Navigation:	Title:	Summary:
Start page 782505	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳fairtrade 199	Fair Trade Products & Shops	This compilation features businesses and organizations dedicated to fair trade practices within the country. Included are online stores, physical shops, and initiatives promoting ethically sourced goods, from food and fashion to home decor and gifts.

199 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
fairtradegemeentegouda.nl	Stichting Fairtrade Gouda, Gemeente Gouda	Fairtrade refers to a trading practice aimed at ensuring producers in developing countries receive fair payments and improve their economic situation.	Local Government → Municipality of Gouda 14 Commerce → Fair Trade 191	producer 464 stichting 481 municipality 6837	Delft → Tanthof-West 103
venrayfairtrade.nl	Venray Fairtrade Municipality	Fairtrade is a trading system ensuring products are traded under fair conditions, with producers in developing countries receiving a fair wage.	Initiatives & Collaboration → Initiatives 459 Commerce → Fair Trade 191	ambassador 213 municipality 6837	Limburg → Venray 1601
fairtradeborne.nl	Fairtrade Gemeente Borne	Fairtrade is a trade model focused on sustainable development in developing countries, which Fairtrade Gemeente Borne advocates for.	Commerce → Fair Trade 191 Government & Administration → Local Municipalities 219	shop 6483 municipality 6837 volunteer 8367	Overijssel → Borne 812
teylingenfairtrade.nl	Teylingen Fairtrade municipality	The Teylingen Fairtrade municipality is a municipality that applied for Fairtrade status in 2014 and is committed to fair trade.	International Aid → Development Aid 401 Commerce → Fair Trade 191	bike tour 97 working group 134 partner 4272 municipality 6837	South-Holland → Teylingen 1265
bunnikfairtrade.nl	Stichting Bunnik Fairtrade	The campaign focuses on promoting Fairtrade trade, ensuring that producers in developing countries receive a fair price for their products.	Commerce → Fair Trade 191 Data Analysis → Business Intelligence 1002	campaign 3428 report 4551 municipality 6837	Bunnik → Odijk 232
fairtradehilversum.nl	Fairtrade Hilversum	Fairtrade is a certification and a movement dedicated to fair trade and sustainability around the world.	Commerce → Fair Trade 191 Local & Regional Products → Local Shops 245	campaign 3428 municipality 6837 news 15293	North-Holland → Hilversum 4397
fairtradeheuvelrug.nl	Stichting Fairtrade gemeente Utrechtse Heuvelrug	The Fairtrade Municipality of Utrechtse Heuvelrug is a municipality committed to fair trade and promoting fairtrade products and practices.	Landscape → Utrechtse Heuvelrug 77 Commerce → Fair Trade 191	resident 3245 shop 6483 foundation 6678 municipality 6837	Utrecht → Utrecht Hill Ridge 2054
fairtradegemeenteaalsmeer.nl	Fairtrade Gemeente Aalsmeer	The Fairtrade Municipality of Aalsmeer aims to promote fair trade within the municipality and beyond.	Kitchenware → Tableware 426 Commerce → Fair Trade 191	coffee 3838 municipality 6837	De Ronde Venen → Mijdrecht 700
fortunafairtrade.nl	Fortuna Fairtrade	The company specializes in Fairtrade products, meaning they are committed to fair trade practices.	Commerce → Fair Trade 191 Fashion → Men’s Fashion 690	alpaca 113 sustainable 739 market 2772 clothing 9443	Borger-Odoorn → Exloo 248
fairtradegemeenten.nl	Fairtrade Gemeenten	The website of Fairtrade Gemeenten aims to encourage and assist municipalities in the Netherlands to become Fairtrade by promoting Fair Trade.	Commerce → Fair Trade 191 Data Analysis → Business Intelligence 1002	campaign 3428 municipality 6837 volunteer 8367 sustainability 18451	Netherlands → Utrecht 48901
wereldwinkelzeist.nl	Wereldwinkel Zeist	The store is the Fairtrade store of Zeist, with a wide selection of products meeting strict Fairtrade standards.	Commerce → Fair Trade 191 Gifts → Gift Sets 200	chocolate 911 tea 1146 coffee 3838 store 3901 gift 6442	Utrecht → Zeist 2644
fairtradegemeentekrimpenerwaard.nl	Municipality of Krimpenerwaard	The website describes the municipality's activities as a Fairtrade Municipality, an effort to promote fair trade.	Initiatives & Collaboration → Initiatives 459 Commerce → Fair Trade 191	village 808 campaign 3428 municipality 6837 news 15293	South-Holland → Krimpenerwaard 1840
eerlijkmiddendrenthe.nl	Mintis.nl	The website actively supports the concept of Fairtrade, promoting fair trade and ensuring that producers in developing countries receive a fair price.	Commerce → Fair Trade 191 Food → Local & Regional Products 930	regional products 391 supplier 1725 news 15293	Drenthe → Midden-Drenthe 1343
fairtrade010.nl	Rotterdam Fairtrade	Fairtrade is a trading practice focused on providing fair trade conditions for producers in developing countries, allowing them to receive a reasonable reward for their products.	Local Government → Municipality of Rotterdam 19 Commerce → Fair Trade 191	producer 464 trade 553 living 578 municipality 6837 sustainability 18451	South-Holland → Rotterdam 25048
globalgoalsindeurne.nl	Platform Global Goals Deurne	Fairtrade is a system that ensures producers in developing countries receive a fair price for their products and that the environment is protected. The platform actively works with Fairtrade initiatives in Deurne.	Initiatives & Collaboration → Initiatives 459 Social Issues & Welfare → Social Issues 18544	global goals 17 community 7931 workshop 19325	North-Brabant → Deurne 1329
wereldwinkelpaterswolde.nl	Worldwinkel Paterswolde	All products are produced according to the fairtrade principle, ensuring fair trade and good working conditions.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	staff 3405 gift 6442 collection 7566 event 45199	Tynaarlo → Paterswolde 168
vandewereldheerenveen.nl	Van de Wereld Heerenveen	The shop is exclusively active with Fairtrade products, meaning it is committed to fair trade and sustainability.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	package 6112 gift 6442	Friesland → Heerenveen 2578
fairtradedelft.nl	Fairtrade Delft	Fairtrade Delft promotes products and initiatives that meet Fairtrade standards, prioritizing fair prices and working conditions.	Produce & Vegetables → Vegetables 1070 Business → Economy 36666	climate change 206 consumer 315 supply chain 413 farmer 661 certification 3380
fairtradeoriginal.nl	Fairtrade Original	Fairtrade Original is a food brand committed to fair trade practices.	Branding & Identity → Brand 28 Wholesale → Food Products 303	mission 1000 recipe 5142
lavidavegan.nl	Brinkers Food	La Vida Vegan’s chocolate spreads are Fairtrade certified, guaranteeing ethical sourcing and trade practices.	Chocolate & Sweets → Chocolate 587 Physical Fitness & Exercise → Veganism 63	flavour 20 organic 471 packaging 2236 ingredients 2346
cafesociety.nl	Café Society	We let you taste the flavor of fairtrade and contribute to a better future.	Graphic Design → Art Direction 33 Blogs & Publications → Press Releases 731	slogan 80 campaign 3428 story 8285 brand 17737	Amsterdam → South 1488
meandmorefairfashion.nl	ME & MORE fair fashion	All products at ME & MORE are fairtrade, meaning that workers are paid fairly.	Clothing → Men’s Clothing 1008 Commerce → Fair Trade 191	boutique 133 outfit 239 sale 5930 clothing 9443 accessories 12975	Gelderland → Wageningen 1949
caffeinedealers.nl	Caffeine Dealers	The Fairtrade certification guarantees better trading conditions for coffee farmers and workers.	Entrepreneurship → Social Enterprises 299 Coffee & Tea → Coffee 1064	coffee bar 111 blend 145 coffee beans 452 coffee 3838
fairtradegemeentewijchen.nl	Fairtrade Gemeente Wijchen	The Fairtrade Gemeente Wijchen promotes fair trade by offering farmers and producers a fair price.	Social Organization → Welfare Organizations 173 Commerce → Fair Trade 191	campaign 3428 community 7931 volunteer 8367 sustainability 18451	Gelderland → Wijchen 1579
wereldwinkeltegelen.nl	Worldwinkel Tegelen	The basis of the shop’s operation is fairtrade, where producers are offered a fair price for their work.	Coffee → Specialty Coffee 20 Commerce → Fair Trade 191	gift 6442	Venlo → Tegelen 324
fairtradenoordwijk.nl	Fairtrade Noordwijk	Fairtrade Noordwijk promotes fair trade products and services, ensuring they are produced and sold fairly.	Landscape → Utrechtse Heuvelrug 77 Commerce → Fair Trade 191	world shop 10 library 988 municipality 6837 event 45199	Noordwijk → Noordwijkerhout 1099
wereldwinkelroden.nl	Wereldwinkel Roden	The gift shop only sells Fairtrade products that guarantee a fair price for producers in developing countries.	Supply Chain & Logistics → International Trade 1156 Food → Gifts & Souvenirs 2421	coffee 3838 shop 6483 volunteer 8367	Noordenveld → Roden 621
wereldwinkelrenkum.nl	Wereldwinkel Renkum	All products sold in the shop are Fairtrade, meaning producers receive a fair price.	Commerce → Fair Trade 191 Delicacies & Specialty Foods → Specialty Foods 265	producer 464 gift 6442 shop 6483 event 45199	Gelderland → Renkum 1301
anushkaentea.nl	Anushka & tea	All teas are Fairtrade certified, meaning the farmers receive fair wages.	Nutrition → Herbal Tea 15 Beverages → Tea 829	sri lanka 35 tea 1146
wwwoudenbergmaarn.nl	Worldwinkel Woudenberg-Maarn	All products in the shop are fairtrade, ensuring fair trade practices.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	gift 6442 news 15293 sustainability 18451	Utrecht → Woudenberg 534
paperprints.nl	Paperprints	All cotton bags are Fairtrade certified, representing fair trade and sustainable production.	Commerce → Fair Trade 191 Gifts → Gift Cards 981	greeting card 335 graphic design 2042 illustration 2447	South-Holland → Delft 5309
mockery.nl	Mockery	All products meet fairtrade requirements, ensuring fair working conditions.	Clothing → Vintage Clothing 72	shirt 669 vintage 689 clothing 9443 sustainability 18451	Gooise Meren → Naarden 1154
wereldwinkelsintmichielsgestel-berlicum.nl	Worldwinkel Sint-Michielsgestel & Berlicum	Fairtrade products are sold to ensure the quality and ethical aspects of trade.	Local Government → Municipality of Gouda 14 Commerce → Fair Trade 191	producer 464 gift 6442 volunteer 8367	Sint-Michielsgestel → Berlicum 327
debobtail.nl	de Bobtail	The BOBtail is a product that uses fairtrade ingredients, allowing consumers to contribute to a fairer world.	Blogs & Publications → Press Releases 731 Beverages → Cocktails 144	cocktail 925 flavor 1032 student 7623 news 15293
helpdeboon.nl	Switch Foundation	Fairtrade products are promoted on the website as a way to help coffee farmers and promote fairer trade.	Commerce → Fair Trade 191 Social Issues & Welfare → Social Issues 18544	global goals 17 campaign 3428 coffee 3838	North-Brabant → Eindhoven 11845
rojebonbons.nl	RoJé Bonbons	The chocolate used by RoJé Bonbons is always fairtrade, ensuring fair trade practices.	Chocolate & Sweets → Chocolate 587 Food → Gifts & Souvenirs 2421	bonbons 329 chocolate 911 shop 6483 assortment 7799	Kaag en Braassem → Leimuiden 202
sustainablycee.nl	Sustainably C	The products on the website are fairtrade, meaning they have been produced under fair working conditions.	Consumer & Lifestyle → Sustainable Shopping 32 Commerce → Fair Trade 191	decoration 4085 sustainability 18451
tiendas.diferentes.nl	Tiendas Diferentes	Tiendas Diferentes emphasizes FairTrade products, supporting fair trade practices.	Architecture & Sites → Historical Sites 1951 Local & Regional Products → Local Shops 245	sustainable 739 shop 6483	North-Brabant → Helmond 3058
theblindspot.nl	The Blind Spot	All products are fairtrade certified, ensuring fair working conditions for the makers.	Clothing → Men’s Clothing 1008 Commerce → Fair Trade 191	scarf 387 t-shirt 698 collection 7566 clothing 9443 sustainability 18451
neutralorganic.nl	Neutral Organic	All clothing is fairtrade certified, guaranteeing fair working conditions.	Clothing → Tops 143 Clothing → Sustainable Clothing 21	cotton 365 certification 3380 clothing 9443 sustainability 18451	Gooise Meren → Naarden 1154
floz.nl	Floz Design	All products are produced under fairtrade conditions.	Kitchenware → Tableware 426 Commerce → Fair Trade 191	tableware 613 decor 945 kitchen 6443 sustainability 18451	Netherlands → Zeeland 15493
wereldwinkelgrave.nl	Wereldwinkel Grave	The products are all Fairtrade certified, ensuring fair prices and working conditions.	Commerce → Fair Trade 191 Africa → Tanzania 39	artisan 94 scarf 387 gift 6442
chocoxd.nl	ChocoXD B.V.	All products are supplied as fairtrade certified, meaning they meet ethical and social standards.	Chocolate → Handcrafted Chocolate 12	ship 5103 gift 6442
wereldwinkelleeuwarden.nl	Worldwinkel Leeuwarden	The products are all Fairtrade, ensuring fair prices for producers.	Retail & Commerce → Commerce 8244 Entrepreneurship & Business → Corporate Social Responsibility 215	jewelry 4599 sustainability 18451	Friesland → Leeuwarden 6068
wereldwinkelzierikzee.nl	Worldwinkel Zierikzee	The shop is specifically focused on selling fairtrade products, meaning that producers in developing countries are treated fairly.	Commerce → Fair Trade 191	producer 464 shop 6483 assortment 7799	Schouwen-Duiveland → Zierikzee 705
wereldwinkelgouda.nl	Wereldwinkel Gouda	The products are characterized by their fairtrade status, ensuring fair trade practices.	Beverages → Tea 829 Retail & Commerce → Goods 20	cart 381 gift 6442 sustainability 18451	South-Holland → Gouda 3521
yfashion.nl	yfashion.nl	The website informs about the benefits of choosing Fairtrade products.	Local & Regional Products → Local Shops 245 Fashion → Men’s Fashion 690	shoe size 16 the hague 312 skincare 1972 fashion 2212	South-Holland → The Hague 19898
heerlijkheerenveen.nl	H(eerlijk) Heerenveen	The website (H)eerlijk Heerenveen is a working group dedicated to promoting sustainability and fair trade within the municipality of Heerenveen, aiming to raise awareness and expand the implementation of fair trade and sustainable practices.	Commerce → Fair Trade 191 Gifts → Gift Sets 200	certificate 1036 municipality 6837 volunteer 8367 sustainability 18451	Friesland → Heerenveen 2578
jkvenlo.nl	Jongerenkerk Venlo	The Fairtrade working group and the focus on Fairtrade hallmarks are important for the church’s mission.	Scouting → Scouting Groups 257	anniversary 670	Limburg → Venlo 4158
bon-bien.nl	BonBien Chocolaterie	The company exclusively uses fairtrade chocolate from Callebaut, focusing on fair prices and sustainability.	Chocolate → Bonbons 42	cacao 140 bonbons 329 chocolate 911 workshop 19325	Dinkelland → Ootmarsum 393
wereldwinkelmaassluis.nl	Worldwinkel Maassluis	The shop places fairtrade as a core value, where producers receive a fair price.	Commerce → Fair Trade 191 Gifts → Gift Sets 200	gift package 530 gift 6442 assortment 7799	South-Holland → Maassluis 988
fairtradetomaten.nl	Desert Joy	The tomatoes are Fairtrade certified, ensuring ethical and sustainable production standards.	Vegetables → Tomatoes 32 Commerce → Fair Trade 191	desert 41 tomato 144 logistics 3257
lettersvannaomi.nl	Letters! by Naomi	The company uses fairtrade chocolate, ensuring ethically responsible production.	Chocolate & Sweets → Chocolate 587 Food → Gifts & Souvenirs 2421	chocolate letter 18 online shop 1310 ship 5103	Katwijk → Rijnsburg 475
bradleys.nl	Bradley’s	The tea is Fairtrade certified, which positively impacts social and economic impact.	Beverages → Tea 829 Hospitality → Suppliers 1057	tea 1146 packaging 2236 concept 3338 sustainability 18451
puroathome.nl	Puro Koffie	Each Puro coffee is marked with the Fairtrade label, guaranteeing ethical trade and sustainability.	Social Impact → Social Responsibility 57 Coffee & Tea → Coffee 1064	rainforest 20 farmer 661 coffee 3838
tavdesign.nl	Tav Design	All products are manufactured under fairtrade conditions, which means attention is paid to fair trade and sustainability.	Woodwork → Tables 814 Retail & Commerce → Commerce 8244	wine rack 29 clock 151 home accessories 603 design 27202
fairenmeer.nl	Fair&Meer	The focus is on offering products made according to fairtrade principles, where producers are paid fairly.	Gifts → Gift Cards 981 Food → Gifts & Souvenirs 2421	sustainable 739 shopping cart 1521 gift 6442
wereldwinkelspakenburg.nl	Worldshop Bunschoten-Spakenburg	The store exclusively sold fairtrade products, meaning the products were sustainably and ethically produced.	Commerce → Fair Trade 191	world shop 10	Bunschoten → Bunschoten-Spakenburg 382
zimbabwe-fairtrade.nl	Amandla	Fairtrade is the core value of Amandla, where fair trade is central and artists receive a fair compensation.	Commerce → Fair Trade 191	sculptor 146 sculpture 1440 artist 5745
wereldwinkel-elst.nl	Wereldwinkel Elst	The shop exclusively sells Fairtrade products, meeting strict requirements regarding fair trade and sustainability.	Decor & Furnishings → Home Stores 932 Food → Gifts & Souvenirs 2421	dopper 10 food products 56 volunteer 8367	Overbetuwe → Elst 886
scheefwear.nl	Scheefwear Store	All sold clothing meets the Fairtrade Textile Production Standard certification, ensuring ethical labor practices.	Clothing → Activewear 642	surf 107 skating 314 collection 7566 clothing 9443 accessories 12975
thecrystalconnector.nl	The Crystal Connector	A key part of the online shop is the selection of Fairtrade products, including jewelry.	Jewelry → Gemstones 451	gemstone 856 healing 1148 online shop 1310 jewelry 4599	Alphen aan den Rijn → Hazerswoude-Rijndijk 235
tjai.nl	Tjai	All products are fairtrade imported, which highlights the ethical origin of the coffee and tea.	Coffee → Coffee Beans 178 Beverages → Tea 829	roast 60 coffee beans 452 tea 1146 coffee 3838	North-Holland → Aalsmeer 1710
icarecoffee.nl	I Care Coffee	All coffee bean blends are certified Fairtrade.	Social Issues → Social Organization 13315 Coffee & Tea → Coffee 1064	beans 185 coffee machine 415 society 1376 coffee 3838
morethangifts.nl	More Than Gifts	More Than Gifts emphasizes offering fairtrade products.	Gifts & Souvenirs → Gift Items 342 Collaboration & Networking → Business Relations 51	corporate gift box 10 christmas market 163 corporate gift 425 webshop 8648 sustainability 18451
ecotex.nl	Ecotex	Ecotex offers fairtrade clothing and textiles, ensuring fair working conditions.	Clothing → Men’s Clothing 1008 Clothing → Activewear 642	organic 471 textile 1421 fabric 1644 clothing 9443
sarana.nl	Sarana	Sarana is a Fairtrade company that sells home accessories and gift items and strives for a fair future and the improvement of producers' livelihoods.	Gifts & Souvenirs → Gift Items 342 Retail & Commerce → Commerce 8244	gift items 172 home accessories 603 collection 7566	Gelderland → Culemborg 1264
bonomi-koffie.nl	Bonomi Koffie	Bonomi Koffie emphasizes the fairtrade quality of its products, which is appealing to consumers.	Coffee → Coffee Beans 178 Coffee → Specialty Coffee 20	tasting packs 10 coffee beans 452 flavor 1032 coffee 3838
chocolaterie.nl	Chocolaterie de Lelie	De Lelie focuses on fairtrade cocoa, because responsible handling of people and nature is important.	Chocolate & Sweets → Chocolate 587 Gifts → Gift Cards 981	bonbons 329 gift card 582 chocolate 911 ice cream 1000 workshop 19325	Pijnacker-Nootdorp → Nootdorp 565
greenpicnic.nl	GreenPicnic	The shop offers a significant selection of Fairtrade products.	Woodwork → Tables 814 Kitchenware → Tableware 426	eco 13 tableware 613 packaging 2236 bag 2399
clipper-teas.nl	Clipper Teas	Clipper Teas is a recognized Fairtrade tea brand committed to fair trade and the social development of producers.	Coffee → Coffee Beans 178 Beverages → Tea 829	blend 145 organic 471 tea 1146 sustainability 18451
fairtalezutphen.nl	Fair Tale	The store offers products that meet fairtrade standards.	Local & Regional Focus → Local Businesses 1077 Blogs & Publications → Press Releases 731	lifestyle 2918 brand 17737 sustainability 18451	Gelderland → Zutphen 2690
wereldwinkelheerde.nl	Wereldwinkel Heerde	The shop offers only Fairtrade products.	Tourism → Tourist Information 124 Food → Gifts & Souvenirs 2421	tourist 58 gift 6442 shop 6483 municipality 6837	Gelderland → Heerde 750
tea-of-life.nl	Tea of Life	The tea is fairtrade certified, ensuring fair trading practices.	Beverages → Tea 829 Coffee & Tea → Coffee 1064	sri lanka 35 impact 926 tea 1146 community 7931 sustainability 18451
koffietheeleutje.nl	Leutje Koffie en Thee	All tea and coffee beans sold by Leutje Koffie en Thee are Fairtrade certified.	Beverages → Tea 829 Coffee & Tea → Coffee 1064	tea 1146 coffee 3838 store 3901 webshop 8648 accessories 12975	Almere → Almere Haven 216
elvee.nl	Elvee Holland B.V.	Elvee exclusively uses 100% Fairtrade cacao in the production of its products.	Chocolate & Sweets → Chocolate 587	confectionery 41 bonbons 329 chocolate 911 assortment 7799 workshop 19325
langemensenforum.nl	Lange mensen forum	The website emphasizes the importance of fairtrade clothing brands and sustainable wardrobes.	Blogs & Publications → Press Releases 731 Gifts → Gift Cards 981	beauty salon 547 style 2348 hair 3014 clothing 9443 accessories 12975	South-Holland → Rotterdam 25048
holybeans.nl	Holy Beans	All coffee beans are fairtrade certified, meaning farmers receive a fair price.	Coffee → Coffee Roasters 23 Hospitality → Suppliers 1057	roast 60 beans 185 subscription 3287 coffee 3838 sustainability 18451	Gelderland → Nijmegen 9384
fairsaturday.nl	Fair Saturday	Fairtrade products and fair trade are central to the philosophy of Fair Saturday.	Commerce → Fair Trade 191	online store 905 clothing 9443 sustainability 18451
missbean.nl	Miss Bean	All coffee products offered by Miss Bean are fairtrade and organic.	Coffee → Coffee Beans 178 Beverages → Tea 829	barista 146 beans 185 coffee 3838 event 45199	Midden-Groningen → Kropswolde 68
trendymeiden.nl	Trendymeiden	The blog describes what fairtrade products are and why they are a good choice.	Wellness → Fashion 17441	beauty 684 fashion 2212 lifestyle 2918 seo 3707 shop 6483
beterechocolade.nl	Betere Chocolade	The 'fairtrade' label is presented as an important criterion for choosing fair chocolate.	Commerce → Fair Trade 191 Essential → Food 47999	cocoa 28 consumer 315 chocolate 911
dewereldwinkels.nl	Wereldwinkel Arnhem-Velp	The shop sells fairtrade products and operates on a volunteer basis, emphasizing fair trade practices.	Decor & Furnishings → Home Stores 932 Food → Gifts & Souvenirs 2421	dopper 10 glassware 208 gift 6442 story 8285	Rheden → Velp 700
wereldwinkel7bergen.nl	Wereldwinkel Zevenbergen	All products are sourced according to fairtrade and fairmade standards.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	tea 1146 donation 5110	Moerdijk → Zevenbergen 502
wereldwinkel-pijnacker.nl	Wereldwinkel Pijnacker	The shop is based on the principle of fairtrade, where producers receive a fair price.	Kitchenware → Tableware 426 Food → Gifts & Souvenirs 2421	food 3872 jewelry 4599 gift 6442 volunteer 8367	Pijnacker-Nootdorp → Pijnacker 788
afriboutique.nl	Afri Boutique	Afri Boutique chooses beauty in products, the production process and business practices, with fair prices for craftsmanship.	Jewelry → Handmade Jewelry 862 TravelContent → Travel Guides 938	wall art 46 rug 299 jewelry 4599 interior 8093
coffeemood.nl	CoffeeMood	CoffeeMood emphasizes the use of fairtrade coffee beans, directly imported from local farmers.	Beverages → Tea 829 Coffee & Tea → Coffee 1064	coffee bar 111 barista 146 coffee 3838 event 45199	Netherlands → Utrecht 48901
chocolaterienoes.nl	Chocolaterie Noes	The chocolate is made using Belgian fairtrade chocolate.	Chocolate → Chocolate Shops 55 Events → Places 1219	bonbons 329 chocolate 911 bar 1216 box 1982 logo 4660	Velsen → IJmuiden 1109
wereldwinkelepe.nl	Wereldwinkel Epe	Fairtrade stands for fair trade, where the production and sale of products are focused on improving the living conditions of producers in developing countries.	Commerce → Fair Trade 191	greeting card 335 volunteer 8367 garden 13129	Gelderland → Epe 1335
wereldwinkellunteren.nl	Worldwinkel Lunteren	The Fairtrade concept is central, ensuring a fair price and sustainable trading relationships.	Commerce → Fair Trade 191 Decor & Furnishings → Home Stores 932	consumer 315 producer 464 home accessories 603 gift 6442	Ede → Lunteren 730
wereldwinkelbarendrecht.nl	Wereldwinkel Barendrecht	Fairtrade products are sold in the shop, with a focus on fair trade and supporting producers in developing countries.	Food → Local & Regional Products 930 Food → Gifts & Souvenirs 2421	regional products 391 gift certificate 646 assortment 7799	Albrandswaard → Rhoon 448
choco-break.nl	Chocobreak	Chocobreak exclusively uses fairtrade chocolate, ensuring that cocoa farmers receive a fair price.	Commerce → Fair Trade 191 Chocolate & Sweets → Chocolate 587	bonbons 329 chocolate 911 recipe 5142 workshop 19325	Gelderland → Nijmegen 9384
namabox.nl	Namabox.nl	Only Fairtrade Callebaut chocolate is used in the production of Nama Box chocolates.	Chocolate → Handcrafted Chocolate 12	chocolate 911 order 6912 webshop 8648	South-Holland → The Hague 19898
printjekleding.nl	Printjekleding.nl	Printjekleding.nl values FairTrade products and selects high-quality materials.	Clothing → Workwear 1001 Commerce → Fair Trade 191	promotional gifts 173 textile 1421 logo 4660 print 5511 clothing 9443	Velsen → Santpoort-Noord 606
villaschaap.nl	Villa Schaap	The company promotes and sells products with a fairtrade certification, ensuring fair trade practices.	Crafts → Handmade 1147 Commerce → Fair Trade 191	wool 489 sustainable 739 woman 1419 collection 7566
wereldwinkelborne.nl	Wereldwinkel Borne	All products in the shop are Fairtrade, ensuring fair trade with producers in developing countries.	Social Issues → Development Cooperation 62	food products 56 water bottle 87 jewelry 4599 gift 6442	Overijssel → Borne 812
wereldwinkelleidschendam-voorburg.nl	Wereldwinkel Leidschendam-Voorburg	All products are sold according to FairTrade principles, making trade fairer and more sustainable.	International Regions → International Culture 193 Food → Gifts & Souvenirs 2421	figurine 99 incense 144 instrument 1295 assortment 7799	South-Holland → Leidschendam-Voorburg 2151
wereldwinkelvarsseveld.nl	Wereldwinkel Varsseveld	All products in the shop are Fairtrade certified, meaning they are produced ethically and sustainably.	Social Issues → Social Organization 13315 Food → Gifts & Souvenirs 2421	relationship gift 43 earthenware 57 gift package 530 gift card 582	Oude IJsselstreek → Varsseveld 301
kazuri.nl	Kazuri & More	Kazuri operates under fair trade principles, giving working women a better life.	Jewelry → Handmade Jewelry 862 Commerce → Fair Trade 191	clay 495 woman 1419 jewelry 4599 collection 7566	Amsterdam → East 1423
agrofair.nl	AgroFair Europe B.V.	The website is for AgroFair, a producer and importer of Fairtrade and organic bananas, committed to sustainable sourcing and improving the lives of banana growers.	Commerce → Fair Trade 191 Produce & Vegetables → Vegetables 1070	banana 42 organic 471 sustainability 18451
goodtogive.nl	Good to Give	Fairtrade is a core value of Good to Give, with fair trade at its center.	Consumer & Lifestyle → Sustainable Shopping 32 Commerce → Fair Trade 191	promotional gifts 173 gift 6442 story 8285 sustainability 18451
wereldwinkel-dordt.nl	Wereldwinkel Dordrecht	The shop is specifically focused on selling products that meet the criteria of fair trade, which stands for fair trade and good working conditions.	Commerce → Fair Trade 191 Gifts → Gift Sets 200		South-Holland → Dordrecht 4531
duurzaamhellendoorn.nl	Duurzaam Hellendoorn	FairTrade activities contribute to fair trade and sustainable production.	Government & Administration → Local Municipalities 219 Initiatives & Projects → Local Initiatives 1001	repair cafe 28 ambassador 213 municipality 6837	Overijssel → Hellendoorn 1217
fairtradecadeaubon.nl	Fairtrade Cadeaubon BV	The website offers an online gift card redeemable for thousands of fair trade products from various brands.	Commerce → Fair Trade 191 Gifts → Gift Cards 981	tea bag 15 skincare products 100 gift card 582 bag 2399
wereldwinkelsassenheim.nl	Wereldwinkel Sassenheim	The shop promotes fair trade and ensures that producers in the third world receive a fair wage.	Social Organization → Welfare Organizations 173 Commerce → Fair Trade 191	gift 6442 shop 6483 assortment 7799	Teylingen → Warmond 384
wereldwinkelzuidhorn.nl	Fair van Ver Zuidhorn	The shop emphasizes fair trade and the offering of products from Fair Trade organizations.	Social Organization → Welfare Organizations 173 Economy → Retail & Commerce 9941	ceramics 1271 card 1975 jewelry 4599 shop 6483	Westerkwartier → Zuidhorn 286
shantiboutique.nl	Shanti Boutique	Shanti Boutique is a fairtrade business committed to fair trade and sustainability.	Jewelry → Gemstones 451 Spirituality → Tarot 258	symbol 149 chakra 278 yoga 3704 jewelry 4599
wereldwinkelbergen.nl	Worldwinkel Bergen NH	Worldwinkel Bergen exclusively sells products that comply with the international Fair Trade standard, ensuring fair payment to producers.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	coffee 3838 gift 6442 foundation 6678	North-Holland → Bergen 2009
wereldwinkelreeuwijk.nl	Wereldwinkel Reeuwijk	The concept of Fairtrade is emphasized, with a guaranteed minimum price and high standards for sustainability.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	gift voucher 548 chocolate 911 sustainability 18451	Amersfoort → Hooglanderveen 125
fairtradeshopweert.nl	Fair Trade Shop Weert	The shop is specifically focused on offering products with the Fairtrade certification.	Commerce → Fair Trade 191 Gifts → Special Gifts 16	culture 3922 gift 6442 volunteer 8367 sustainability 18451	Limburg → Weert 2030
wereldwinkelhavelte.nl	Worldwinkel Havelte	The shop’s operations are based on fairtrade principles.	Commerce → Fair Trade 191 International Regions → International Culture 193	food 3872 gift 6442 volunteer 8367 collaboration 16036	Westerveld → Havelte 228
tiktak-segafredo.nl	Tiktak/Segafredo Zanetti Nederland b.v.	The website of Tiktak/Segafredo Zanetti Nederland B.V. presents the history, values, and products of the coffee companies Tiktak and Segafredo, with an emphasis on sustainability, fair trade, and traditional quality.	Coffee & Tea → Coffee 1064	italy 263 tradition 736 coffee 3838 sustainability 18451	North-Holland → Amsterdam 41253
sasdesign.nl	Sas Design Jewelry	Sas Design Jewelry operates on fair trade principles, ensuring ethical sourcing and production.	Jewelry → Handmade Jewelry 862 Jewelry → Goldsmiths 319	india 68 silver 479 gold 805 jewelry 4599	North-Holland → Amsterdam 41253
wereldwinkelonline.nl	Velua ™	The products are made as much as possible through fair trade or sustainable production.	Commerce → Fair Trade 191 Commerce → Sustainability 14	decoration 4085 ship 5103 price 8328
kickinsite.nl	Kickinsite	The article on Fair Trade at Wereldwinkel in Houten describes the principles and products of this concept.	Transportation → Motorcycle Travel 105	motorcycle trip 15 driving school 696 notary 791 workwear 851	Smallingerland → Drachten 2052
mundomi.nl	Mundomi	Mundomi is a fair trade importer, which is a core value of the company and highlighted through a 'check' icon on the website.	Gifts & Flowers → Gift Retail 71	decoration 4085 wood 4153 gift 6442
uwsieraad.nl	Atelier Arte D'Oro	A key aspect of the atelier is the use of fair trade materials in the production of the jewelry.	Jewelry → Goldsmiths 319 Economy → Retail & Commerce 9941	ring 800 gold 805 atelier 1417 jewelry 4599	Gelderland → Nijmegen 9384
wereldwinkelaalsmeer.nl	Wereldwinkel Aalsmeer	All products are certified fair trade, which means they are made with respect for people and the environment.	Local & Regional Products → Local Shops 245 Supermarkets & Grocery → Food Stores 1058	trade 553 shop 6483 assortment 7799	North-Holland → Aalsmeer 1710
chocolade-winkels.nl	Chocolade-Winkels.nl	Fair trade chocolate plays an important role, with explanations about its impact and benefits.	Blogs → Food Blogs 246 Chocolate & Sweets → Chocolate 587	vegan 508 chocolate 911 recipe 5142 brand 17737
lailasboutique.nl	Lailasboutique	Lailasboutique sells exclusively fair trade products.	Upholstery & Fabrics → Cushions 245 Women’s Clothing → Blouses 74	batik 31 cushion 823 carpet 840 clothing 9443 accessories 12975
amorcollections.nl	Amor Collections	The scarves are sold as Fair Trade, indicating that they are produced under fair working conditions.	Accessories → Scarves 155 International Regions → International Culture 193	scarf 387 story 8285 design 27202	North-Brabant → Vught 1230
mamenda.nl	Mamènda	Mamènda operates on Fair Trade principles, ensuring that products are produced ethically and the makers receive fair compensation.	Africa → Ghana 22 Commerce → Fair Trade 191	ghana 58 shop 6483 workshop 19325
kashmirheritage.nl	Kashmir Heritage	Kashmir Heritage operates exclusively on a fair trade basis, ensuring fair prices are paid.	Crafts → Textiles 1280 Commerce → Fair Trade 191	shawl 49	Utrecht → Amersfoort 8011
hennepmade.nl	Hennep Made	All products are made according to fair trade principles, highlighting social and ethical responsibility.	Nutrition → Herbal Tea 15 Commerce → Fair Trade 191	hemp 65 clothing 9443 sustainability 18451
producentenreizen-kenia.nl	Producentenreizen Kenia	The website focuses on trips geared towards fair trade, where visitors directly interact with the producers of the products.	Africa → Kenya 38 Commerce → Fair Trade 191	kenya 62 safari 181 craftsman 188
hulpwijzerouderamstel.nl	Hulpwijzer Ouder-Amstel	The website emphasizes fair trade and the principles of fairness and respect for the environment.	Social Organization → Welfare Organizations 173 Social Issues → Gender Equality 75	work 3122 housing 4378 finance 5341 family 6462 care 12338	Ouder-Amstel → Ouderkerk aan de Amstel 410
zawadinamar.nl	Zawadi NaMar	All products are made according to Fair Trade standards, ensuring fair prices for African artisans.	Beverages → Tea 829 Commerce → Fair Trade 191	jewelry 4599 gift 6442 travel 7210 sustainability 18451
dewittelotus.nl	De Witte Lotus	De Witte Lotus sells products from fair trade organizations.	Arts → Decorative Arts & Crafts 825	henna 74 mosaic 213 jewelry 4599 clothing 9443
wereldwinkelwolvega.nl	Wereldwinkel Wolvega	The producers receive a fair price for their products, which contributes to a better future for them.	International Aid → Developing Countries 10 International Regions → International Culture 193	coffee 3838 assortment 7799 sustainability 18451	Weststellingwerf → Wolvega 524
ikwinkeleerlijk.nl	Ēerlijk Wateringen	The shop exclusively works with fair trade products, ensuring that producers in developing countries are paid fairly for their labor and products.	Coffee → Coffee Roasters 23 Commerce → Fair Trade 191	tea 1146 coffee 3838 decoration 4085 gift 6442 assortment 7799
amandla-fairtrade.nl	Amandla	The website of Amandla is an online store selling fairtrade serpentine sculptures from Zimbabwe and supporting local artists.	Commerce → Fair Trade 191 Historical & African Art → African Art 10	artist 5745 webshop 8648
kaarsentempel-webshop.nl	De Kaarsentempel	The website also sells candles with the Fair Trade label.	Decor & Furnishings → Candles 294	candle 792 recycling 1036 theme 4015 gift 6442 workshop 19325	North-Brabant → Tilburg 8759
karakter-denbosch.nl	Karakter Den Bosch	The shop focuses on selling products that are produced fairly.	Commerce → Sustainability 14 Household & Cleaning → Household Goods 1642	fashion 2212 collection 7566 home 7976 sustainability 18451	North-Brabant → 's-Hertogenbosch 8868
jwsupport.nl	JW Support	Fair trade is one of the principles that JW Support promotes to foster sustainable and fair trade.	International Aid → Developing Countries 10 Special Needs & Support → Educational Support 2195	donation 5110 volunteer 8367 child 11566 education 13471
goldenoasis.nl	Golden Oasis	Fair trade is a core value of the brand, with attention to ethical production and fair wages.	Jewelry → Handmade Jewelry 862 Commerce → Sustainability 14	charm 93 pendant 182 earrings 578 sustainable 739 jewelry 4599
wild-souls.nl	Wild-Souls	The webshop emphasizes a commitment to fair trade and a Fair Trade guarantee when purchasing gemstones.	Jewelry → Gemstones 451	fragrance 395 gemstone 856 reviews 3172 jewelry 4599
wereldwinkeldoetinchem.nl	Worldwinkel Doetinchem	The shop promotes and practices fair trade to support producers in developing countries.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	netherlands 1376 food 3872 gift 6442 shop 6483	Gelderland → Doetinchem 2706
brandstofkoffie.nl	Brandstof Koffie	The company emphasizes the principles of fair trade in its business philosophy.	Coffee → Coffee Roasters 23	roastery 55 coffee 3838 shop 6483 sustainability 18451	South-Holland → Goeree-Overflakkee 1757
wereldwinkelroosendaal.nl	Wereldwinkel Roosendaal	All products in the shop are fair trade, meaning they are produced according to ethical and sustainable principles.	Commerce → Fair Trade 191 Gifts & Souvenirs → Gift Items 342	christmas 320 craft 538 volunteer 8367	North-Brabant → Roosendaal 2677
manavta.nl	Manavta	All of Manavta's products are fair trade, meaning they meet the requirements of the World Fair Trade Organization.	Crafts → Handmade 1147 Commerce → Fair Trade 191	hemp 65 nepal 81 artisan 94 incense 144 jewelry 4599
aalaniwoonaccessoires.nl	Aalani	All products are crafted with fair labor practices and fair wages for the producers.	Upholstery & Fabrics → Cushions 245	wall decoration 101 animal 2908 decoration 4085 accessories 12975
reisroess.nl	Reisbureau & WAAR	A key element of the offering is fair trade products, ensuring a fair income for artisans in developing countries.	TravelBrands → Travel Agencies 1840 Food → Gifts & Souvenirs 2421	bracelet 1053 bag 2399 gift 6442 travel 7210 design 27202
wereldwinkelvries.nl	Stichting Wereldwinkel Vries	The goal of the shop is to raise awareness for fair trade.	Commerce → Fair Trade 191	world shop 10 promotion 2062 environment 4873 volunteer 8367	Tynaarlo → Vries 168
jlfconcepts.nl	JLF Concepts B.V.	JLF Concepts B.V. is an experienced producer of bags, felt products and plush products, with a focus on fair trade and sustainability.	Commerce → Fair Trade 191 Manufacturing → Textile Production 36	plush 66 felt 208 bag 2399	South-Holland → Noordwijk 2507
wereldwinkelhuissen.nl	Wereldwinkel Huissen	Fair trade products are sold to promote poverty reduction and ensure producers receive a fair price.	Organizations → Interest Groups 43 Commerce → Fair Trade 191	producer 464 shop 6483	Lingewaard → Huissen 537
cerroazul.nl	Cerro Azul Food BV	Cerro Azul Food BV is a wholesale company specializing in fair trade products, importing and distributing these products exclusively in the Netherlands.	Beverages → Tea 829 Chocolate & Sweets → Chocolate 587	honey 432 chocolate 911 distribution 1011 tea 1146 coffee 3838	Overijssel → Almelo 2696
deboeddha.nl	varada.nl	The website sells dreamcatchers, originating from the Ojibweg and Chippewa tribes of North America, with a focus on fair-trade products from Bali.	Jewelry → Gemstones 451 Crafts → Handmade 1147	dreamcatcher 23 web 80 bali 109 decoration 4085
fairehandel.nl	FAIREHANDEL.NL	FAIREHANDEL.NL is a website that informs consumers about and directs them to products produced ethically and sustainably, with a focus on fair trade.	Local Government → Municipality of Gouda 14 Commerce → Fair Trade 191	producer 464 environment 4873
wereldwinkels.nl	Stichting Wereldwinkel.Nu	The website of Worldwinkel Nederland provides information about the organization and its activities focused on fair trade and promoting sustainable development goals.	Non-Profit Organizations → Development Organizations 46 Commerce → Fair Trade 191	trademark 97 poverty 291 environment 4873
sari-fairfashion.nl	Sari Fair Fashion	Sari Fair Fashion is a store specializing in fair trade clothing, sustainable garments, and accessories with a focus on respect for people and the environment.	Coffee → Specialty Coffee 20 Commerce → Fair Trade 191	certification 3380 assortment 7799 clothing 9443 sustainability 18451	De Fryske Marren → Joure 689
actionaid.nl	ActionAid Nederland	ActionAid Nederland is an organization committed to combating inequality and supporting people in the Global South, with a focus on women's rights and fair trade.	Social Organization → Humanitarian Organizations 1135 Social Issues → Gender Equality 75	humanitarian aid 14 empowerment 115 campaign 3428
madat.nl	Madat Fair Treasures	The website of Madat Fair Treasures is an online store and a local aid organization that promotes fair trade practices and sells handcrafted products from artisans in Nepal and other regions, while also providing support to local communities.	Jewelry → Handmade Jewelry 862 Commerce → Fair Trade 191	homeware 18 chimes 18 handcraft 79 lifestyle 2918 accessories 12975
wereldwinkelsnederland.nl	World Shops Netherlands	World Shops Netherlands is an organization supporting world shops and promoting fair trade.	Social Issues → Social Organization 13315 Commerce → Fair Trade 191	world shop 10 participant 1934
livconceptstore.nl	LIV CONCEPTSTORE	LIV Concept Store is an online shop and store offering handmade and fair trade products, primarily from Morocco and Bali, with the aim of contributing positively to the world.	Commerce → Fair Trade 191 Decor & Furnishings → Home Stores 932	morocco 95 home decor 400 online shop 1310	's-Hertogenbosch → Rosmalen 1059
sandrachocolade.nl	Sandra Chocolade	The Sandra Chocolade website offers a range of handcrafted chocolate products, including bonbons, truffles, bars, and sugar confectionery, with a focus on quality ingredients and chocolate-making workshops.	Commerce → Fair Trade 191 Chocolate & Sweets → Chocolate 587	bonbons 329 chocolate 911 workshop 19325	Velsen → Velsen-Noord 181
wilmasfairtradecentrum.nl	Wilma’s Fair Trade center	Wilma’s Fair Trade center is a wholesale business that imports and sells products according to Fair Trade principles, aiming to improve the livelihoods of producers in developing countries.	Social Issues → Social Organization 13315 Commerce → Fair Trade 191	producer 464 home accessories 603
heinshome.nl	HeinsHome	The website HeinsHome is a shop offering unique home accessories and gifts, particularly handcrafted items from various countries, often adhering to the Fair Trade principle.	Commerce → Sustainability 14 Commerce → Fair Trade 191	handicraft 18 home accessories 603 gift 6442 collection 7566	North-Holland → Hilversum 4397
esgii.nl	Esgii	The website esgii.nl sells handmade felt slippers and gloves from Mongolia, with a focus on sustainability and fair trade practices.	Shoes → Slippers 54 Commerce → Fair Trade 191	slippers 161 felt 208 gloves 292 shoes 2699
alatara.nl	à la Tara	à la Tara is an online spiritual gift shop offering a wide range of products such as gemstones, jewelry, and singing bowls.	Food → Gifts & Souvenirs 2421	singing bowls 119 spiritual 165 gemstone 856 gift 6442
whatabeauty.nl	what a beauty.nl	what a beauty.nl is an online blogmagazine run by Gigi, covering a variety of topics including travel, fashion, skincare, fair trade, and career paths.	Local & Regional Products → Local Shops 245 Wellness → Fashion 17441	hair salon 717 skincare 1972 fashion 2212 travel 7210
ignoti.nl	Ignoti	Ignoti is a website that sources and sells exclusively hand-woven fabrics from African artisans.	Textiles → Fabrics 371 Regions → Africa 713	artisan 94 weave 118 africa 150 fabric 1644
cafedelmar.nl	Café del Mar	Café del Mar is a company specializing in the sale and rental of professional coffee machines and Fair Trade coffee for businesses and the hospitality industry.	Coffee → Coffee Beans 178 Business → Industry 36977	coffee machine 415 hospitality 3491 coffee 3838	Bergen → Schoorl 481
wereldwinkeldelft.nl	Wereldwinkel Delft	Wereldwinkel Delft is an ideal shop dedicated to fair trade and supporting producers in developing countries.	Commerce → Fair Trade 191 Commerce → Sustainability 14	shop 6483 volunteer 8367	South-Holland → Delft 5309
jansje.nl	The World of Jansje	The World of Jansje is a gift shop and lunchroom that sells sustainable products from around the world, emphasizing fair trade.	Cafes & Lunch → Lunchroom 446 Food → Gifts & Souvenirs 2421	lunchroom 312 sustainable 739 gift 6442 garden 13129	North-Holland → Haarlem 8674
countingflowers.nl	Counting Flowers	Counting Flowers is a webshop that sells unique Fair Trade products, primarily scarves and tablecloths, handcrafted from natural materials.	Accessories → Scarves 155	tablecloth 109 natural materials 131 scarf 387 education 13471
tresbien.nl	Très Bien	Très Bien is a nut and chocolate shop located in Groningen that offers a wide variety of products, including bonbons, chocolate, nuts, and gift packages.	Chocolate & Sweets → Chocolate 587 Gifts → Gift Sets 200	bonbons 329 nuts 417 gift package 530 chocolate 911	Netherlands → Groningen 23734
deoarewrald.nl	Worldshop De Oare Wrâld	This website presents the world shop De Oare Wrâld in Burgum and its activities.	Non-Profit Organizations → Development Organizations 46 Commerce → Fair Trade 191	working groups 171 employee 4429 production 4582 shop 6483	Tytsjerksteradiel → Burgum 371
wereldwinkelbreda.nl	Wereldwinkel Breda	Wereldwinkel Breda’s website provides information about the shop, its activities, and its mission of conscious choices and fair trade.	Commerce → Fair Trade 191 Sustainability → Cooperatives 970	assortment 7799 volunteer 8367 sustainability 18451	North-Brabant → Breda 9003
passieux.nl	Fa. Passieux	The website of Passieux offers high-quality coffee beans and related cleaning products, with a focus on fair trade and artisanal roasting.	Coffee → Coffee Beans 178 Coffee → Specialty Coffee 20	roast 60 coffee beans 452 coffee 3838 shop 6483
kerstpakketplus.nl	Kerstpakket plus	The website kerstpakket plus presents and sells a wide range of corporate and personal gift packages.	Gifts → Gift Cards 981 Gifts → Gift Packages 18	gift package 530 wellness 1561 food 3872 wine 4476
artofafrica.nl	Art of Africa	The Art of Africa website offers a unique collection of African (garden) sculptures and gifts, with an emphasis on fair trade practices.	Adventure → Safari 56 Commerce → Fair Trade 191	safari 181 stone 724 sculpture 1440
chocolatebar.nl	The Chocolate Bar	The website of The Chocolate Bar in Ootmarsum provides information about workshops for making chocolate bonbons, the location, and upcoming activities.	Fine Dining & Gastronomy → Gastronomy 599 Tourism → Tourist Information 124	registration 4366 workshop 19325	Dinkelland → Ootmarsum 393
numithee.nl	Numi Tea	The website of Numi Tea presents a bio-organic and fair trade tea brand that focuses on offering tea with a pure taste, made from natural ingredients and with attention to sustainability.	Beverages → Tea 829 Context → Environment 54437	organic 471 tea 1146 packaging 2236 sustainability 18451	Utrecht Hill Ridge → Maarn 226
wereldwinkelpurmerend.nl	Worldshop Purmerend	The Worldshop Purmerend is a shop selling products with a fair trade and sustainable origin, supporting various charities in the process.	Commerce → Fair Trade 191 Retail & Supplies → Specialty Retail 347	candleholder 61 gift voucher 548 sustainable 739 assortment 7799 news 15293	North-Holland → Purmerend 2620
hvvinterieur.nl	Heinde & van Verre	The website of Heinde & van Verre is an online store that offers sustainable home and fashion accessories made from natural materials, including decor, household textiles, fashion accessories and gift items, often with a focus on fair trade.	Clothing → Vintage Clothing 72 Decor & Furnishings → Home Stores 932	home decor 400 online store 905 fabric 1644	South-Holland → The Hague 19898
boerland-uitvaartmanden.nl	Boerland Uitvaartmanden	Boerland Uitvaartmanden offers handcrafted, eco-friendly funeral baskets.	Consumer & Lifestyle → Eco-Friendly Products 269 Crafts & Hobbies → Handcrafted Products 21	cremation 615 certification 3380
hebbusennoggus.nl	Hebbus & Noggus	The website of Hebbus & Noggus presents a brand specializing in the design and sale of alternative clothing, with a focus on handmade, unique, and affordable pieces.	Textiles → Fabrics 371	fabric 1644 style 2348 festival 3804 clothing 9443
bureauverantwoord.nl	Bureau Verantwoord	The website of Bureau Verantwoord presents the activities of Jan Vugts related to fair trade and sustainable food.	Initiatives & Collaboration → Initiatives 459 Entrepreneurship → Social Enterprises 299	food waste 54 news 15293 collaboration 16036
wereldwinkelgroningen.nl	Wereldwinkel Groningen	The website of Wereldwinkel Groningen presents its selection of fair trade products, gift packages, and other unique items that the store offers.	Commerce → Fair Trade 191	gift package 530 opening hours 2953 jewelry 4599 vacancy 6598	Netherlands → Groningen 23734
wereldwinkelvught.nl	Wereldwinkel Vught	Wereldwinkel Vught is a shop that sells fair trade products from various countries around the world and where people can work to promote fair trade.	Commerce → Fair Trade 191 Food → Gifts & Souvenirs 2421	world 321 shop 6483
zijdensjaaltjes.nl	zijdensjaaltjes.nl	The website is an online shop where customers can buy silk scarves, both plain and printed, and sarongs.	Accessories → Scarves 155 Clothing → Activewear 642	silk 102 scarf 387 color 4159
wereldwinkelhuizen.nl	Wereldwinkel Huizen	Wereldwinkel Huizen is a shop that sells handmade products from developing countries and supports fair trade.	Supply Chain & Logistics → International Trade 1156	catalog 812 shop 6483 story 8285 volunteer 8367	North-Holland → Huizen 1416
wwsb.nl	Wereldwinkel Stede Broec	Wereldwinkel Stede Broec sells products from other cultures with a focus on fair trade and sustainability.	Commerce → Fair Trade 191 Commerce → Sustainability 14	decoration 4085 gift 6442 sustainability 18451 event 45199	Stede Broec → Bovenkarspel 278
perezvloerkleden.nl	PEREZ VLOERKLEDEN	Perez Vloerkleden is a company specializing in the sale and provision of services related to hand-knotted and handmade rugs.	Household & Cleaning → Household Goods 1642 Retail & Commerce → Retailers 754	handmade 270 rug 299 collection 7566	North-Brabant → Tilburg 8759
wereldwinkel-tilburg.nl	Wereldwinkel Tilburg	Wereldwinkel Tilburg is a gift shop selling products from various cultures and countries with a focus on sustainability and fair trade.	Retail & Commerce → Commerce 8244 Culture → Cultural Experiences 52	gift 6442 newsletter 6504 sustainability 18451	North-Brabant → Tilburg 8759
egos-copenhagen.nl	EGOS Copenhagen	The EGOS Copenhagen website offers comfortable, handmade slippers, hats, and gloves made from 100% natural wool, produced by Nepalese women in a fair working environment.	Textiles → Wool 160 Shoes → Slippers 54	slippers 161 handmade 270 gloves 292 hat 349 wool 489
wijchensewereldwinkel.nl	Wijchense Wereldwinkel	The Wijchense Wereldwinkel is a shop that sells fair trade and sustainable goods, with a history of 40 years.	Commerce → Fair Trade 191	paper goods 15 coffee 3838 gift 6442 sustainability 18451	Gelderland → Wijchen 1579
sqware.nl	Sqware	Sqware is a men's fashion store located in Bladel, offering carefully curated collections from international brands.	Retail & Commerce → Retailers 754	fashion 2212 collection 7566	North-Brabant → Bladel 779
dromenvanger.nl	Dromenvanger.nl	The website offers a wide selection of dreamcatchers for sale, emphasizing fair-trade products.	Jewelry → Gemstones 451 Crafts → Handmade 1147	dreamcatcher 23 feather 34 web 80 bed 1384
hetbelegh.nl	Broodjeszaak Het Belegh	The website of Broodjeszaak Het Belegh presents the business, its menu, and opening hours, and provides information about the delivery of sandwiches and hot dishes to individuals and companies.	Blogs → Food Blogs 246 Sandwiches & Salads → Sandwich Shops 229	sandwich 4098 dish 5936 menu 13856	Overijssel → Haaksbergen 887
domburgfoods.nl	Domburg Foods	The Domburg Foods website showcases its product range, distribution points, and recipes, aiming to make Surinamese cuisine accessible and affordable in the Netherlands.	Delicacies & Specialty Foods → Specialty Foods 265	product range 75 cuisine 666 recipe 5142
wereldwinkelvoorschoten.nl	Wereldwinkel Voorschoten	The Wereldwinkel Voorschoten's website provides information about the shop, its policy plan, opening hours, and volunteer opportunities.	Africa → Kenya 38 Commerce → Fair Trade 191	policy plan 114 market 2772 shop 6483 volunteer 8367	South-Holland → Voorschoten 830
growinggreencoffee.nl	Growing Green Coffee	The Growing Green Coffee website is an online store selling organic, fair trade, and freshly roasted coffee beans with a focus on sustainability and direct relationships with coffee farmers.	Coffee → Coffee Beans 178 Commerce → Fair Trade 191	coffee roaster 13 coffee beans 452 organic 471 packaging 2236 sustainability 18451
paul-k.nl	Beska International Fabrics	The website of Beska International Fabrics showcases a range of sustainable products and fair trade materials, including a linen collection, products from brands like Nikari and Johanna Gullichsen, and a line of wooden furniture.	Commerce → Textile Retail 137 Business → Industry 36977	linen 194 textile 1421 wood 4153 brand 17737 design 27202
kraftkoffie.nl	Kraft Koffie	The Kraft Koffie website offers and sells fair trade coffee beans, which are roasted with a focus on preserving the unique flavor of the beans, with a focus on both home and commercial use.	Coffee → Coffee Beans 178	roast 60 coffee beans 452 flavor 1032
mappadelmondo.nl	Mappa del Mondo	The website Mappa del Mondo sells fair trade products and related services, with a focus on ethical and sustainable sourcing.	Commerce → Fair Trade 191 Decor & Furnishings → Home Stores 932	gift 6442 workshop 19325
rodeli.nl	Rodeli & Luckyboysunday	The website rodel i offers unique, trendy, and cute decorations and accessories for children’s rooms, primarily hand-knitted plush toys from the brand Luckyboysunday and various textile products.	Textiles → Wool 160 Crafts → Handmade 1147	alpaca 113 plush toy 256 style 2348 design 27202
tichaonana.nl	Tichaonana	Tichaonana is a website that organizes and promotes exhibitions of Zimbabwean art.	Historical & African Art → African Art 10 Painting → Individual Artists 668	zimbabwe 23 artworks 460 exhibition 5332 artist 5745
risacoffee.nl	Risa Coffee	The Risa Coffee website presents a premium coffee brand focused on fair trade, sustainability, and fresh coffee beans. The aim is to offer customers an appealing coffee experience and contribute to ethically responsible coffee production.	Coffee → Specialty Coffee 20 Commerce → Fair Trade 191	roast 60 coffee beans 452 coffee 3838 sustainability 18451

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.