspit-veghel.nl	Cafetaria 't Braadspit	A large selection of sauces are available to accompany the dishes.	Cafeteria → Dutch Cafeteria ¹²²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Meierijstad → Veghel ¹²⁸⁸
cafetariatrefpunt.nl	Eethuis Cafetaria Trefpunt Venhorst	The website features a ‘Sparshop’ where customers can purchase sauces and earn points.	Sandwiches & Salads → Snacks ⁶⁹³ Quick Bites → Cafeteria ⁹⁰⁶	calzone ⁹⁰ drink ⁵¹⁹¹	Boekel → Venhorst ⁷⁷
cafetariavulcano-hank.nl	Cafetaria Vulcano	Various sauces are offered to accompany the ordered meals.	Quick Bites → Snack Bar ⁵⁸⁰	plate ⁷⁸⁷ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Altena → Hank ¹¹³
cafetariayeemei-debilt.nl	Cafetaria Yeemei	A wide range of sauces is available, matching the fries and dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → De Bilt ¹⁶⁷⁶
cairo-vlaardingen.nl	Cairo Vlaardingen	The dishes are served with a variety of sauces.	Italian Restaurant → Pizza Restaurant ³⁵¹ Grilling & Steaks → Meat Restaurants ⁵⁷	steak ³³⁵ meat ²⁰⁵⁵ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
cairogrillroom.nl	Grillroom Cairo 3 Vlaardingen	The website offers a variety of sauces to combine with the different dishes.	Catering & Ready Meals → Takeaway ⁴⁰⁹	kapsalon ⁵⁰⁹ grill ⁵⁶² pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
cedarsfusion-denhelder.nl	Cedars Fusion	The website features a selection of sauces, such as mayonnaise, ketchup and tahini.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	dessert ⁴⁹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Den Helder ¹⁸⁸⁶
chao-utrecht.nl	Chao!	The website offers a variety of sauces with the orders.	Cafes → Dutch Restaurants ¹⁰³¹	croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
chef-piri-piri-groningen.nl	Chef Piri Piri	Various sauces are available to accompany the dishes, complementing the piri-piri flavor.	Cooking & Recipes → Dishes ³³⁵	marinade ³⁸ chicken ⁹⁴⁴ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
chicosburgerkebab-amersfoort.nl	Chico's Burger & Kebab	The website describes various homemade sauces, such as the garlic sauce.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	kebab ²⁷⁶ wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
chicosdriveduiven.nl	CHICO'S DRIVE	A wide selection of sauces is available to enhance the pizzas and döner dishes.	Fast Food → Döner ²³⁸ Meat → Chicken ¹²⁷	halal ¹⁶⁵ döner ⁶⁷³ chicken ⁹⁴⁴ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Duiven ⁸⁵¹
chidoz-haarlem.nl	Chidóz Haarlem	Various sauces are offered, including a spicy 'Killer Smokey Chipotle sauce'.	Mexican & South American → Mexican ¹⁵¹	burrito ⁶² drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
chidoz-nijmegen.nl	Chidóz Nijmegen	Various spicy sauces are offered, such as Killer Smokey Chipotle sauce and Salsa Verde.	Fast Food → Burger Restaurants ³⁴⁶ Mexican & South American → Mexican ¹⁵¹	burrito ⁶² combo meal ⁶⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
crispy-chicken-verona-bello-en-kapsalon-saddan.nl	Verona bello en kapsalon Saddan	Various sauces are offered to accompany the dishes.	Turkish Cuisine → Fast Food ³²²² Activities → Dining Out ¹⁸¹	main course ¹⁰² döner ⁶⁷³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Tytsjerksteradiel → Burgum ³⁷¹
cyprusgriekseethuis-overloon.nl	Cyprus Grieks Eethuis	The website offers a selection of sauces for dipping.	International → Greek ⁴⁶⁵	tzatziki ³⁷ mix ³⁷⁷ grill ⁵⁶² plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸	Land van Cuijk → Overloon ¹⁹⁴
dailydiner.nl	Daily Diner Doetinchem	The website sells a variety of sauces that can be added to various dishes.	Fast Food → Burgers ⁶⁸⁷	soft drinks ⁸⁷ hamburger ³⁶⁴ pizza ⁴¹⁵⁸	Gelderland → Doetinchem ²⁷⁰⁶
dappfrietwinkelbiologischefrieten-utrecht.nl	Dapp Frietwinkel Biologische Frieten	The website offers a range of sauces to serve with the fries.	Fast Food → Fries ⁹⁴⁹ Vegan & Vegetarian → Vegan ³⁹⁰	croquette ¹³⁶ organic ⁴⁷¹ vegan ⁵⁰⁸ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
de-gulle-buurman-vroomshoop.nl	De Gulle Buurman	Various sauces are offered to accompany the dishes.	Grilling & Steaks → Meat Dishes ⁴⁰ Cooking & Recipes → Meat Dishes ¹⁰	sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Twenterand → Stationslaan ²⁶⁶
de-lekkere-hap.nl	De Lekkere Hap Emmeloord	The website mentions a wide range of sauces as extras with the orders.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	spareribs ²¹³ kapsalon ⁵⁰⁹ döner ⁶⁷³ burger ¹⁴³¹ menu ¹³⁸⁵⁶	Noordoostpolder → Emmeloord ¹⁶⁴⁹
defriettentrooi-sint-oedenrode.nl	De Friettent Rooi	A wide range of sauces are available to accompany the fries and other dishes.	Fast Food → Fries ⁹⁴⁹	family pack ²⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Meierijstad → Sint-Oedenrode ⁶³²
dehamburgerij.nl	De Hamburgerij	The website describes various sauces and dressings, such as mustard, ketchup and garlic sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	hotdog ³⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶
dilekchicken-amsterdam.nl	Dilek Chicken Osdorp	There is an extensive selection of various sauces, ranging from spicy to sweet flavors.	Fast Food → Chicken Dishes ⁹² Grilling & Steaks → Meat Dishes ⁴⁰	beverage ⁵⁸⁶ chicken ⁹⁴⁴ sandwich ⁴⁰⁹⁸	Amsterdam → Nieuw-West ⁸⁴⁴
doner-kebab-express-on-tour-rotterdam.nl	Döner Kebab Express on Tour	The dishes are served with various sauces, including garlic sauce, sambal and various other variations.	Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ plate ⁷⁸⁷ box ¹⁹⁸² meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
doner-wereld-bergeijk.nl	Döner Wereld Bergeijk	All dishes are served with various sauces, such as salad sauce and cheese.	Fast Food → Döner ²³⁸	dürüm ⁹⁷ kapsalon ⁵⁰⁹ döner ⁶⁷³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Bergeijk ⁷⁷⁵
donerkinguden-uden.nl	DöNER KING UDEN	Customers can choose from a variety of sauces with their order.	Fast Food → Döner ²³⁸ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Maashorst → Uden ¹⁵⁴⁰
dulcepicante-ijmuiden.nl	Meat This IJmuiden	Customers can choose from a wide range of sauces to complement their meal.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Indonesian ⁵⁰²	loaded fries ⁴¹ rib ¹⁹¹ satay ³²⁰ burger ¹⁴³¹ menu ¹³⁸⁵⁶	Velsen → IJmuiden ¹¹⁰⁹
eat-to-go-roermond.nl	Eat to Go	Seven different wok sauces are available for customizing a wok dish.	Catering & Ready Meals → Chinese Restaurants ³⁰³	wok ²³¹ protein ²⁹⁹ rice ⁶³⁵	Limburg → Roermond ²⁶⁰²
eatz-by-jake-zwolle.nl	Eatz by Jake	The website describes various sauces that can be added to the burgers, such as mayonnaise, sriracha, and truffle mayonnaise.	Fast Food → Burgers ⁶⁸⁷	vegetarian ³³⁷ chicken ⁹⁴⁴ burger ¹⁴³¹ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
eetaliano.nl	Eetaliano	The website offers a selection of traditional Italian sauces, such as Amatriciana and Carbonara sauces.	Sandwiches & Salads → Italian Cuisine ⁹⁹ Meal Solutions → Meal Boxes ⁶³	meal box ⁵⁴ olive oil ³⁴⁶ pasta ¹³⁸⁹ box ¹⁹⁸² ingredients ²³⁴⁶
eeterijenfeesterijdedroom-langeweg.nl	Eeterij en Feesterij de Droom	The website describes various sauces that can be combined with the dishes.	Fast Food → Fries ⁹⁴⁹ Cuisine → Dutch Cuisine ¹⁷⁹	fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Moerdijk → Langeweg ³⁹
eethuiscyprus-valkenswaard.nl	Eethuis Cyprus	The customer can choose from a variety of sauces to customize the dish.	International → Greek ⁴⁶⁵ Turkish Cuisine → Fast Food ³²²²	plate ⁷⁸⁷ meat ²⁰⁵⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
eethuisnoewthoear-thorn.nl	Eethuis Noew Thoear	A wide range of sauces are available to accompany the fries and snacks.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Quick Bites → Cafeteria ⁹⁰⁶	frikandel ¹⁸ croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Maasgouw → Thorn ¹²⁰
elcafetal.nl	El Cafetal Colombiaans Eetcafe	El Cafetal prepares various, homemade sauces that give the dishes a unique flavor.	Fast Food → Burgers ⁶⁸⁷	coffee ³⁸³⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
ensar-doner-kebab.nl	Ensar Döner & Kebab	The website describes various sauces, including garlic sauce and sambal.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	dürüm ⁹⁷ kapsalon ⁵⁰⁹ döner ⁶⁷³ salad ²⁴⁴⁴ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
febo-van-woustraat-amsterdam.nl	FEBO van Woustraat	The website contains an overview of various sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → FEBO ²⁴	shake ¹¹² croquette ¹³⁶ burger ¹⁴³¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
frangospiripiri.nl	Frango's Piri Piri	The Piri Piri sauce is an essential part of the recipe and the secret to the unique flavor.	Turkish Cuisine → International ¹²⁰⁷	platters ⁵⁴ grill ⁵⁶² chicken ⁹⁴⁴ burger ¹⁴³¹ reviews ³¹⁷²
friethuystien-amsterdam.nl	Friethuys Tien Amsterdam	Various homemade sauces are offered with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
frietwagen-venlo.nl	Frietwagen de Smulboetiek	The fry truck offers a variety of sauces, such as mayo, curry, and ketchup.	Fast Food → Fries ⁹⁴⁹ Catering → Mobile Catering ⁸⁷	fry truck ³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Limburg → Venlo ⁴¹⁵⁸
fusionwok-enschede.nl	FusionWok	The website offers a selection of sauces, including chili sauce and sambal.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷ Catering & Ready Meals → Chinese Restaurants ³⁰³	hotpot ²⁵ rice ⁶³⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
grillgenius.nl	GrillGenius	Part of the collection consists of a range of sauces and spices.	Garden → Grills ⁶⁵ Outdoor → Grilling ¹¹²	fuel ⁴²⁴ return ⁹⁰⁹ barbecue ¹¹⁷⁵ tool ³⁹⁰⁷ ship ⁵¹⁰³
grillhelden-heerhugowaard.nl	Grillhelden Heerhugowaard	Various sauces are offered to enhance the dishes.	Fast Food → Burgers ⁶⁸⁷	spareribs ²¹³ wrap ⁸²⁶ burger ¹⁴³¹ menu ¹³⁸⁵⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
grillking-etten-leur.nl	Grill King	Orders are served with a selection of 3 sauces.	Fast Food → Fries ⁹⁴⁹	chicken satay ²⁶ pita ¹⁹⁹ plate ⁷⁸⁷ wrap ⁸²⁶ pizza ⁴¹⁵⁸	North-Brabant → Etten-Leur ¹³⁶⁶
gulli-denbosch.nl	Gulli	Various types of ‘sauce’ are offered as an option during ordering.	Mexican & South American → Mexican ¹⁵¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ bread ¹⁶²² box ¹⁹⁸² fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
happiedoner-hoofddorp.nl	Happie Doner	Orders include two sauces of your choice.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Coffee & Tea → Beverages ⁴⁴⁵³	grilled dishes ⁴⁹ shoarma ²⁵⁴ kapsalon ⁵⁰⁹ döner ⁶⁷³ menu ¹³⁸⁵⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
harryvangoorvishandel-maarssen.nl	Harry van Goor Vishandel	A suitable sauce is available for each dish.	Restaurants & Dining → Seafood Restaurants ⁶¹²	kibbeling ¹¹⁵ shrimp ²¹⁹ fish ¹¹²¹ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Stichtse Vecht → Maarssen ¹⁰⁵¹
heel-bijzonder-enschede.nl	Heel Bijzonder	The website uses specific sauces, such as 'Heel Bijzonder' sauce, to enhance the dishes.	Lunch → Sandwiches ⁴⁶⁶ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	toastie ⁴⁵ pastries ⁹⁴⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
hetepepperz.nl	Hetepepperz	The shop offers a wide assortment of hot pepper sauces.	Online Retail → Food Retail ³⁴⁰ Coffee & Tea → Beverages ⁴⁴⁵³	pepper ⁵⁵ seed ⁵⁹⁹ recipe ⁵¹⁴² shop ⁶⁴⁸³
hetsluisjeveldkamp.nl	Webshop 't Sluisje\Veldkamp	The website sells various sauces with the ordered dishes.	Fast Food → Fries ⁹⁴⁹ Food → Meat ¹¹²³	spareribs ²¹³ menus ²²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
hetsushipaleis-beuningen.nl	Het Sushi Paleis	In addition to sushi, a selection of sauces are offered to complete the meal.	Japanese → Sushi ⁹⁷¹ Web → Websites ²⁰²⁸	roll ³⁵⁸ sushi ¹⁶⁹⁵ box ¹⁹⁸² drink ⁵¹⁹¹	Gelderland → Beuningen ⁸⁸³
hokisnacks-amsterdam.nl	Hoki Snacks	A variety of sauces, such as satay sauce and jopinessauce, are available to add to the orders.	Fast Food → Burger Restaurants ³⁴⁶ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Amsterdam ⁴¹²⁵³
hollywoodchickenpizza-assen.nl	Hollywood Chicken & Pizza	Various sauces, including cream sauce and dips, are served with the dishes.	Food Delivery → Delivery ²²²⁷ Mediterranean & Middle Eastern → Takeout ²⁸⁶	plate ⁷⁸⁷ chicken ⁹⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Drenthe → Assen ³⁵¹⁶
imkekookt.nl	Imke	The website also includes recipes for various sauces.	Blogs → Food Blogs ²⁴⁶ Cuisine → Vegetarian ⁶⁹⁷	main course ¹⁰² dessert ⁴⁹⁶ recipe ⁵¹⁴² newsletter ⁶⁵⁰⁴
jacks-rippies-rhoon.nl	Jack's Rippies Rhoon	The website lists a wide range of sauces, both cold and hot, and special sauces with the dishes.	Fast Food → Burgers ⁶⁸⁷ Cafes → Dutch Restaurants ¹⁰³¹	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Albrandswaard → Rhoon ⁴⁴⁸
jmsnacks.nl	JM Snacks	The renowned hot sauce, developed in-house, is also sold in the shop.	Fast Food → Fries ⁹⁴⁹ Beach Life → Beach ⁵³²	tart ²⁰ fish ¹¹²¹ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸	The Hague → Scheveningen ¹⁶²⁵
kiliscitygrilleethuis-sassenheim.nl	Kilis City Grill & Eethuis Sassenheim	The dishes are served with various sauces, such as garlic sauce and sambal.	Fast Food → Burger Restaurants ³⁴⁶	doner ¹³¹ kapsalon ⁵⁰⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Teylingen → Sassenheim ⁵⁹⁹
kingkumpiramsterdam.nl	POTAÉ KING KUMPIR BOS EN LOMMERWEG	The website describes 12 different homemade sauces that customers can choose with their order.	Turkish Cuisine → Fast Food ³²²²	falafel ¹⁰⁸ wrap ⁸²⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
komagene-rotterdam-putsebocht.nl	Komagene Rotterdam	Various sauces are offered, including a special pomegranate sauce.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Vegan & Vegetarian → Vegan ³⁹⁰	portion ³³ vegan ⁵⁰⁸ wrap ⁸²⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
krooks-haarlem.nl	Krooks	Customers can choose a sauce to accompany their order, which is served with fries and dishes.	Fast Food → Fries ⁹⁴⁹ Asian → Korean ⁵¹	bitterballs ⁴¹ chicken ⁹⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
kwalitaria-soest.nl	Kwalitaria Délifrance Zuidpromenade	Various sauces, such as BBQ, pesto and mayonnaise, can be added to the order.	Turkish Cuisine → Fast Food ³²²²	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht → Soest ²⁰²⁷
kwalitariavianen.nl	Kwalitaria Délifrance Vianen	The website describes a wide range of sauces, including BBQ, pestomayo, and cheese sauce.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	shake ¹¹² burger ¹⁴³¹ meal ¹⁶³⁸ fries ²⁷⁵³	Vijfheerenlanden → Vianen ⁷⁰⁷
la-bamba-zwolle.nl	La Bamba Zwolle	Customers can choose from a variety of sauces, such as curry, ketchup and mustard.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
lennalemmer-lemmer.nl	Lenna Lemmer	The dishes are served with different sauces, such as pesto, carbonara, and Napolitan sauce.	Pastries & Baked Goods → Menus ²²³ Sandwiches & Salads → Italian Cuisine ⁹⁹	dessert ⁴⁹⁶ appetizer ⁵⁵⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	De Fryske Marren → Lemmer ¹¹⁸⁸
lepetitdeliamsterdam.nl	Le Petit Deli	The menus offer a variety of sauces and mayonnaise.	Brasseries & Bistros → Bistro ⁵⁹⁴ Quick Bites → Snack Bar ⁵⁸⁰	bread ¹⁶²² salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
lezzetnijverdal.nl	Lezzet Nijverdal	The website offers a variety of sauces that can be ordered.	Fast Food → Burgers ⁶⁸⁷	hamburger ³⁶⁴ barbershop ⁵¹² salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Hellendoorn → Nijverdal ⁷²⁸
lina-snacks-grill-haarlem.nl	Lina Snacks & Grill Haarlem	Customers can customize their dishes with various sauces.	Lunch → Sandwiches ⁴⁶⁶ Ready-To-Eat Meals → Wraps ¹⁰²	kapsalon ⁵⁰⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
littleitalyalmere.nl	Little Italy	The website offers options to add extra sauce when ordering pizzas.	Italian → Pasta ²¹³ Cafeteria → Dutch Cafeteria ¹²²	combination ¹⁸⁹ pasta ¹³⁸⁹ bread ¹⁶²² pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
localdealerfoodincamsterdam.nl	LOCAL DEALER FOOD INC.	There are several types of sauces, such as Salsa Roja and Salsa Amarilla, which make the dishes special.	Grilling & Steaks → Grills ⁹⁶ Mexican & South American → Mexican ¹⁵¹	guacamole ¹⁵ taco ⁹² drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
lokantaofgold-helmond.nl	Lokanta of Gold	Customers can choose from two sauces when ordering dishes and sandwiches.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	chicken fillet ³⁵ shoarma ²⁵⁴ döner ⁶⁷³ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	North-Brabant → Helmond ³⁰⁵⁸
lucsfooddelft.nl	Luc's Food	A wide selection of sauces is available.	Fast Food → Fries ⁹⁴⁹	spring roll ⁸² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Delft ⁵³⁰⁹
mam-streetfood-nijmegen.nl	Mam Streetfood	All dishes are topped with homemade sauce.	Asian → Vietnamese ¹²⁴ Catering & Ready Meals → Asian Cuisine ¹³⁷	noodle soup ²⁴ spices ³⁴⁰ bowl ⁴⁸² sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Gelderland → Nijmegen ⁹³⁸⁴
mamisnackbar-leiden.nl	BRAM'S	Customers can choose from an extensive selection of sauces with their order.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	shoarma ²⁵⁴ satay ³²⁰ burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸	South-Holland → Leiden ⁷⁰⁸⁹
maozfalafel-nijmegen.nl	Maoz Falafel	A wide selection of sauces, such as tahini and sambal, is available to enhance the flavor of the dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	falafel ¹⁰⁸ meal ¹⁶³⁸ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
mess-burger-factory.nl	Mes's Burger Factory Breestraat	Burgers are served with a variety of delicious sauces, such as classic, mess-BBQ and pesto-mayonnaise.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	bun ²⁷ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Beverwijk ¹⁶⁹⁰
mrkebab-veldhoven.nl	Mr. Kebab Eindhoven	A variety of sauces are available to choose from with the orders.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	kebab ²⁷⁶ döner ⁶⁷³ box ¹⁹⁸² fries ²⁷⁵³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
noussieslelystad.nl	Noussie's	The website offers various sauces as an option with the order.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Turkish Cuisine → Fast Food ³²²²	calzone ⁹⁰ shoarma ²⁵⁴ wrap ⁸²⁶ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸	Flevoland → Lelystad ³¹⁸⁰
otacos-spijkenisse.nl	O'Tacos Spijkenisse	The availability of different sauces provides variation in flavor.	Mexican & South American → Mexican ¹⁵¹	taco ⁹² box ¹⁹⁸² meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶	Nissewaard → Spijkenisse ¹⁴³³
paviljoenbijmanmetfriet-rotterdam.nl	Paviljoen bij Man met Friet	The website describes various sauces and mayonnaise, including a ‘spicy samurai mayonnaise’ and ‘truffle mayonnaise’.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	bacon ²² hamburger ³⁶⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
pizza-pasta-al-dente-haarlem.nl	Pizza Pasta Al Dente Haarlem	Tomato sauce is a common base for many dishes on the menu.	Food Delivery → Italian Restaurant ¹⁰⁴⁰	cheese ¹²⁰⁵ pasta ¹³⁸⁹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
pizzeria-kapadokya.nl	Kapadokya Mediterrane Restaurant	A selection of sauces is offered alongside various dishes.	Food Delivery → Delivery ²²²⁷ Mediterranean & Middle Eastern → Takeout ²⁸⁶	reviews ³¹⁷² food ³⁸⁷² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Land van Cuijk → Boxmeer ⁸⁶¹
plazale-patat-aarle-rixtel.nl	Le-Patat	The website describes numerous sauces that can be added to the fries, such as curry, oorlog and satay sauce.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	fry ⁵⁹ kapsalon ⁵⁰⁹ burger ¹⁴³¹ fries ²⁷⁵³ dish ⁵⁹³⁶	Laarbeek → Aarle-Rixtel ²³⁸
plazastadskanaal-stadskanaal.nl	Plaza Stadskanaal	The website offers a variety of sauces as an addition to the order.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	vegetarian ³³⁷ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Groningen → Stadskanaal ¹⁰⁵⁴
pokay-delft.nl	Pokay	The Poke Bowls are served with various unique sauces, such as Ponzu and Sriracha Mayonnaise.	Japanese → Poke ¹⁹	salmon ¹⁸⁵ poke bowl ³⁰⁸ vegetarian ³³⁷ ingredients ²³⁴⁶	South-Holland → Delft ⁵³⁰⁹
poke-specials-houten.nl	POKé SPECIALS - OOST	Customers can choose their own sauce when building their ‘Build Your Own Meal’.	Cafes → Dutch Restaurants ¹⁰³¹ Food Delivery → Asian ²⁷²³	truffle ³³ poké bowl ¹⁶⁹ salmon ¹⁸⁵ vegan ⁵⁰⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
pokeperfect-denbosch.nl	Poké Perfect Den Bosch	Various sauces, such as Sriracha mayo and Miso Tahini sauce, are essential to the Poké bowls and give them a unique flavor.	Japanese → Sushi ⁹⁷¹	bowl ⁴⁸² vegan ⁵⁰⁸ ingredients ²³⁴⁶ dish ⁵⁹³⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
porkandpotatoes-tilburg.nl	Bogey's Ribs	A wide range of sauces are available, such as BBQ, curry, and mustard.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Grilling & Steaks → American ⁸⁵	loaded fries ⁴¹ combo meal ⁶⁵ rib ¹⁹¹ ice cream ¹⁰⁰⁰ fries ²⁷⁵³	North-Brabant → Tilburg ⁸⁷⁵⁹
rebrowndenbosch.nl	Rebrown	Diverse sauces, such as coleslaw and sambal, are used as a complementary sauce.	Dutch Restaurants → Brabant ³²	tempeh ¹¹ roti ³⁰³ plate ⁷⁸⁷ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
restaurantjapas-ermelo.nl	Restaurant Japas Ermelo	The website offers the option to order extra sauces, such as soy sauce, wasabi and ginger.	Asian → Japanese ¹⁴⁸⁸	poké bowl ¹⁶⁹ sushi ¹⁶⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Ermelo ¹²⁰⁷
restaurantwally-nijmegen.nl	Restaurant Wally	Burgers are served with different homemade and specialty sauces.	Fast Food → Burger Restaurants ³⁴⁶ Cooking & Recipes → Cuisine ¹¹⁴⁷	soft drink ³⁹ organic ⁴⁷¹ burger ¹⁴³¹ beer ²⁸⁸⁷	Gelderland → Nijmegen ⁹³⁸⁴
ricardossnackcorner-deventer.nl	Ricardo's Snackcorner Deventer	Satay sauce is a frequently used sauce with fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Deventer ⁴⁷⁵¹
roysrotishop-zwolle.nl	Roy's Roti Shop	The website offers a range of sauces, including madam jeannet pepper, to flavor the dishes to taste.	Food Delivery → Surinamese ²⁶⁵	bara ²² nasi ²⁴² roti ³⁰³ drink ⁵¹⁹¹	Overijssel → Zwolle ⁷³⁹⁵
sabrosorotterdam.nl	Sabroso Rotterdam	The restaurant offers a wide range of homemade sauces, such as pindasaus and rosada, which are served with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
sakara-denhaag.nl	Sakara	The website offers a wide range of sauces with the dishes.	Fast Food → Burgers ⁶⁸⁷ Turkish Cuisine → International ¹²⁰⁷	steak ³³⁵ shawarma ³³⁵ plate ⁷⁸⁷ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
sangleerotishopbroodjeszaak-eindhoven.nl	Sang Lee Rotishop & Broodjeszaak	Various sauces are offered with the dishes, such as sambal and curry.	Food Delivery → Surinamese ²⁶⁵	rotis ¹² cabbage ²³ bread ¹⁶²² sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
seasons-maasbracht.nl	Seasons Maasbracht	Guests can choose from a variety of sauces to flavor their dishes.	Food Delivery → Asian ²⁷²³	teppanyaki ⁵⁸ wok ²³¹ sushi ¹⁶⁹⁵ buffet ¹⁷⁴⁷ ingredients ²³⁴⁶	Maasgouw → Maasbracht ²⁴⁸
smakelijk-gemert.nl	Smakelijk Gemert	Various types of sauces are offered with the pasta and pizza dishes.	Italian → Pasta ²¹³	pasta ¹³⁸⁹ ingredients ²³⁴⁶ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Gemert-Bakel → Gemert ⁶⁰¹
smakojczyzny-tilburg.nl	Schnitzel House Tilburg	The website offers a wide selection of sauces with the dishes.	Regional Cuisine → German ¹⁷ Meat → Chicken ¹²⁷	schnitzel ⁶¹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	North-Brabant → Tilburg ⁸⁷⁵⁹
snackbar-amersfoort.nl	Snackbar Amersfoort	There is an extensive selection of sauces to dip with.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Utrecht → Amersfoort ⁸⁰¹¹
snackbarnicos-denbosch.nl	Nico’s Orthen	The website describes the specific sauces used with the burgers and other dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
snackbarpaulus-arnhem.nl	Snackbar Paulus	In addition to the dishes, various sauces are also offered.	Fast Food → Fries ⁹⁴⁹ Lunch → Sandwiches ⁴⁶⁶	croquette ¹³⁶ shawarma ³³⁵ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gelderland → Arnhem ⁸⁶⁸⁰
snacksonskrimpen-krimpenaandelek.nl	Snacksons Krimpen	Various sauces are offered, such as Joppiesauce, chili mayonnaise, truffle mayonnaise, and french fries sauce.	Fast Food → Burgers ⁶⁸⁷	loaded fries ⁴¹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
snekkievent.nl	SnekkieVent	Guests can choose from a variety of sauces when eating the fries.	Quick Bites → Cafeteria ⁹⁰⁶ Food → Foodservice & Catering ⁵⁷⁷	fry truck ³⁸ guest ¹³³⁴ fries ²⁷⁵³ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹
so-pasta-best.nl	Só Pasta Best	The website offers a wide selection of sauces for the pasta dishes, such as pesto, tomato, bolognese, and carbonara.	Japanese → Sushi ⁹⁷¹	dessert ⁴⁹⁶ pasta ¹³⁸⁹ ingredients ²³⁴⁶ pizza ⁴¹⁵⁸	North-Brabant → Best ⁹⁷⁸
soerabajazeist.nl	Soerabaja	Dishes are served with diverse, often spicy, sauces.	Food Delivery → Indonesian ⁵⁰²	rice ⁶³⁵ chicken ⁹⁴⁴ meal ¹⁶³⁸ menu ¹³⁸⁵⁶	Den Helder → City within the Lines-East ¹²
soest-laroute.nl	Cafetaria La Route	The website describes an extensive range of sauces.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	family pack ²⁴ burger ¹⁴³¹ fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Soest ²⁰²⁷
soulfoodmama-groningen.nl	Soulfood Mama	Dishes are served with various sauces, such as peanut sauce and ketjap marinade.	Indonesian → Roti ¹¹ Food Delivery → Indian Cuisine ⁵⁴³	roti ³⁰³ bowl ⁴⁸² rice ⁶³⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
spareribs-koning-oosterhout.nl	Spareribs Koning Oosterhout	Customers can select their sauce of choice with their order.	Fast Food → Burger Restaurants ³⁴⁶ Context ¹⁶¹³⁹⁴	spareribs ²¹³ kapsalon ⁵⁰⁹ rice ⁶³⁵ pasta ¹³⁸⁹ salad ²⁴⁴⁴	North-Brabant → Oosterhout ²⁰⁸⁶
starfoodcafetaria.nl	Star Food Leiden	The website offers the possibility to order sauce with the dishes.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	halal ¹⁶⁵ kapsalon ⁵⁰⁹ salad ²⁴⁴⁴ fries ²⁷⁵³	South-Holland → Leiden ⁷⁰⁸⁹
steakhouse-sphinx.nl	Sphinx Nieuwegein	A wide assortment of sauces can be chosen with the order.	Sandwiches & Salads → Snacks ⁶⁹³ Cooking & Recipes → Dishes ³³⁵	salon ⁵⁵⁴¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
subwayrotterdamwestblaak-rotterdam.nl	SUBWAY ROTTERDAM WESTBLAAK	Users can choose their favorite sauce to personalize their Sub or Salad.	Lunch → Sandwiches ⁴⁶⁶	chicken ⁹⁴⁴ vegetables ¹⁴¹⁶ bread ¹⁶²² salad ²⁴⁴⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
sultan-ijmuiden.nl	Eetcafé Shoarma Sultan	Various sauces are available to choose from when ordering.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	kebab ²⁷⁶ shawarma ³³⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Velsen → IJmuiden ¹¹⁰⁹
sultanpizzeria-krimpenaandelek.nl	Sultan Pizzeria	The menu offers a wide range of sauces, both for pizzas and for pasta.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	calzone ⁹⁰ shoarma ²⁵⁴ chicken ⁹⁴⁴ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
taste-the-joy-zwolle.nl	Taste the Joy	Various sauces are available to pour over fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
telaviv-zandvoort.nl	Tel Aviv & Rosie's Burgers, Pizza, Doner, Grill	The website emphasizes the homemade Rosie's sauce that is served with many dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Fast Food → Burger Restaurants ³⁴⁶	doner ¹³¹ grill ⁵⁶² wrap ⁸²⁶ burger ¹⁴³¹ pizza ⁴¹⁵⁸	North-Holland → Zandvoort ¹²⁹⁸
tenthijbakeryenschede.nl	ten Thij Bakery@Shell ten Thij Glanerbrug	Various sauces are available, such as Twente delight and sweet chilli sauce.	Turkish Cuisine → Takeout Restaurant ⁸¹	kebab ²⁷⁶ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Enschede ⁵⁵⁵⁴
the-happy-bull-amsterdam.nl	The Happy Bull	The restaurant offers various sauces, including the unique ‘Bull sauce’ which is commonly found on hamburgers.	Restaurants By Location → Restaurants in Amsterdam ²² Mexican & South American → Mexican ¹⁵¹	nachos ³⁵ hamburger ³⁶⁴ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
the-harvest-rotterdam.nl	The Harvest	The website describes various sauces, including a homemade satay sauce.	Cuisine → Vegetarian ⁶⁹⁷	quinoa ¹¹ tempeh ¹¹ bowl ⁴⁸² salad ²⁴⁴⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
theburgery.nl	The Burgery	Burgers can be configured with a choice of different homemade sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
thefoodengineer-hoogvlietrotterdam.nl	The Food Engineer	Authentic TFE sauces are used in the preparation of the dishes.	Fast Food → Burgers ⁶⁸⁷	bbq ⁹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
thepokefamilyrotterdam.nl	The Poké Family Rotterdam	Various sauces, such as ‘Honolulu Dressing’ and ‘Teriyaki Kapolei Dressing’, give the Poké bowls their unique flavor.	Asian → Japanese ¹⁴⁸⁸	poké bowl ¹⁶⁹ bowl ⁴⁸² rice ⁶³⁵ vegetables ¹⁴¹⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
time-4-burger-nieuwegein.nl	Time 4 Burger Nieuwegein	Various sauces are offered to enhance the burgers and other dishes.	Fast Food → Burgers ⁶⁸⁷	hamburger ³⁶⁴ burger ¹⁴³¹ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
trucditran-alphenaandenrijn.nl	Truc di Tran	The website offers a selection of different sauces, including sambal and sweet chili sauce.	Asian → Vietnamese ¹²⁴	spring roll ⁸² pastry ²⁰⁶ shrimp ²¹⁹ beef ³¹⁹ chicken ⁹⁴⁴	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
twentsebitterbal.nl	Twentse Bitterbal	The Tukkersaus is a created sauce with Eastern spices and Twente flavors, intended as a dip and accompaniment.	Snacks → Bitterballs ²² Sauces & Condiments → Sauces ⁴⁹	croquette ¹³⁶ vegan ⁵⁰⁸
viet-yam-rotterdam.nl	Viet Yam Rotterdam	The website offers a variety of sauces, including hoisin and fish sauce, to enhance the dishes.	Asian → Vietnamese ¹²⁴	noodle soup ²⁴ bun ²⁷ pho ²⁷ chicken ⁹⁴⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
vishandelkrols-hertogenbosch.nl	Vishandel Krol	The dishes are served with various sauces, such as ravigote sauce.	Restaurants & Dining → Seafood Restaurants ⁶¹²	kibbeling ¹¹⁵ fish ¹¹²¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
visspeciaalzaakfishcorner-rotterdam.nl	Fish Corner	Various sauces are offered to accompany the dishes.	Lunch → Sandwiches ⁴⁶⁶ Restaurants & Dining → Seafood Restaurants ⁶¹²	platters ⁵⁴ soft drinks ⁸⁷ kibbeling ¹¹⁵ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
vlaamsfriteshuisloket13-overasselt.nl	Vlaams Friteshuis Loket 13 Overasselt	A variety of sauces are available to enhance the fries and snacks to taste.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	loaded fries ⁴¹ chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Heumen → Overasselt ¹⁵¹
vladimiro.nl	Vladimiro	The website offers a recipe for homemade peanut sauce.	Cuisine → International Cuisines ¹⁰¹ Cuisine → Vegetarian ⁶⁹⁷	cheesecake ³⁴ curry ³⁵⁵ salad ²⁴⁴⁴ recipe ⁵¹⁴² dish ⁵⁹³⁶
vol-smaak-kerkrade.nl	Vol Smaak	The website offers a diverse assortment of sauces to customize the dishes to your liking.	Online Ordering → Delivery Restaurants ⁷² Sandwiches & Salads → Italian Cuisine ⁹⁹	pasta ¹³⁸⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Limburg → Kerkrade ¹⁰³¹
wawburger-eindhoven.nl	WawBurger Eindhoven	A wide range of sauces are available to accompany the burgers and fries.	Fast Food → Burgers ⁶⁸⁷ Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
wawburgertilburg.nl	WawBurger Tilburg	Various sauces are offered to be poured over the burgers.	Fast Food → Burgers ⁶⁸⁷	shake ¹¹² burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
webtalisvip.nl	Webtalis	A variety of sauces and flavor enhancers are available to enrich dishes.	Garden → Grills ⁶⁵ Outdoor → Barbecues ⁷⁴⁴	spices ³⁴⁰ barbecue ¹¹⁷⁵ book ¹¹³⁹⁶ accessories ¹²⁹⁷⁵ workshop ¹⁹³²⁵
wegrestauranttwijzel.nl	Wegrestaurant Twijzel	Various sauces are available with the order, including oorlog, curry and chili sauce.	Fast Food → Fries ⁹⁴⁹ Fast Food → Chicken Dishes ⁹²	points ⁶¹² promotion ²⁰⁶² fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶
wokcity-ijsselstein.nl	Wok City	Customers can choose from a variety of sauces to customize their wok dish to their taste.	Asian → Chinese ⁴¹⁵	wok ²³¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → IJsselstein ¹¹⁰⁷
yamyamhengelo.nl	Yam Yam Hengelo	Dishes can be seasoned with various sauces to choose from.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	lahmacun ⁹³ kapsalon ⁵⁰⁹ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
yasai-wok.nl	Yasai Wok	There is a wide variety of sauces to customize the dishes to taste.	Asian → Chinese ⁴¹⁵	noodles ¹⁹¹ wok ²³¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
yasami-wok-zaandam.nl	Yasami Wok Zaandam	The website offers a variety of sauces and spices to customize dishes.	Asian → Chinese ⁴¹⁵ Quick Bites → Cafeteria ⁹⁰⁶	wok ²³¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
zonbootleek.nl	Zon Boot Leek	The shop differentiates itself by using its own recipes for the various sauces served with the shoarma.	Sandwiches & Salads → Snacks ⁶⁹³	cozy ²²⁷ shoarma ²⁵⁴ meat ²⁰⁵⁵	Westerkwartier → Leek ⁶⁴²
berryspizzapastaamsterdam.nl	Berry's Pizza & Grill	The salads are served with various sauces, such as garlic sauce and sambal.	Activities → Dining Out ¹⁸¹	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
usgrocery.nl	Belfor Imports	Various sauces from the Badia brand are for sale on the website, including taco seasoning and arrowroot.	Wholesale → Food Products ³⁰³	food products ⁵⁶ chip ¹³⁸ beans ¹⁸⁵ shopping cart ¹⁵²¹
cigkftem-rotterdam-markthal.nl	Çigköftem Rotterdam Markthal	Various sauces, such as hummus and pomegranate sauce, complement the dishes.	Turkish Cuisine → Fast Food ³²²² Catering & Ready Meals → Takeaway ⁴⁰⁹	falafel ¹⁰⁸ drink ⁵¹⁹¹ package ⁶¹¹²	Rotterdam → Center ³⁸²
burblogt.nl	Burblogt	The traditional cold sauce a la Stan is presented as a family recipe passed down through generations.	Directories → Websites ³⁴⁷³ Europe → Romania ¹⁷	diy ⁴⁴³ cookie ⁶⁰² vegetables ¹⁴¹⁶ recipe ⁵¹⁴² travel ⁷²¹⁰
wok-box.nl	Wok-box B.V.	A variety of sauces are available to flavor the dishes.	Catering & Ready Meals → Asian Restaurant ¹⁶³ Cooking & Recipes → Dishes ³³⁵	wok box ¹⁵ chinese food ¹⁶ ingredients ²³⁴⁶	Flevoland → Lelystad ³¹⁸⁰
mounileeuwarden.nl	Falafel Mouni	The sauce is often served separately with falafel shops and döner boxes.	International → Turkish ⁴¹⁶ Quick Bites → Cafeteria ⁹⁰⁶	dönerbox ³³ dürüm ⁹⁷ falafel ¹⁰⁸ sandwich ⁴⁰⁹⁸	Friesland → Leeuwarden ⁶⁰⁶⁸
pokestation-amsterdam.nl	De Valentino's 7	Sandwiches are served with various sauces.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	panini ¹⁵⁶ cheese ¹²⁰⁵ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
puurvis-leidschenveen-den-haag.nl	Puurvis	A selection of sauces is available to accompany the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹²	baked fish ¹² menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
cafetariafameamsterdam.nl	Cafetaria Fame	Cafetaria Fame offers a wide range of sauces with its dishes.	Fast Food → Burger Restaurants ³⁴⁶ Sandwiches & Salads → Italian Cuisine ⁹⁹	shawarma ³³⁵ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
hunkarrestaurant-amsterdam.nl	Hünkar Restaurant	Various sauces are available to add to the dishes.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	soup ¹⁰⁴³ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
kenyan-delicacies-den-haag.nl	Kenyan Delicacies	Samosas and baked sweet potatoes are served with sweet chili or spicy sriracha sauce.	International → African ¹⁵	samosa ⁶⁰ curry ³⁵⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
goedlekker.nl	GoedLekker	The site also offers various sauces for use with the dishes.	Food → Cooking & Recipes ³⁹⁸⁹	dessert ⁴⁹⁶ appetizer ⁵⁵⁶ snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶
tokonina-haarlem.nl	Toko Nina	The website provides an overview of various types of sambals and sauces.	Catering & Ready Meals → Indonesian Restaurant ³⁹²	rame ¹⁹ rice ⁶³⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
fitter-best.nl	Studio Fi)tt(er	Studio Fi)tt(er now sells Callowfit sauces that are free from added sugars and fats.	Vegan & Vegetarian → Vegan ³⁹⁰ Meal Solutions → Food Businesses ⁵⁷	meal replacement ²² challenge ¹⁶⁹⁷ coach ²⁵⁸¹⁰	North-Brabant → Best ⁹⁷⁸
cantingdimsum.nl	Canting Dim Sum	Three different sauces are offered to enhance the flavor of the dim sum.	Asian → Chinese ⁴¹⁵	freezer ⁵⁰ dim sum ⁸⁷ hospitality ³⁴⁹¹
trafficgrill-groningen.nl	Traffic Grill	A wide range of sauces is available to top the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	meat dishes ⁶⁶ spareribs ²¹³ plate ⁷⁸⁷ sandwich ⁴⁰⁹⁸	Netherlands → Groningen ²³⁷³⁴
bipafrietwagen.nl	BIPA Friet	The website offers choice of warm sauces, such as gravy, satay, and goulash.	Logistics → Transportation ¹¹⁰² Sandwiches & Salads → Snacks ⁶⁹³	truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹² book ¹¹³⁹⁶
royalcorner.nl	Royal Corner	Royal Corner offers warm sauce sandwiches as an alternative to traditional cakes.	Sandwiches & Salads → Prepared Foods ³⁹ Sandwiches & Salads → Sandwich Shops ²²⁹	lunch ¹⁵³⁴ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
smashthat.nl	SmashThat	Burgers are served with homemade sauce and options like mayonnaise and ketchup.	Fast Food → Burgers ⁶⁸⁷	combo ⁵⁹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³	North-Holland → Amsterdam ⁴¹²⁵³
kebabhuis-vollenhove.nl	Kebabhuis Vollenhove	The website offers a variety of sauces with the dishes.	International → Turkish ⁴¹⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	appetizer ⁵⁵⁶ döner ⁶⁷³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Steenwijkerland → Vollenhove ²⁰⁷
pizzariadelal-tolkamer.nl	Pizzaria Delal	The website describes the available sauces for the pizzas.	Italian Restaurant → Pizza Restaurant ³⁵¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ wrap ⁸²⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zevenaar → Tolkamer ¹²⁷
pollodekoog.nl	Pollo De Koog	The sauces are created by the restaurant’s team themselves.	Grilling & Steaks → Meat Restaurants ⁵⁷ Context ¹⁶¹³⁹⁴	chicken ⁹⁴⁴ beer ²⁸⁸⁷ coffee ³⁸³⁸ wine ⁴⁴⁷⁶	North-Holland → Texel ²²⁰⁸
samsonenfriet.nl	Samson & Friet	Customers can combine their fries with a variety of sauces.	Fast Food → Burger Restaurants ³⁴⁶	top ³⁷⁷ pastries ⁹⁴⁶ fries ²⁷⁵³ menu ¹³⁸⁵⁶
cookingqueens.nl	CookingQueens	The website features a recipe for homemade peanut sauce.	Pastry → Cakes ⁸²⁶	pasta ¹³⁸⁹ cake ¹⁷³⁰ recipe ⁵¹⁴² dish ⁵⁹³⁶
receptenbundel.nl	Receptenbundel	There are recipes for various sauces.	Chocolate & Sweets → Sweets ²⁵⁷	cocktail ⁹²⁵ cake ¹⁷³⁰ salad ²⁴⁴⁴ recipe ⁵¹⁴² dish ⁵⁹³⁶
stoer-lekker.nl	Stoer & Lekker	The website describes 'Siem's Sauce' as a standard ingredient with burgers, enhancing the flavor.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Utrecht → Baarn ¹⁶²⁸
annemariekookt.nl	Annemarie van Pol	Annemarie emphasizes the importance of perfectly balanced sauces.	Pastries & Baked Goods → Pastry ¹²¹⁰ Cooking & Recipes → Home Cooking ³⁵	dinner ¹⁵³³ cake ¹⁷³⁰ catering ⁶⁴⁵⁶
vishandeldeankarhof.nl	Volendammer Vishandel Dean Karhof	The shop offers a choice of various homemade sauces.	Fish & Seafood → Fresh Food ⁵²	platter ⁶⁶ herring ¹⁵⁶ specialty ²²⁹ folder ³⁰⁰ fish ¹¹²¹	North-Holland → Medemblik ¹⁵³⁵
decouscousbar.nl	Couscousbar	The dishes are served with a flavorful broth.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Cuisine → Vegetarian ⁶⁹⁷	couscous ²³ vegetables ¹⁴¹⁶ dish ⁵⁹³⁶
evelinewu.nl	Eveline Wu	Eveline Wu has developed special ‘Signatures Sauces’.	Cuisine → International Cuisines ¹⁰¹	cooking ⁸⁰¹ recipe ⁵¹⁴² restaurant ¹¹²¹⁵
aardappelanders.nl	Aardappel Anders	The website sells sauces that can easily be added to potato dishes.	Vegetables → Potatoes ¹⁰⁰ Cooking & Recipes → Dishes ³³⁵	bacon ²² onion ¹¹¹ potato ⁵⁴² recipe ⁵¹⁴²
frietoplocatie.nl	Friet op Locatie	A wide assortment of sauces is offered.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	truck ¹⁴¹² buffet ¹⁷⁴⁷ fries ²⁷⁵³ package ⁶¹¹² catering ⁶⁴⁵⁶
snackbarroma.nl	Snackbar Roma (Foe)	The website offers a variety of sauces with fries and burgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	lasagna ²³ gyro ⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Edam-Volendam → Volendam ⁹⁴⁸
turndontburn.nl	Turn Don't Burn	The platform features recipes and information on various BBQ sauces and marinades.	Cooking & Recipes → BBQ ²³⁶	spices ³⁴⁰ bbq ⁹⁰⁸ equipment ⁴¹⁴³ recipe ⁵¹⁴² blog ¹³³⁹²
sandrasbroodjescorner.nl	Sandra's Lunchroom	The website offers various sauce options for the customer to choose from when ordering.	Quick Bites → Cafeteria ⁹⁰⁶ Cafes & Lunch → Lunch Spots ²³⁷	sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Kampen ²¹⁶¹
lunchbollenstreek.nl	Lunch Bollenstreek	The restaurant uses white wine sauce in dishes, such as baked salmon.	Performance → Live Music ¹⁶¹² Brasseries & Bistros → Brasserie ¹⁰⁰⁵	high tea ⁵⁸⁵ dinner ¹⁵³³ lunch ¹⁵³⁴ coffee ³⁸³⁸ drink ⁵¹⁹¹	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
hotking.nl	Hot King	Sichuan sauce is an essential component of Sichuan cuisine and is used to give the dishes an intense flavor.	Asian → Chinese ⁴¹⁵ Context ¹⁶¹³⁹⁴	dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
dynasty-veluwe.nl	Golden Dynasty Chinese Specialities Restaurant	Customers can choose from 15 different sauces with the Ti Pan dishes.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷ Catering & Ready Meals → Takeaway ⁴⁰⁹	takeaway ⁶⁵³ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	Ede → Harskamp ¹⁷²
stoofpeertjesmaken.nl	stoofpeertjesmaken.nl	The website describes how the cooking liquid from the stoofpeertjes can be converted into a flavorful sauce.	Cuisine → Dutch Cuisine ¹⁷⁹ Cooking & Recipes → Dishes ³³⁵	cinnamon ¹⁰ pear ⁷⁹
cateringbywarda.nl	Catering by Warda	A variety of sauces are offered to enhance the dishes.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	spring rolls ¹⁴¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
wereldkeuken-triavium.nl	Wereldkeuken Triavium	Guests can create their own wok dishes by choosing their favorite ingredients and sauce.	Restaurants & Dining → International Restaurants ¹¹	hotpot ²⁵ crab ³⁵ broth ³⁷ grill ⁵⁶² sushi ¹⁶⁹⁵	Gelderland → Nijmegen ⁹³⁸⁴
bosschebasakdoner.nl	Bossche Basak Doner	There is a choice of different sauces with the kapsalons and plates.	Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ plate ⁷⁸⁷ cheese ¹²⁰⁵ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸
aarti-2.nl	Aarti Roti Amsterdam	Various dishes are served with different sauces, such as ketjap and soya.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Catering & Ready Meals → Takeaway ⁴⁰⁹	vegetarian dishes ³⁴ curry ³⁵⁵ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
snackbarbinnenburg.nl	Snackbar Binnenburg / Chinees Afhaal Binnenburg	Gon Bao, the house specialty, is a paprika and nut sauce.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Asian ²⁷²³	chinese ⁶⁸ rice ⁶³⁵ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Texel → Den Burg ¹⁸⁴
burgerbitch.nl	Burger Bitch	A signature 'Bitch Sauce' complements the burgers, contributing to their unique flavor profile.	Fast Food → Burgers ⁶⁸⁷ Sports Activities → Football ⁴¹⁴⁴	beef ³¹⁹ burger ¹⁴³¹ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
karadagfoods-zoetermeer.nl	Karadag Foods	Karadag Foods has homemade special sauces that are used with the burgers and other dishes.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner ⁶⁷³ burger ¹⁴³¹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
vuurproeven.nl	Quality BBQ	Quality BBQ makes its own homemade BBQ sauce which is used to glaze the meat.	Grilling & Steaks → Grills ⁹⁶ Cooking & Recipes → BBQ ²³⁶	smoker ⁶⁸ bbq ⁹⁰⁸ meat ²⁰⁵⁵ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
momijisushi.nl	Momiji Sushi	The website provides information about the use of various sauces.	Food → Culinary Travel ⁴³ Culture → Cultural Travel ⁴²¹	asia ⁴⁶ barbecue ¹¹⁷⁵ coffee ³⁸³⁸ kitchen ⁶⁴⁴³	North-Holland → Hilversum ⁴³⁹⁷
vivianvanbrussel.nl	Vivian van Brussel	The Züricher Geschnetzeltes are presented with a prominent cream sauce.	Cuisine → Dutch Cuisine ¹⁷⁹ Cooking & Recipes → Meat Dishes ¹⁰	stew ⁶² mussel ¹⁴⁵ recipe ⁵¹⁴² dish ⁵⁹³⁶ blog ¹³³⁹²
friterieoplocatie.nl	Friterie aon de Kirk and Catering	The fried food shop serves homemade warm sauces with the fresh fries.	Fast Food → Burgers ⁶⁸⁷	frituur ¹² cooking ⁸⁰¹ buffet ¹⁷⁴⁷ event ⁴⁵¹⁹⁹	Valkenburg aan de Geul → Valkenburg ⁹²²
lakerhof.nl	Thuis Lakerhof	The website lists various sauces that can be served with the main courses.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵	group menu ¹³ brasserie ⁷⁵² reservation ³³⁷³ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
fritaria-almere.nl	Fritaria Almere	Various sauces are offered to accompany the dishes.	Fast Food → Fries ⁹⁴⁹	satay ³²⁰ plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³ order ⁶⁹¹²	Flevoland → Almere ⁷⁷⁶⁵
saray-aarle-rixtel.nl	Saray Aarle-Rixtel	Visitors can choose from different sauces with the wraps and plates.	International → Turkish ⁴¹⁶ Mediterranean & Middle Eastern → Takeout ²⁸⁶	döner ⁶⁷³ plate ⁷⁸⁷ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Laarbeek → Aarle-Rixtel ²³⁸
cafetarialudo.nl	Snackbar Ludo Maastricht	A selection of sauces is available, both hot and cold, which can be added to the order.	Web Design & Development → Web Services ⁴¹³ Fast Food → Fries ⁹⁴⁹	promotion ²⁰⁶² fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Limburg → Maastricht ⁶⁰⁰⁸
aspergo.nl	Aspergo	The asparagus is served with butter sauce, a popular combination.	Vegetables → Asparagus ⁶² Cooking & Recipes → Dishes ³³⁵	ham ⁴⁰ salmon ¹⁸⁵ asparagus ¹⁸⁶ dinner ¹⁵³³	Sint-Michielsgestel → Den Dungen ¹⁷⁵
belgischebroodjesbar.nl	Belgian Bread Bar	Sandwiches are served with a diverse selection of sauces.	Lunch → Sandwiches ⁴⁶⁶ Bars & Pubs → Bars ¹⁹³⁸	ham ⁴⁰ cheese ¹²⁰⁵ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Valkenswaard ¹¹⁷⁹
cateringvanveen.nl	Catering van Veen - ERICA	Customers can choose from a variety of sauces, including mayonnaise, curry, ketchup, and joppie.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	snack cart ¹⁵ fries ²⁷⁵³ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
denasfoodtruck.nl	Dena's Cafetaria	A variety of sauces are available to accompany the dishes.	Quick Bites → Food Trucks ⁶²³ Catering & Ready Meals → Takeaway ⁴⁰⁹	fast food ¹² burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Leeuwarden → Wergea ⁶³
paulsnacks.nl	Paul's Snacks & bread rolls	At the Piri Piri dishes there is the possibility to order extra sauce.	Sandwiches & Salads → Snacks ⁶⁹³ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	chip ¹³⁸ cheese ¹²⁰⁵ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Groningen → Haren ⁸⁰⁵
cafetariaridderhof.nl	Cafetaria Ridderhof	The snack bar makes its own special sauce according to an old family recipe.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	meat ²⁰⁵⁵ snack ²⁹¹⁶ employee ⁴⁴²⁹ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
crostamollica.nl	Crosta & Mollica	The white sauce in the pizzas is specifically mentioned as a flavorful factor that makes the pizzas particularly delicious.	Sandwiches & Salads → Italian Cuisine ⁹⁹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	crust ¹⁷ inspiration ⁴⁰⁸¹ pizza ⁴¹⁵⁸ travel ⁷²¹⁰
caffecorretto.nl	Caffè Corretto	The sauces and tapenades are prepared in-house.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Venues → Event Spaces ⁴³²	lunch ¹⁵³⁴ coffee ³⁸³⁸ space ³⁸⁴⁶ menu ¹³⁸⁵⁶	North-Brabant → Oss ²⁹⁶²
smultaria-schagen.nl	Smultaria	The website offers a wide range of sauces to accompany the dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	plate ⁷⁸⁷ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Schagen ²¹⁸²
delifrance-enschede.nl	Délifrance	The website offers a wide range of sauces to enhance the sandwiches and salads.	Quick Bites → Cafeteria ⁹⁰⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	panini ¹⁵⁶ roll ³⁵⁸ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
bigsnack-hoogeveen.nl	De Cascade	Various sauces are offered with the dishes.	Fast Food → Fries ⁹⁴⁹ Pastries & Baked Goods → Menus ²²³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ package ⁶¹¹² menu ¹³⁸⁵⁶	Drenthe → Hoogeveen ²²⁹⁴
boerske-breda.nl	Boerske Breda	Boerske sauce is an important component in many dishes, such as with the sandwiches and special dishes.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
jungle-burger-amsterdam.nl	Jungle Burger	Jungle Burger has a homemade Jungle-Burger sauce that is used with the various burgers.	Fast Food → Burgers ⁶⁸⁷	bun ²⁷ vegan ⁵⁰⁸ burger ¹⁴³¹ ingredients ²³⁴⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
kwalitaria-almere.nl	Kwalitaria Buitengewoon	The website describes the flavorful sauces used in the dishes.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	chicken ⁹⁴⁴ burger ¹⁴³¹ meal ¹⁶³⁸ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
kwalitaria-eerbeek.nl	Kwalitaria Délifrance Eerbeek	The website describes a wide range of sauces that can be added to the dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Pastries & Baked Goods → Menus ²²³	chicken ⁹⁴⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Brummen → Eerbeek ³²⁸
wokholy.nl	WOK Holy	Customers can customize their wok meal by choosing a sauce.	Asian → Chinese ⁴¹⁵	wok dish ⁶⁶ wok ²³¹ vegetables ¹⁴¹⁶ menu ¹³⁸⁵⁶	Rotterdam → Pernis ¹⁴²
rickskeuken.nl	Rick's Kitchen	The creamy mayo-slasaus dressing is an important part of the flavor of the Hulzen Salad.	Sandwiches & Salads → Appetizers ⁴⁰ Cooking & Recipes → Main Courses ¹²	risotto ²⁶ soup ¹⁰⁴³ salad ²⁴⁴⁴ recipe ⁵¹⁴² dish ⁵⁹³⁶
rachawadeethaihomemade.nl	Thai Homemade \| Tasty Thai	The website offers a diverse selection of Thai woksauces and curry pastes, available in various flavors.	Asian → Thai ³⁰¹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	thai cuisine ¹¹⁰ recipe ⁵¹⁴²
broodjeco-arnhem.nl	Broodje & Co	Various homemade sauces are offered with the sandwiches and panini's.	Lunch → Sandwiches ⁴⁶⁶	panini ¹⁵⁶ ingredients ²³⁴⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
foodbrothersamsterdam.nl	Food Brothers	The website offers a selection of sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ meat ²⁰⁵⁵ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
olverrewijn.nl	Olverre	The website offers special sauces specifically suitable for the BBQ.	Wine → Wine Tasting ⁷³⁰	wine tasting ²³⁸ wine ⁴⁴⁷⁶ package ⁶¹¹² shop ⁶⁴⁸³
tostcumahmutcoolsingel-rotterdam.nl	Tostçu Mahmut Coolsingel	Various sauces are available for choice with the order.	Quick Bites → Snack Bar ⁵⁸⁰ Turkish Cuisine → Fast Food ³²²²	tosti ²³ doner ¹³¹ wrap ⁸²⁶ cheese ¹²⁰⁵ fries ²⁷⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
rolderspatathoes.nl	Rolder's Patathoes	A wide range of sauces is available for the fries, including herbs, vegan mayo, curry and ketchup.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ smoothie ³⁸⁴ pickup ⁷³⁶ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Aa en Hunze → Rolde ¹⁷⁶
schippervleesenbbq.nl	Schipper Vlees & BBQ	The packages contain three types of sauces to enhance the meat products.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	bbq package ²⁴ bread roll ²⁸ online store ⁹⁰⁵ meat ²⁰⁵⁵ salad ²⁴⁴⁴	Lingewaard → Huissen ⁵³⁷
cigkoftemmercator.nl	Cigköftem - Mercator Amsterdam	Various sauces are offered as a side dish with the cigköfte.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Food Delivery → Delivery ²²²⁷	wrap ⁸²⁶ package ⁶¹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
menkenbeheer.nl	Menken Keuken	The company is specialized in the development and production of a wide range of sauces.	Wholesale → Food Products ³⁰³ Meat → Meat Products ²¹¹	meat products ²⁷² salad ²⁴⁴⁴ production ⁴⁵⁸²	Teylingen → Sassenheim ⁵⁹⁹
eetcafecollegas.nl	Eetcafe Collega's	The website offers a large selection of sauces that can be ordered with the dishes.	Quick Bites → Cafeteria ⁹⁰⁶	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
slagerbeert.nl	Slager Beert Karssen	Homemade sauces give the barbecue a personal touch.	Cooking & Recipes → Culinary ³³⁸	barbecue ¹¹⁷⁵ vegetables ¹⁴¹⁶ meat ²⁰⁵⁵ salad ²⁴⁴⁴ menu ¹³⁸⁵⁶	Gelderland → Harderwijk ²²⁴⁰
mqdonerpizza-weert.nl	M.Q. Döner Pizza	Various sauces are available to serve with the dishes.	Websites → Local Businesses ⁸⁵ Fast Food → Fries ⁹⁴⁹	döner kebab ⁸¹ beer ²⁸⁸⁷ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Limburg → Weert ²⁰³⁰
hetspoor-denbosch.nl	Het Spoor Den Bosch	A kapsalon is a dish consisting of fries covered with...	Fast Food → Burgers ⁶⁸⁷ Cafes → Dutch Restaurants ¹⁰³¹	kapsalon ⁵⁰⁹ cheese ¹²⁰⁵ fries ²⁷⁵³ pizza ⁴¹⁵⁸	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
cigkoftemdeventer-deventer.nl	Çigköftem Deventer	A wide range of sauces are available to enhance the dishes.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	ayran ¹⁰ wrap ⁸²⁶ pizza ⁴¹⁵⁸ package ⁶¹¹²	Overijssel → Deventer ⁴⁷⁵¹
turquoisemosaegusto-maastricht.nl	Turquoise Mosae Gusto	The website describes a wide range of sauces that can be chosen with the dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Turkish Cuisine → Fast Food ³²²²	rotisserie ¹¹ lahmacun ⁹³ kebab ²⁷⁶ box ¹⁹⁸² sandwich ⁴⁰⁹⁸	Limburg → Maastricht ⁶⁰⁰⁸
frietzo.nl	Frietzo	Each customer receives a large bag with the tastiest sauces with their fries.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	fry cart ¹⁹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
bbq-vlees-bestellen.nl	Maros	Various sauces are offered with the All-in packages.	Cooking & Recipes → BBQ ²³⁶ Food → Meat ¹¹²³	bbq ⁹⁰⁸ meat ²⁰⁵⁵ package ⁶¹¹²	North-Brabant → Roosendaal ²⁶⁷⁷
sunnybirdz.nl	SunnyBirdz	Chicken wings are served with spicy pepper ranch and our Slap Yo Mamma Hot Sauce.	Quick Bites → Food Trucks ⁶²³	lemonade ³³ waffle ²¹⁸ roll ³⁵⁸ chicken ⁹⁴⁴ festival ³⁸⁰⁴
debesteribbenvanrotterdam.nl	The Best Ribs of Rotterdam!	A wide range of sauces are offered with the order.	Food Delivery → Delivery ²²²⁷	rib ¹⁹¹ menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
receptenpret.nl	Recepten Pret	A yogurt-citrus sauce is described as a way to give salads a fresh flavor.	Food → Cooking & Recipes ³⁹⁸⁹	soup ¹⁰⁴³ pasta ¹³⁸⁹ salad ²⁴⁴⁴ recipe ⁵¹⁴² dish ⁵⁹³⁶
schnitzelhouse.nl	Schnitzel House	Schnitzel House makes its sauces themselves according to a secret recipe.	Regional Cuisine → German ¹⁷	schnitzel ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³
eetcafe55.nl	Eetcafé 55	The restaurant serves the dishes with accompanying sauces.	Cafes → Brown Cafés ⁵⁹⁹ Freight & Logistics → Trucks ⁸⁹⁹	break ⁵⁰ café ⁹⁴⁴ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Southwest-Friesland → Bolsward ⁵⁶⁶
eethoek10west-amsterdam.nl	Eethoek 10 West	The satay sauce is a common topping for the sandwiches and chicken.	Restaurants By Location → Restaurants in Amsterdam ²² Sandwiches & Salads → Sandwich Shops ²²⁹	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
2tekonline.nl	2 Tek B.v.	An extensive selection of sauces and extras is available to personalize orders.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	hotdog ³⁵ menus ²²¹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸	Gelderland → Arnhem ⁸⁶⁸⁰
billsburger.nl	Bill’s Burger Joint	The BLT burger is notable for its ‘Bill’s secret sauce’, a key component of the burger’s flavor profile.	Fast Food → Burgers ⁶⁸⁷ Grilling & Steaks → American ⁸⁵	instagram ¹²¹⁶ burger ¹⁴³¹ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
eetcafesantas.nl	Eetcafé Santas	All sauces are freshly prepared on-site, contributing to the quality of the dishes.	Cafes → Brown Cafés ⁵⁹⁹ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	carpaccio ⁴⁷ spareribs ²¹³ terrace ⁴⁸⁴⁷ dish ⁵⁹³⁶	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
seta-galareta.nl	Shoarma Meester Seta & Galareta	Orders are served with two sauces.	Quick Bites → Snack Bar ⁵⁸⁰	shoarma ²⁵⁴ plate ⁷⁸⁷ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Meierijstad → Veghel ¹²⁸⁸
tastypotato.nl	Tasty Filled Potato Delft	The dishes are served with a diverse selection of accompanying sauces.	Cooking & Recipes → Dishes ³³⁵	potato ⁵⁴² order ⁶⁹¹² menu ¹³⁸⁵⁶
americanspareribslijn-amsterdam.nl	Amerikaans Spareribs Line Diemen	Spareribs are served with a choice of different sauces.	Cafes → Dutch Restaurants ¹⁰³¹	spareribs ²¹³ ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Diemen ⁹⁷⁵
baguettetogo-sittard.nl	Baguette To Go	Various sauces are offered to fill the sandwiches and other dishes.	Lunch → Sandwiches ⁴⁶⁶	panini ¹⁵⁶ smoothie ³⁸⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	Sittard-Geleen → Sittard ¹⁹⁹⁷
bakiszwolle.nl	Baki's	Customers can choose their preferred sauce when ordering.	Cafes → Dutch Restaurants ¹⁰³¹	kebab ²⁷⁶ wrap ⁸²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Overijssel → Zwolle ⁷³⁹⁵
balkanrestaurantyoegoslaviehengelo.nl	Balkan Restaurant Yoegoslavie	Different sauces are served with the dishes.	Fast Food → Burger Restaurants ³⁴⁶ Turkish Cuisine → International ¹²⁰⁷	grilled dishes ⁴⁹ rice ⁶³⁵ meat ²⁰⁵⁵ dish ⁵⁹³⁶	Overijssel → Hengelo ³⁴⁹⁹
bolswardmorgana.nl	Morgana Bolsward	Various sauces can be chosen to enhance the dishes.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner ⁶⁷³ pasta ¹³⁸⁹ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Southwest-Friesland → Bolsward ⁵⁶⁶
burger-n-shake-amsterdam.nl	Burger 'n Shake Amsterdam Oostpoort	Various sauces, such as Brooklyn, chimichurri, and ginger-citrus, enhance the flavor of the hamburgers.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → Mexican ¹⁵¹	hamburger ³⁶⁴ chicken ⁹⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
burgersenbeersvenlo.nl	Burgers and Beers	The website offers a variety of sauces to accompany the burgers.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Limburg → Venlo ⁴¹⁵⁸
burgersnmore-rotterdam.nl	Burgers N More	Various sauces, such as ketchup and mustard, are offered to accompany the hamburgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
burgerspecialarnhem.nl	Burger Special	All burgers are served with a special burger sauce.	Fast Food → Fries ⁹⁴⁹ Cafes → Dutch Restaurants ¹⁰³¹	momo ¹⁴ wrap ⁸²⁶ burger ¹⁴³¹ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
caferestaurantdinkelsweideglane.nl	Café Restaurant Dinkelsweide	Various sauces are offered with the dishes.	Fast Food → Burger Restaurants ³⁴⁶	snitzel ¹⁰ chicken burger ¹⁸ hamburger ³⁶⁴ wrap ⁸²⁶ drink ⁵¹⁹¹	Losser → Glane ¹⁹
cafetaria-caglar-nijmegen.nl	Cafetaria Caglar	A diverse range of sauces is available to enhance the dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Turkish Cuisine → Takeout Restaurant ⁸¹	döner ⁶⁷³ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Gelderland → Nijmegen ⁹³⁸⁴
cafetaria-la-route-soest.nl	Cafetaria La Route	Various sauces are available, such as Mayonnaise, Curry and Andalouse.	Cafeteria → Dutch Cafeteria ¹²²	frikandel ¹⁸ halal ¹⁶⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Soest ²⁰²⁷
cafetaria-rockanje-rockanje.nl	Cafetaria Rockanje	Various sauces are offered, indicating the matching of flavors with the dishes.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Voorne aan Zee → Rockanje ²⁹⁸
cafetariadebloemenbuurt-terneuzen.nl	Cafetaria de Bloemenbuurt	The website describes various sauces used in the dishes, such as unagi and mayonnaise.	Japanese → Sushi ⁹⁷¹ Sandwiches & Salads → Snacks ⁶⁹³	poké bowl ¹⁶⁹ rice ⁶³⁵ sushi ¹⁶⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zeeland → Terneuzen ¹⁵¹⁷
cafetariadedreef-zeist.nl	Cafetaria De Dreef	A selection of sauces is available to accompany the fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	turkish pizza ⁶³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Zeist ²⁶⁴⁴
cafetariatsmulparadijs-culemborg.nl	Cafetaria 't Smulparadijs	A wide variety of sauces is available with the fries and other dishes.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Gelderland → Culemborg ¹²⁶⁴
cafetariavanputten-rotterdam.nl	Cafetaria Van Putten	Various sauces are offered to top the dishes.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetariawing-landgraaf.nl	Cafetaria Wing	A comprehensive selection of sauces is offered to enhance the dishes.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	spareribs ²¹³ wok ²³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Landgraaf ⁷¹⁹
casaray-helmond.nl	CasaRay	Customers can add their dish to their liking with matching sauces.	Fast Food → Fries ⁹⁴⁹ Cafes → Dutch Restaurants ¹⁰³¹	burger ¹⁴³¹ salad ²⁴⁴⁴ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
dayi-utrecht.nl	Dayi Pizza & Shoarma	The website offers a variety of sauces with the ordered dishes.	Fast Food → Burger Restaurants ³⁴⁶ International → Turkish ⁴¹⁶	shawarma ³³⁵ plate ⁷⁸⁷ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
dequackede.nl	De Quack	A cream sauce is a common base for the pasta dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken ⁹⁴⁴ pasta ¹³⁸⁹ burger ¹⁴³¹ drink ⁵¹⁹¹	Gelderland → Ede ⁵¹⁰⁴
dimitrafastfood-nieuwegein.nl	Dimitra Fastfood	Various sauces are available to serve with the dishes.	International → Greek ⁴⁶⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	gyro ⁹⁵ pita ¹⁹⁹ burger ¹⁴³¹ fries ²⁷⁵³ dish ⁵⁹³⁶	Utrecht → Nieuwegein ²²⁶⁴
doner-dudes-vegan-kebab-shoarma-delft.nl	Doner Dudes - Vegan Kebab & Shoarma Delft	A wide range of different sauces are available to choose from with the dishes.	Vegan & Vegetarian → Vegan Restaurants ²⁸ Cuisine → Vegetarian ⁶⁹⁷	pita ¹⁹⁹ shoarma ²⁵⁴ kebab ²⁷⁶ döner ⁶⁷³ fries ²⁷⁵³	South-Holland → Delft ⁵³⁰⁹
dutchpokebowl.nl	Dutch Pokebowl	The customer can choose their own sauce for their Dutch Pokebowl.	Fast Food → Fries Restaurants ⁸⁷ Cafes & Lunch → Lunch ⁵⁹¹	poke bowl ³⁰⁸ top ³⁷⁷ potato ⁵⁴² menu ¹³⁸⁵⁶
eatingpointheerhugowaard.nl	Eatingpoint Heerhugowaard	The website provides an overview of the different sauces used in the dishes.	Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ döner ⁶⁷³ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Dijk en Waard → Heerhugowaard ²⁰¹¹
eetcafeilayda-ede.nl	Eetcafé Ilayda	The dishes and pizzas are served with various sauces.	Turkish Cuisine → Fast Food ³²²²	döner kebab ⁸¹ bread ¹⁶²² salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Gelderland → Ede ⁵¹⁰⁴
eetcafemalika-leeuwarden.nl	Eetcafé Malika	A wide range of sauces are available to flavor the dishes.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	turkish pizza ⁶³ doner ¹³¹ plate ⁷⁸⁷ wrap ⁸²⁶ sandwich ⁴⁰⁹⁸	Friesland → Leeuwarden ⁶⁰⁶⁸
eethuis-capadokyawbeckmansingel-vlaardingen.nl	Eethuis Capadokya Vlaardingen	Various sauces are offered with the dishes.	Fast Food → Fries ⁹⁴⁹ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	dönerbox ³³ turkish pizza ⁶³ kapsalon ⁵⁰⁹ plate ⁷⁸⁷ fries ²⁷⁵³	South-Holland → Vlaardingen ¹⁸⁵³
familyfriedchicken-hilversum.nl	Family Fried Chicken	Various sauces are offered with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Chicken Dishes ⁹²	bucket ¹¹³ chicken ⁹⁴⁴ salad ²⁴⁴⁴ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
fastfreshmexicanfood-rotterdam.nl	Fast & Fresh Mexican Food	A selection of sauces is available to order, including mild and spicy options.	Mexican & South American → Mexican ¹⁵¹	rice bowl ¹⁷ burrito ⁶² drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
fatphills-utrecht.nl	Fat Phills Utrecht	The website offers a variety of sauces to customize the dishes to your liking.	Cafes → Dutch Restaurants ¹⁰³¹ Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
filipinogrocery.nl	FilipinoGrocery.nl	The website stocks various sauces and seasoning mixes, reflecting the importance of flavor in Filipino cooking.	Specialty Foods → International Foods ¹⁹ Coffee & Tea → Beverages ⁴⁴⁵³	seafood ¹⁴⁸ dessert ⁴⁹⁶ beverage ⁵⁸⁶ meat ²⁰⁵⁵
fishpointcapelle-capelleaandenijssel.nl	Fishpoint Capelle	A wide range of sauces are available to accompany the dishes.	Restaurants & Dining → Seafood Restaurants ⁶¹²	fish dishes ⁴⁷ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
foodiespizza-rotterdam.nl	Foodies pizza Rotterdam	Various sauces are offered with the orders.	Fast Food → Döner ²³⁸ Fast Food → Burger Restaurants ³⁴⁶	doner ¹³¹ shawarma ³³⁵ kapsalon ⁵⁰⁹ wrap ⁸²⁶ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
frankys-fish-chips-and-snacks-eindhoven.nl	Franky's Fish, Chips and Snacks	Various sauces are available to accompany the dishes.	Catering & Ready Meals → Takeaway ⁴⁰⁹	kibbeling ¹¹⁵ fries ²⁷⁵³ dish ⁵⁹³⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
friturewendy.nl	Friture Wendy	Delicious sauces await you. With Friture Wendy, I want to be a meeting place in Rijckholt for young and old.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	frituur ¹² fries ²⁷⁵³ snack ²⁹¹⁶ hospitality ³⁴⁹¹ menu ¹³⁸⁵⁶	Eijsden-Margraten → Gronsveld ¹⁰⁴
gochu-gang-deventer.nl	Gochu Gang	The website offers a selection of different sauces to flavor the dishes.	Food Delivery → Korean Restaurants ³³	korean fried chicken ¹⁸ combo ⁵⁹ chicken ⁹⁴⁴ menu ¹³⁸⁵⁶	Overijssel → Deventer ⁴⁷⁵¹
grieks-restaurant-olympia-almere.nl	Grieks Restaurant Olympia Almere	Some dishes are topped with a delicious sauce.	International → Greek ⁴⁶⁵ Lunch → Sandwiches ⁴⁶⁶	pita ¹⁹⁹ salad ²⁴⁴⁴ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
happy-pasta.nl	Happy Pasta Valkenburg	The website describes the ingredients used in the various sauces for the dishes.	Italian → Pasta ²¹³ Sauces & Condiments → Sauces ⁴⁹	vegan ⁵⁰⁸ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Valkenburg aan de Geul → Valkenburg ⁹²²
het-kwartier.nl	Het Kwartier	Various sauces are available to serve with the dishes.	Turkish Cuisine → Fast Food ³²²² Food → Meat ¹¹²³	pita ¹⁹⁹ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Utrecht → Amersfoort ⁸⁰¹¹
hollandersnieuwe-leeuwarden.nl	Hollander's nieuwe	Customers can choose from two sauces when ordering.	Fish & Seafood → Fish ³⁸⁸	kibbeling ¹¹⁵ fish ¹¹²¹ fries ²⁷⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
ietsandersbroodjes-oudenbosch.nl	Iets Anders Broodjes	All dishes are served with sauce to choose from.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	panini ¹⁵⁶ plate ⁷⁸⁷ burger ¹⁴³¹ sandwich ⁴⁰⁹⁸	Halderberge → Oudenbosch ³⁵²
ijsspecialist-edma.nl	Ijsspecialist EDMA	The website offers various sauces to complement the fries.	Japanese → Sushi ⁹⁷¹ Fast Food → Fries ⁹⁴⁹	croquettes ¹⁰⁸ chicken ⁹⁴⁴ sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
italiaans-popeye-almere.nl	Italiaans Popeye	Most pasta dishes are served with a creamy sauce.	Fast Food → Burgers ⁶⁸⁷ Italian Restaurant → Pizza Restaurant ³⁵¹	doner ¹³¹ shrimp ²¹⁹ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
jacks-rippies-schiedam.nl	Jack's Rippies Schiedam	A wide range of sauces, both hot and cold, are available to pour over the dishes.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Schiedam ²²⁴⁹
jamaica-suritwist.nl	Jamaica Suri Twist	The website describes the various sauces available with the dishes.	Mexican & South American → International Cuisine ⁴¹¹ Cooking & Recipes → Dishes ³³⁵	roti ³⁰³ pickup ⁷³⁶ fries ²⁷⁵³ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
jessyskitchen-denhaag.nl	Jessy's Kitchen	Various sauces are available to top the dishes.	Food Delivery → Delivery ²²²⁷	wrap ⁸²⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
jfkburgersplantage-amsterdam.nl	JFK Burgers Plantage	The website offers a selection of special sauces to enhance the flavor of the burgers.	Fast Food → Burgers ⁶⁸⁷ Sandwiches & Salads → Snacks ⁶⁹³	taste ⁹³³ burger ¹⁴³¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
joeskitchenalkmaar.nl	Joe's Kitchen Alkmaar	Dishes are served with a variety of special sauces.	Food Delivery → Delivery ²²²⁷ Food Delivery → Indonesian ⁵⁰²	loyalty points ¹⁴ nasi ²⁴² roti ³⁰³ reviews ³¹⁷² menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
joylunchroom-schiedam.nl	&-Joy Lunchroom	Various sauces are offered, such as mustard dressing and truffle mayonnaise.	Lunch → Sandwiches ⁴⁶⁶ Cafes & Lunch → Lunch Spots ²³⁷	baguette ³⁵ wrap ⁸²⁶ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Schiedam ²²⁴⁹
karel-kerkrade.nl	Karel	The website offers a variety of sauces, including mayonnaise, curry and ketchup.	Turkish Cuisine → Fast Food ³²²²	chicken dishes ²⁶ gyro ⁹⁵ pita ¹⁹⁹ shawarma ³³⁵ sandwich ⁴⁰⁹⁸	Limburg → Kerkrade ¹⁰³¹
kibboets-tilburg.nl	Kibboets Tilburg	Various sauces are available to accompany the dishes.	Turkish Cuisine → Fast Food ³²²²	plate ⁷⁸⁷ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
kookkriebels.nl	Kookkriebels	The website offers recipes for sauces, such as a classic tomato salsa with basil.	Blogs → Food Blogs ²⁴⁶ Cooking & Recipes → Healthy Cooking ⁴²	cooking ⁸⁰¹ soup ¹⁰⁴³ bread ¹⁶²² salad ²⁴⁴⁴ recipe ⁵¹⁴²
kwalitaria-kampen.nl	Kwalitaria Hanzewijk	The website describes the different sauces used with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Chicken Dishes ⁹²	shake ¹¹² burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	Overijssel → Kampen ²¹⁶¹
kwalitariaheemskerk.nl	Kwalitaria Broekpolder	Various sauces are offered to enrich the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Heemskerk ¹¹¹¹
lapiazza-alblasserdam.nl	LA PIAZZA/ wine bar/restaurant	The menus describe the different sauces used in the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ fries ²⁷⁵³ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Alblasserdam ⁸²⁶
letspokenboba-groningen.nl	Let's Poké N Boba	Various sauces are offered to season the poke bowls and other dishes.	Sandwiches & Salads → Appetizers ⁴⁰ Food Delivery → Asian ²⁷²³	bubble tea ¹⁵³ waffle ²¹⁸ poke bowl ³⁰⁸ smoothie ³⁸⁴	Netherlands → Groningen ²³⁷³⁴
lombardosamsterdam.nl	Lombardo's	Burgers are served with various homemade sauces.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ ingredients ²³⁴⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
maestros-pizza-burger-zaandam.nl	Maestro's Pizza & Burger	The website provides an overview of various sauces used in the dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Fast Food → Burger Restaurants ³⁴⁶	toppings ¹⁵³ burger ¹⁴³¹ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
massiliapizza-tilburg.nl	Massilia Pizza	The website offers a choice of various sauces for the pizzas and other dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Meal Solutions → Food Online Shops ⁸⁰	dessert ⁴⁹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
maximasnack.nl	Maximasnack Urk	Customers have the choice of different sauces, which can be added during the ordering process.	Fast Food → Burger Restaurants ³⁴⁶	promotion ²⁰⁶² app ⁴⁵⁹⁵ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Flevoland → Urk ⁷⁶²
mcdonaldsbuitenhofdenhaag.nl	McDonald's Den Haag Buitenhof	Burgers are topped with different sauces, such as ketchup and mustard.	Fast Food → McDonald’s ¹² Fast Food → FEBO ²⁴	burger ¹⁴³¹ bread ¹⁶²² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
mesospice.nl	MesoSpice	Hot sauces, including 'El Yucateco' Habanero salsa, are offered for sale.	Fast Food → Burgers ⁶⁸⁷ Turkish Cuisine → International ¹²⁰⁷	tortilla ²² jewellery ⁴⁶ spices ³⁴⁰
misastakeaway-rozenburg.nl	Misa's Takeaway	Various sauces are offered to accompany the dishes.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	wrap ⁸²⁶ chicken ⁹⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸	Rotterdam → Rozenburg ¹⁹⁹
miyagi-jones-haarlem-haarlem.nl	Miyagi & Jones Haarlem	Various sauces are used to enhance the dishes.	Asian → Japanese ¹⁴⁸⁸	rice bowl ¹⁷ side dish ¹¹⁸ sashimi ¹⁹⁴ sushi ¹⁶⁹⁵ salad ²⁴⁴⁴	North-Holland → Haarlem ⁸⁶⁷⁴
mr-gyros-leiderdorp.nl	Mr. Gyros Leiderdorp	Various sauces are offered, both with the fries and the dishes.	International → Greek ⁴⁶⁵	tzatziki ³⁷ gyro ⁹⁵ pita ¹⁹⁹ fries ²⁷⁵³
mrshoarma-lelystad.nl	Mr. Shoarma	Various sauces are available with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Shoarma ⁹⁰	shoarma ²⁵⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Flevoland → Lelystad ³¹⁸⁰
nazar-coevorden.nl	Nazar Coevorden	Various sauces are available to be used with the dishes.	Turkish Cuisine → Fast Food ³²²² Sandwiches & Salads → Italian Cuisine ⁹⁹	döner kebab ⁸¹ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Drenthe → Coevorden ¹⁴⁹²
originalpizzacompany-putten.nl	Ribs Company & Pizza Company	A wide range of sauces are available to season the dishes.	Fast Food → Fries ⁹⁴⁹ Grilling & Steaks → Meat Dishes ⁴⁰	rib ¹⁹¹ salad ²⁴⁴⁴ fries ²⁷⁵³ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Gelderland → Putten ¹⁰⁶⁹
orlunchsnacks-venlo.nl	ORLUNCH SNACKS	Users can supplement their order with various sauces.	Fast Food → Burgers ⁶⁸⁷ Lunch → Sandwiches ⁴⁶⁶	döner ⁶⁷³ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Limburg → Venlo ⁴¹⁵⁸
pastaitaly-zutphen.nl	Pasta Italy	Tomato sauce is a common base for the pasta dishes offered on the website.	Japanese → Poke ¹⁹ Italian → Pasta ²¹³	pasta ¹³⁸⁹ salad ²⁴⁴⁴ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Zutphen ²⁶⁹⁰
pizzeria-rosmalen.nl	Pizzeria Rosmalen	Various sauces are available as extras with the dishes.	Fast Food → Döner ²³⁸ Turkish Cuisine → Takeout Restaurant ⁸¹	döner ⁶⁷³ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	's-Hertogenbosch → Rosmalen ¹⁰⁵⁹
pizzerialacantina-deventer.nl	Pizzeria La Cantina	The website describes the different sauces used in the dishes.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Appetizers ⁴⁰	appetizer ⁵⁵⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Overijssel → Deventer ⁴⁷⁵¹
potatoking-eindhoven.nl	Potato King	A wide range of sauces are available to enhance the dishes.	Fast Food → Fries ⁹⁴⁹	croquette ¹³⁶ hamburger ³⁶⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
pyramide-tilburg.nl	Grillroom Shoarma Pyramide	The website offers various sauces to choose from with the dishes.	Fast Food → Burger Restaurants ³⁴⁶	dürüm ⁹⁷ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Tilburg ⁸⁷⁵⁹
renard-sint-gillis-waas.nl	Renard	There is a selection of sauces available for pizzas and pasta.	Regional Cuisine → German ¹⁷	dessert ⁴⁹⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹
restaurant-mesken-amsterdam.nl	Restaurant Mesken	Various sauces are available as an extra accompaniment to the orders.	International → Middle Eastern ¹¹⁶ International → Turkish ⁴¹⁶	pita bread ⁵⁰ shoarma ²⁵⁴ plate ⁷⁸⁷ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
roots-snouckaertlaan.nl	Roots Munchies	Various sauces are offered to view the dishes.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³	Utrecht → Amersfoort ⁸⁰¹¹
sardi-amsterdam.nl	Sardi	In addition to the main dishes, a selection of sauces is offered, such as barbecue and truffle mayonnaise.	Fast Food → Burger Restaurants ³⁴⁶ Sandwiches & Salads → Sandwich Shops ²²⁹	steak ³³⁵ burger ¹⁴³¹ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
shalom-hoogvliet.nl	Shalom Hoogvliet	Dishes are served with various sauces.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	pita bread ⁵⁰ kebab ²⁷⁶ döner ⁶⁷³ fries ²⁷⁵³ dish ⁵⁹³⁶	Rotterdam → Hoogvliet ⁵¹⁶
shamiat-nieuwegein.nl	SHAMIAT	Tomato sauce is a base ingredient for the pide dishes.	International → Middle Eastern ¹¹⁶ Cuisine → Vegetarian ⁶⁹⁷	spinach ¹⁶ pide ⁵⁶ dough ¹²³ shoarma ²⁵⁴ cheese ¹²⁰⁵	Utrecht → Nieuwegein ²²⁶⁴
shoarmapizzeriaistanbulbosporus-helmond.nl	Shoarma Pizzeria Istanbul Bosporus	The website provides various sauces with the dishes.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Food Delivery → Delivery ²²²⁷	turkish ¹⁸ döner ⁶⁷³ plate ⁷⁸⁷ wrap ⁸²⁶	North-Brabant → Helmond ³⁰⁵⁸
simitcidunyasi-denhaag.nl	Simitci Dunyasi Den Haag	The website emphasizes the use of homemade sauces with the various dishes.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	wrap ⁸²⁶ soup ¹⁰⁴³ breakfast ¹⁸²² sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
slagerijpouw-amsterdam.nl	Slagerij Pouw	Various sauces are available to enhance the sandwiches and meat products to taste.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Meat → Meat Products ²¹¹	burger ¹⁴³¹ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
snack-koningvenray.nl	SnacK-Koning	A wide range of sauces are available with the dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	schnitzel ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Limburg → Venray ¹⁶⁰¹
snack-o-rant-jan-wap.nl	Snack-O-Rant 'Jan Wap'	Various sauces are available to accompany the dishes.	Cafes → Dutch Restaurants ¹⁰³¹ Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ menus ²²¹ hamburger ³⁶⁴ fries ²⁷⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbar-azmat.nl	Snackbar Azmat	Various sauces are offered with the orders.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbar-johan-amsterdam.nl	Snackbar Johan	A wide range of sauces are available for the various dishes.	Fast Food → Fries ⁹⁴⁹	turkish pizza ⁶³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackbar-marcouch.nl	Snackbar Marcouch	The website describes a wide range of sauces to accompany the fries and other dishes.	Turkish Cuisine → Fast Food ³²²²	plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
spare-ribshouse-amsterdam.nl	Spare-Ribs House	Various sauces are offered with the dishes.	International → Greek ⁴⁶⁵ Food Delivery → Indonesian ⁵⁰²	combination menu ¹⁰ vegetarian dishes ³⁴ spareribs ²¹³ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
sphinx-alphen-ad-rijn.nl	Sphinx Alphen a/d Rijn	Customers can choose their sauce with their order.	Online Ordering → Delivery Restaurants ⁷² International → Turkish ⁴¹⁶	spareribs ²¹³ plate ⁷⁸⁷ wrap ⁸²⁶ bread ¹⁶²² menu ¹³⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
steakhousepizzeriasedra-haelen.nl	Steakhouse Pizzeria Sedra	The dishes are served with various sauces.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Turkish Cuisine → Fast Food ³²²²	plate ⁷⁸⁷ wrap ⁸²⁶ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Leudal → Haelen ¹³¹
strasgrill-herzogenrath.nl	Straß Grill	Various sauces are available with the dishes.	Cafes → Dutch Restaurants ¹⁰³¹ Regional Cuisine → German ¹⁷	döner ⁶⁷³ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³
super-doner.nl	Super Döner	Multiple sauces can be selected with the dishes.	Fast Food → Döner ²³⁸ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ plate ⁷⁸⁷ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Tilburg ⁸⁷⁵⁹
suradiyadenhaag.nl	Suradiya	The dishes can be seasoned with various sauces to choose from.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Snacks ⁶⁹³	spring rolls ¹⁴¹ roti ³⁰³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
t-pleintje-breda.nl	t Pleintje	Customers can choose from a variety of sauces with their order.	Turkish Cuisine → Fast Food ³²²² Sandwiches & Salads → Italian Cuisine ⁹⁹	shawarma ³³⁵ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
taco-company-hilversum.nl	Taco Company Hilversum	The website describes various types of sauce used in the dishes.	Fast Food → Burgers ⁶⁸⁷ Mexican & South American → Mexican ¹⁵¹	tortilla ²² burrito ⁶² taco ⁹² ingredients ²³⁴⁶ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
tandooriroticorner-barneveld.nl	Tandoori & Roti corner Barneveld	The restaurant offers a chef's secret sauce, which is used in some dishes.	Turkish Cuisine → Takeout Restaurant ⁸¹ Food Delivery → Indian Cuisine ⁵⁴³	tandoori ¹¹⁴ curry ³⁵⁵ rice ⁶³⁵ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Gelderland → Barneveld ²⁷⁸¹
tbevertje-beverwijk.nl	Safi's Plek	A wide range of sauces is available to enhance the dishes.	Fast Food → Burger Restaurants ³⁴⁶	falafel ¹⁰⁸ kapsalon ⁵⁰⁹ chicken ⁹⁴⁴ salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸	North-Holland → Beverwijk ¹⁶⁹⁰
thefareast-amersfoort.nl	The Far East	The website offers a variety of sauces to accompany the dishes.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	spring roll ⁸² noodles ¹⁹¹ satay ³²⁰ soup ¹⁰⁴³ dish ⁵⁹³⁶	Utrecht → Amersfoort ⁸⁰¹¹
toetanchamon-soest.nl	Toetanchamon Soest	Customers can supplement their order with various sauces.	Food Delivery → Delivery ²²²⁷	meat ²⁰⁵⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Utrecht → Soest ²⁰²⁷
turks-specialiteitenrestaurant-turkoise.nl	Turkish Specialties Restaurant Turkoise	All grilled dishes are served with two types of sauce.	Fine Dining & Gastronomy → Specialty Restaurants ³²	rice ⁶³⁵ dish ⁵⁹³⁶ order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
wasabisushitogo-rosmalen.nl	Wasabi sushi to go	A selection of sauces are available with the sushi order.	Japanese → Sushi ⁹⁷¹	nigiri ¹⁴⁶ toppings ¹⁵³ roll ³⁵⁸ sushi ¹⁶⁹⁵ menu ¹³⁸⁵⁶	's-Hertogenbosch → Rosmalen ¹⁰⁵⁹
zombiepizzamorealmere.nl	Zombie Pizza & More	Pizzas are served standard with tomato sauce.	Regional Cuisine → German ¹⁷	dessert ⁴⁹⁶ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Flevoland → Almere ⁷⁷⁶⁵
enricos-apeldoorn.nl	Enrico's Apeldoorn	A characteristic cheese sauce is served as a standard with the fries.	Fast Food → Chicken Dishes ⁹² Cooking & Recipes → Dishes ³³⁵	points ⁶¹² fries ²⁷⁵³ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
grand-sandwich-house.nl	Grand Sandwich House Amsterdam	A wide range of sauces are available to top the dishes.	Sandwiches & Salads → Sandwich Shops ²²⁹	wrap ⁸²⁶ bread ¹⁶²² sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
friterie-ijssalon-emmen-emmen.nl	Friterie IJssalon Emmen	The friterie sells a variety of sauces to accompany the fries.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Takeaway ⁴⁰⁹	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Drenthe → Emmen ³³⁴⁸
frituur-grillroomdalia-lanaken.nl	Frituur-Grillroom Dalia	The website offers a wide range of sauces to top the dishes.	Turkish Cuisine → Fast Food ³²²² Web → Websites ²⁰²⁸	dürüm ⁹⁷ kapsalon ⁵⁰⁹ burger ¹⁴³¹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸
juipenchenchen.nl	Jui Pen Chen Chen	The website describes the various sauces served with the dishes.	Sandwiches & Salads → Snacks ⁶⁹³ Catering & Ready Meals → Chinese Restaurants ³⁰³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
fast-fresh-daily-cuisine-noordwijk.nl	Fast & Fresh Daily Cuisine	The website offers a selection of different sauces, both mild and spicy, that customers can add to their order.	Mexican & South American → Mexican ¹⁵¹	rice bowl ¹⁷ burrito ⁶² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Noordwijk ²⁵⁰⁷
dapperfoodcafe-kampen.nl	Brasserie Flink	The dishes are served with various sauces, including barbecue, pesto, and mayonnaise.	Quick Bites → Snack Bar ⁵⁸⁰ Pastries & Baked Goods → Menus ²²³	chicken ⁹⁴⁴ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Overijssel → Kampen ²¹⁶¹
majo-apeldoorn.nl	Friethuys MAJO	The website offers a variety of sauces to accompany the dishes.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Apeldoorn ⁶⁹⁹⁶
konbu-streetfood.nl	Konbu Streetfood	A diverse assortment of sauces is offered to enhance the dishes.	Quick Bites → Street Food ¹²⁵	dumpling ⁴⁹ ramen ¹⁰⁶ streetfood ¹⁵¹ fries ²⁷⁵³ beer ²⁸⁸⁷	Netherlands → Groningen ²³⁷³⁴
amir-hoekvanholland.nl	Amir Hoek van Holland	The menus contain different types of sauces.	Turkish Cuisine → Fast Food ³²²²	hair salon ⁷¹⁷ meat ²⁰⁵⁵ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Rotterdam → Hoek van Holland ⁵⁴⁰
vatandonerdelft.nl	Vatan Döner Delft	The dishes are served with various sauces.	Fast Food → Fries Restaurants ⁸⁷	döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Delft ⁵³⁰⁹
indiapalace-haarlem.nl	India Palace Haarlem	Dishes are often served with various sauces.	Turkish Cuisine → Takeout Restaurant ⁸¹ Food Delivery → Indian Cuisine ⁵⁴³	tandoori ¹¹⁴ vegetarian ³³⁷ curry ³⁵⁵ chicken ⁹⁴⁴	North-Holland → Haarlem ⁸⁶⁷⁴
baylings-leeuwarden.nl	Baylings	Various sauces are offered with the dishes.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	main course ¹⁰² appetizer ⁵⁵⁶ wrap ⁸²⁶ burger ¹⁴³¹ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
bestellen.deli78.nl	Deli 78	The website sells different types of sauce with the sandwiches.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	reviews ³¹⁷² sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
burgeruno.ordersys.nl	Burger Uno	A wide selection of sauces is available to complement the burgers and snacks.	Fast Food → Burgers ⁶⁸⁷	halal ¹⁶⁵ burger ¹⁴³¹ fries ²⁷⁵³ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbarpontje.nl	CeLa Design	The snack bar serves free med saus (mayonnaise) with the Family Deal.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶	Valkenburg aan de Geul → Valkenburg ⁹²²
renovliestotaal.nl	Renovliestotaal	The website focuses on the saucing of Renovlies wallpaper, a crucial step to achieve a professional and sleek final result.	Interior → Wallpaper ¹⁰⁰¹ Installation & Mounting → Installers ¹⁰⁰⁷	renovlies wallpaper ¹⁴ service area ⁶⁵ installer ⁶⁷⁷	Overijssel → Enschede ⁵⁵⁵⁴
crownstuc.nl	CrownStuc Stukadoor Spacker en Sauzen	Saucing refers to finishing products, such as plasters and decorative plasters, which are used to give walls and ceilings a specific appearance. CrownStuc offers various saucing options for different applications.	Building & Construction → DIY ¹⁰⁰⁷	plaster ²¹⁷⁵ renovation ¹³⁸⁴⁹	Drenthe → Emmen ³³⁴⁸
renovliesexpert.nl	Renovlies Expert	Renovlies is often sauced to guarantee a perfect smooth result and improve adhesion.	Building & Construction → DIY ¹⁰⁰⁷	renovlies ⁸⁸ wallpaper ¹⁷⁵⁶ question ²²⁶¹ quote ¹²⁸⁶³

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.