Local Communities and Regional Information

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳village ⁸⁰⁸	Local Communities and Regional Information	This collection features websites dedicated to towns, villages, and local regions, primarily within the Netherlands and surrounding areas. Content ranges from historical accounts and community events to local politics, tourism, and accommodations.

808 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
mijndorpinoverijssel.nl	Province of Overijssel & OVKK	The website describes and presents information about various villages in the province of Overijssel.	Politics & Government → Provinces ¹²	comparator ²⁴ atlas ⁶⁹ register ³⁶² database ¹¹⁵³ municipality ⁶⁸³⁷	Dinkelland → Lattrop-Breklenkamp ⁷⁵
dorp-ee.nl	Gemeente Dongeradeel	Dorp Ee is a protected village character and offers a glimpse into village life in a traditional Friesian village.	Local Communities → Villages ¹⁰⁰⁵	history ⁷²⁸⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Northeast-Friesland → Ternaard ³⁵
rondomdekiel.nl	rondomdekiel.nl	The village of De Kiel is a small and surprisingly historical village in Drenthe, with a population of less than 400 people.	Hiking → Walking Routes ²²⁶ Local Communities → Villages ¹⁰⁰⁵	qr code ¹⁸⁹ walk ²¹⁶¹ history ⁷²⁸⁶	Netherlands → Drenthe ²⁰⁰⁶²
dorpsgidsenhogeland.nl	Dorpsgidsen van het Hogeland	The website focuses on the diverse villages within the municipality of Het Hogeland, each with its own unique characteristics and history.	Monuments → Cultural Heritage ⁵¹⁴ Monuments → Heritage ⁵²⁶	heritage ⁸¹⁸ tours ¹⁰⁴⁸	Het Hogeland → Winsum ³⁶⁹
dorpdekoog.nl	De Koog Village Committee	De Koog is a dune village on Texel, known for its beaches and dunes and offers a cozy mix of shops and restaurants.	Local Politics → Municipal Council ⁴⁸⁴ Travel → Tourism ³⁷⁵⁴	village house ¹⁶⁵ news ¹⁵²⁹³	Texel → De Koog ¹⁴⁷
sumar.nl	Doarpsbelang Sumar	Sumar is a surprising small village in Limburg, Netherlands.	Local Government → Village Council ⁴⁷⁹	village vision ²⁷ village house ¹⁶⁵ history ⁷²⁸⁶ association ⁸⁵⁶²	Tytsjerksteradiel → Sumar ⁵¹
dewaaltexel.nl	Municipality of Texel	De Waal is a small village on Texel, known for its historical houses and peaceful atmosphere.	Local Government → Village Council ⁴⁷⁹	village house ¹⁶⁵ municipality ⁶⁸³⁷ photo ⁷⁷⁷⁸ news ¹⁵²⁹³	Texel → De Waal ²⁵
dorpsraadpetten.nl	Petten Village Council	Petten is a seaside town with approximately 1600 residents, located at the foot of the Hondsbossche Zeewering and at the edge of the Pettemer Dunes.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	village council ¹⁴⁵ meeting ²³⁸¹ municipality ⁶⁸³⁷ news ¹⁵²⁹³	North-Holland → Schagen ²¹⁸²
filopopers.nl	Filopopers	The website is focused on informing about the various aspects of the village Nieuw-Beijerland.	News & Journalism → Local News ⁴⁸⁸ Village Focus → Village Organizations ⁶⁸³	history ⁷²⁸⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Hoeksche Waard → Nieuw-Beijerland ⁸⁴
nachtvanhetdorp.nl	The NvhD	The Night of the Village is an initiative to connect the village and the local community.	Local Events → Village Events ⁷⁵ Collaboration & Networking → Networking ¹²²⁵	night ⁶⁹ introduction ²⁷⁷ association ⁸⁵⁶² collaboration ¹⁶⁰³⁶	Roerdalen → Herkenbosch ¹²⁷
wapenvankwadijk.nl	Woningbouwproject Kwadijk	Kwadijk is a picturesque village in the municipality of Edam-Volendam, located in the green heart of North Holland. The project offers a unique combination of tranquility and accessibility.	Sustainable Living → New Developments ²⁰⁰ House Types → Apartment Living ³⁵⁵⁹	residence ²⁵¹ apartment ⁵⁰⁸⁸ history ⁷²⁸⁶	Purmerend → Middenbeemster ³⁶⁷
mooistedorpjes.nl	mooistedorpjes.nl	The village is a collection of special places, often with a specific location or atmosphere, as described by Jeroen and Patrick during their travels.	Local Communities → Villages ¹⁰⁰⁵ Europe → France ¹⁰⁴¹	place ²⁴² attraction ¹²⁷⁵ atmosphere ⁵⁵⁹¹ travel ⁷²¹⁰ blog ¹³³⁹²
jutrijp-hommerts.nl	Doarpsbelang Jutrijp-Hommerts	Jutrijp and Hommerts are described as villages and referred to as twin villages.	Village Council → Local Councils ²¹ Local Communities → Villages ¹⁰⁰⁵	editorial ¹⁶² village house ¹⁶⁵ municipality ⁶⁸³⁷ association ⁸⁵⁶² news ¹⁵²⁹³	De Fryske Marren → Lemmer ¹¹⁸⁸
de4doarpen.nl	Stichting De Fjouwer Doarpen	The website presents information about the four villages of Hinnaard, Itens, Rien, and Lytsewierrum, with a focus on connecting the residents.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	photo album ⁶⁸⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Friesland → Southwest-Friesland ⁴¹⁹⁴
vesting-oudeschans.nl	Geen	The village of Oudeschans was described as the 'heart of the village' due to the historical farmhouse, which was subsequently destroyed by fire.	Local History → Northern Netherlands ¹⁷ News & Journalism → Regional News ⁹⁴⁸	fire ⁴²⁹ province ⁵¹⁸ farmhouse ⁸⁷⁸ landscape ²⁶⁰⁹ community ⁷⁹³¹	Oldambt → Winschoten ⁸³⁰
hetdorpzalk.nl	Solutit - Fresh IT Solutions	The village of Zalk is a municipality in Flevoland and offers various facilities and events for its residents.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	board member ¹⁴² village house ¹⁶⁵ agenda ⁴³⁷⁴ association ⁸⁵⁶²	Kampen → Zalk ⁵⁰
werkgroepdoornenburg.nl	Doornenburg Working Group	Doornenburg is a village that needs to continuously develop to maintain a pleasant living environment.	Local Governance → Zoning Plans ⁴⁸ Government & Administration → Local Government ⁴⁵⁹¹	sports facilities ⁵⁵ living environment ¹⁷⁷ plan ²⁵⁶⁶ resident ³²⁴⁵	Lingewaard → Doornenburg ¹²⁹
wehe-denhoorn.nl	Municipality of Het Hogeland	Wehe-den Hoorn is a small village in the province of Groningen with a unique mix of long-term residents and newcomers, contributing to the village's vibrancy.	Travel → Tourism ³⁷⁵⁴ Context ¹⁶¹³⁹⁴	recreation ⁷⁹⁹ culture ³⁹²² association ⁸⁵⁶²	Het Hogeland → Lauwersoog ²⁹⁵
scharnegoutum.nl	Doarpsbelang Skearnegoutum	Scharnegoutum is a village in Friesland with an active community.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	photo archive ⁵⁵ village hall ¹⁰⁷ agenda ⁴³⁷⁴ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Friesland → Southwest-Friesland ⁴¹⁹⁴
nes-nof.nl	Municipality of Noardeast-Fryslân	Nes Noardeast-Fryslân is a small village in Friesland known for its association life and historical elements.	Local Communities → Villages ¹⁰⁰⁵	farmhouse ⁸⁷⁸ church ³⁴³⁹ association ⁸⁵⁶²	Northeast-Friesland → Dokkum ⁸⁴⁶
waddentour.nl	Waddentour	The Waddentour runs through a number of characteristic villages in Northeast Friesland.	Historical Sites → Monuments ¹⁰²⁷ Cycling → Cycling Routes ¹⁰⁰²	information board ¹³ walking route ³⁴⁰ route ³⁴²⁵	Smallingerland → Drachten ²⁰⁵²
dorpsbelangendelutte.nl	Stichting Dorpsbelangen De Lutte	The Stichting Dorpsbelangen de Lutte is an organization dedicated to the well-being and livability of the village of Lutte.	Local Governance → Local Politics ²⁵⁵⁹ Local Government → Village Council ⁴⁷⁹	service level ³⁴ livability ²³⁰ plan ²⁵⁶⁶ podcast ³³²⁸ municipality ⁶⁸³⁷	Overijssel → Losser ⁷⁴³
bloeizonetgoy.nl	Stichting Mooi ’t Goy	't Goy is a small and charming village located along the Amsterdam-Rijn canal.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Organizations ⁶⁸³	hiking ⁸⁴¹ plan ²⁵⁶⁶ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	Houten → 't Goy ⁶⁵
museumdorpentour.nl	Museumdorpentour	The Museumdorpentour connects six specific villages in the Eemsdelta.	Tourism → Cultural Attractions ⁶⁹⁸ Art Management & Sales → Art Projects ²⁶	artwork ²²⁴⁸ youth ³¹²⁶ route ³⁴²⁵ artist ⁵⁷⁴⁵	Eemsdelta → Bierum ²³
ditiseenrum.nl	Gemeente Groningen	Eenrum is a picturesque wierdedorp (traditional village) in North Groningen, with a rich history and diverse amenities.	Local History → Historical Places ⁶⁰	mill ⁴⁸⁷ hiking ⁸⁴¹ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Oldambt → Winschoten ⁸³⁰
dorpkopeninspanje.nl	dorpkopeninspanje.nl	The website specifically focuses on the possibility of purchasing an abandoned village in Spain, highlighting the unique characteristics and challenges of this type of property.	Property Location & Neighborhood → Property ⁶⁹⁵ Europe → Spain ¹³¹⁶	spain ³⁶³ dream ⁸⁸³ plan ²⁵⁶⁶
nobelhorst.nl	Municipality of Almere	Nobelhorst is described as 'the village of Almere,' a place where residents meet and children play together.	Property Finance → Purchase ⁴⁹³	dwelling ¹¹⁸ plot ¹⁰⁵¹ neighborhood ²⁴²⁴ resident ³²⁴⁵ house ⁸¹²¹	Almere → Nobelhorst ²⁸
harich.nl	Harich	Harich is a charming village with a rich history.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Organizations ⁶⁸³	governance ⁶¹⁰ farm ²⁶²² church ³⁴³⁹ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	De Fryske Marren → Balk ²²⁴
sintjabik.nl	Gemeente Waadhoeke	Sint Jacobiparochie is a village in the Waadhoeke municipality, Friesland, with a rich history and an active community.	Accommodation → Group Accommodation ⁸⁴⁴ Village Focus → Village Organizations ⁶⁸³	pilgrimage route ¹⁵ infrastructure ¹⁴⁶⁰ history ⁷²⁸⁶ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	Waadhoeke → St.-Annaparochie ¹⁴⁶
dorpenfrankrijk.nl	N/A	The website focuses on presenting a collection of the most attractive villages in France, with a clear focus on recreation and relaxation.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Europe → France ¹⁰⁴¹	place ²⁴² vacation ⁴²³⁴ region ⁵⁴¹²
easterwierrum.nl	Stichting Begraafplaats Easterwierrum	The village of Easterwierrum (also Oosterwierum) is the central focus of the website, with information about its history, attractions, and activities.	Historical Sites → Monuments ¹⁰²⁷	committee ⁶²⁹ municipality ⁶⁸³⁷ history ⁷²⁸⁶ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Friesland → Southwest-Friesland ⁴¹⁹⁴
bitgummole.nl	Pleatslik Belang Bitgummole	Pleatslik Belang Bitgummole is an organization that manages the activities and developments in the village of Bitgummole and provides information.	Associations → Village Associations ¹⁵² Village Focus → Village Organizations ⁶⁸³	airbase ¹² village vision ²⁷ bus ⁸⁹⁴ board ³⁴³⁸ agenda ⁴³⁷⁴	Waadhoeke → Bitgummole ²⁷
muziekstroomdordrecht.nl	N.V.	Erica, Vlijmen, Ulft, and Klazienaveen are all described as villages, indicating the website’s focus on local news and developments.	TravelContent → Travel Guides ⁹³⁸ News & Journalism → Regional News ⁹⁴⁸	community ⁷⁹³¹ story ⁸²⁸⁵ news ¹⁵²⁹³	Goeree-Overflakkee → Achthuizen ⁴⁴
vriendenvanhetoudedorphuizen.nl	Friends of the Old Village of Huizen	The website focuses on the history and current situation of the village of Huizen.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Life ²⁶²	building plan ¹⁶⁷ council ⁴²⁶ friend ⁶³⁹ monument ¹¹⁶⁸ house ⁸¹²¹	North-Holland → Huizen ¹⁴¹⁶
wonenincortelande.nl	Municipality of Zuidplas	The village of Cortelande is presented as a new and attractive residential area that values people and nature.	Social Issues → Humanitarian Aid ⁶²¹ Context → Environment ⁵⁴⁴³⁷	outdoor ³⁸¹ housing ⁴³⁷⁸ community ⁷⁹³¹ nature ⁹⁰⁹⁴	South-Holland → Zuidplas ¹¹²²
bewonersplatformsmilde.nl	Bewonersplatform Smilde	Before 1998, Smilde was the central village of several small villages.	Local Government → Village Council ⁴⁷⁹	interest ⁹¹¹ vision ¹⁸⁸² municipality ⁶⁸³⁷	Midden-Drenthe → Smilde ²⁰³
experimentkrewerd.nl	Experiment Krewerd	The residents want to maintain the familiar character of their village while improving it when necessary.	Humanitarian Aid → Disaster Relief ⁷⁴ Environment → Natural Disasters ¹⁹	earthquake ⁴⁴ reinforcement ⁶⁵ energy ⁹⁰⁷⁵	Eemsdelta → Krewerd ¹²
actievedorpen.nl	Groninger Dorpen Association	The ADA initiative is focused on improving the living environment in Groningen villages.	Local Communities → Villages ¹⁰⁰⁵ Initiatives & Collaboration → Initiatives ⁴⁵⁹	theme ⁴⁰¹⁵ association ⁸⁵⁶²	Netherlands → Groningen ²³⁷³⁴
dorpenoverleg.nl	Dorpenoverleg Midden Drenthe	The Dorpenoverleg Midden-Drenthe is primarily focused on the interests of villages and neighborhoods within the municipality.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	livability ²³⁰ agenda ⁴³⁷⁴ housing ⁴³⁷⁸ municipality ⁶⁸³⁷	Drenthe → Midden-Drenthe ¹³⁴³
dorpenacademie.nl	Dorpenacademie	The Dorpenacademie focuses on connecting villages in the Netherlands and supporting innovative projects within these communities.	Social Issues → Community Development ³³⁰ Blogs & Publications → Regional ²⁷²	improvement ²⁸⁴ opportunity ⁵⁸¹ initiative ¹²⁹⁷ collaboration ¹⁶⁰³⁶	Westerkwartier → Lauwerzijl ¹²
ven-zelderheide.nl	None	Ven-Zelderheide is a village with a rich history and a close-knit community.	Local Communities → Villages ¹⁰⁰⁵	history ⁷²⁸⁶ community ⁷⁹³¹ association ⁸⁵⁶² nature ⁹⁰⁹⁴	Gennep → Ven-Zelderheide ³¹
indimenticabile.nl	Liz Windt	The village where Liz Windt works is a nearly deserted and traditional Italian village, characterized by a long period of stagnation.	Europe → Italy ⁷⁸⁶ Journalistic Visuals → Documentary Photography ⁸⁴	italy ²⁶³ tradition ⁷³⁶ photographer ¹³⁶⁶ nature ⁹⁰⁹⁴ music ¹³¹⁷⁰
dorpsbelangoosterwolde.nl	Stichting Dorpsbelang Oosterwolde	The Stichting Dorpsbelang Oosterwolde is committed to improving the livability of the village of Oosterwolde.	Local Politics → Parties ⁶²² Neighborhood Focus → Neighborhoods ¹⁰²⁸	livability ²³⁰ resident ³²⁴⁵ municipality ⁶⁸³⁷	Ooststellingwerf → Oosterwolde ⁴¹⁷
hartvoorschore.nl	Schore	Schore is a small, welcoming village in the municipality of Kapelle, fostering a community spirit.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Travel → Tourism ³⁷⁵⁴	village house ¹⁶⁵ housing ⁴³⁷⁸ history ⁷²⁸⁶ community ⁷⁹³¹ association ⁸⁵⁶²	Zeeland → South-Beveland ¹⁵⁷
dorpsraad-eethen.nl	Dorpsraad Eethen	The village of Eethen is a small community with a strong commitment from its residents.	Village Council → Local Councils ²¹ Local Communities → Villages ¹⁰⁰⁵	council ⁴²⁶ green ⁸⁸⁹ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	North-Brabant → Altena ¹⁶⁶⁹
derips.nl	Dorpsoverleg De Rips	De Rips is a village with a rich history of over 100 years.	Local Government → Village Council ⁴⁷⁹	village council ¹⁴⁵ agenda ⁴³⁷⁴ news ¹⁵²⁹³	Gemert-Bakel → De Rips ⁴⁴
kruispad.nl	Buurtschap de Kruispad	Buurtschap de Kruispad is a small village located at a crossroads in the region and offers information and activities for residents.	Local Communities → Villages ¹⁰⁰⁵	photo ⁷⁷⁷⁸ news ¹⁵²⁹³
delocht.nl	De Locht Museumdorp	De Locht is a museum village, a unique place that combines the history and culture of a traditional Limburg village.	Family Activities → Outings ⁷⁶³ Museums → Regional Museums ³⁹⁰	museum ²⁰⁰² history ⁷²⁸⁶ story ⁸²⁸⁵	Sittard-Geleen → Sittard ¹⁹⁹⁷
zuthem.nl	Municipality of Raalte	Laag Zuthem is a village on the water that is part of the municipality of Raalte.	Local Events → Village Events ⁷⁵ Village Focus → Village Organizations ⁶⁸³	facility ²⁶¹⁶ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Raalte → Luttenberg ⁵³²
warns.nl	Gemeente/Dorp Warns	Warns is a picturesque village located in Friesland.	Accommodation → Holiday Parks ¹⁰²⁴ Nature → National Parks ⁸⁹⁸	harbor ⁶⁹¹ theater ²⁵⁴⁴ accommodation ⁴⁹²¹ event ⁴⁵¹⁹⁹	Southwest-Friesland → Stavoren ¹⁵⁵
welcometothevillage.nl	Koen Haringa	The festival village was the central hub of the event and is known for its unique atmosphere.	Local Politics → Municipal Council ⁴⁸⁴ News & Journalism → Regional News ⁹⁴⁸	documentary ¹⁰⁸¹ festival ³⁸⁰⁴ newsletter ⁶⁵⁰⁴	Friesland → Leeuwarden ⁶⁰⁶⁸
netwerkduurzamedorpen.nl	Netwerk Duurzame Dorpen	The website is geared toward connecting and inspiring various sustainable villages.	Volunteering → Community Initiatives ⁵²³ Radio & Communication → Networks ³⁴¹	initiative ¹²⁹⁷ knowledge ³⁵²⁸ inspiration ⁴⁰⁸¹ sustainability ¹⁸⁴⁵¹	Southwest-Friesland → Heeg ²²⁷
rottumonline.nl	Rottum Online	Rottum is a village with approximately 700 inhabitants located in the municipality of De Fryske Marren.	Local Communities → Village Communities ¹²¹ Landscape → Nature Areas ⁵⁸	nature area ⁴⁹⁷ agenda ⁴³⁷⁴ municipality ⁶⁸³⁷ news ¹⁵²⁹³	Het Hogeland → Rottum ³⁸
americaweb.nl	Gemeente Horst aan de Maas	America is a small church village located in Horst aan de Maas, with a rich history and an active community.	Local Communities → Villages ¹⁰⁰⁵ Governance → Cultural Organization ¹⁵¹	recreational park ¹⁵ fanfare ¹⁷¹ community ⁷⁹³¹ association ⁸⁵⁶²	Limburg → Horst aan de Maas ¹³⁵⁷
dorpsbelangennieuwbuinen.nl	Vereniging voor Dorpsbelangen Nieuw Buinen	The association strives to improve the livability of Nieuw-Buinen.	Associations → Community Associations ¹⁶ Tourism → Regional Tourism ²⁴²	announcement ¹¹⁵ cycling route ⁴⁵¹ board ³⁴³⁸ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Borger-Odoorn → Nieuw-Buinen ¹⁴⁰
bombardementdefilm.nl	Curtis Reed	Millingen aan de Rijn is a charming village, a small community with its own history and characteristics.	Travel & Exploration → Natural History ¹⁷ Local Communities → Villages ¹⁰⁰⁵	border ¹¹⁹ river ³¹² nature area ⁴⁹⁷ municipality ⁶⁸³⁷ garden ¹³¹²⁹	Lingewaard → Doornenburg ¹²⁹
lvkk.nl	Landelijke Vereniging voor Kleine Kernen (LVKK)	The organization supports 4,000 village and community center organizations.	Government & Administration → Provincial Governments ⁶⁹ Context → Environment ⁵⁴⁴³⁷	resident initiative ¹⁷ manifesto ⁶⁷ village house ¹⁶⁵ politics ¹²⁵⁹	Drenthe → Assen ³⁵¹⁶
dorpsraadarkel.nl	Dorpsraad Arkel	The Dorpsraad Arkel focuses on creating a livable and attractive village.	Local Communities → Villages ¹⁰⁰⁵	village council ¹⁴⁵ resident ³²⁴⁵ newsletter ⁶⁵⁰⁴	Molenlanden → Arkel ¹⁴³
larensevoorouders.nl	Larense Voorouders	Laren is primarily described as a village with a rich history and an attractive residential environment.	Local Communities → Villages ¹⁰⁰⁵	family tree ⁴⁴⁸ genealogy ⁵⁴³ history ⁷²⁸⁶	North-Holland → Laren ¹²³⁴
dorpvijfhuizen.nl	Vereniging Dorp Vijfhuizen	The website is specifically focused on the village of Vijfhuizen and activities within this village.	Local History → Place History ⁴¹ Nature Conservation → Landscape Conservation ¹¹⁴	meeting ²³⁸¹ newsletter ⁶⁵⁰⁴ municipality ⁶⁸³⁷ association ⁸⁵⁶²	Haarlemmermeer → Vijfhuizen ²²⁶
hetdorphoek.nl	Stichting Dorpsbelangen Hoek	The village of Hoek is described as a place with much potential and provides information on livability and developments.	Local Government → Village Council ⁴⁷⁹ Pediatric & Child Health → Community Care ¹⁴¹	foundation ⁶⁶⁷⁸ municipality ⁶⁸³⁷ event ⁴⁵¹⁹⁹	Terneuzen → Hoek ⁷⁹
dorpsraadleunen.nl	Stichting Dorpsraad Leunen	The village of Leunen is one of the 14 church villages of Venray and is known for its cozy atmosphere and the involvement of its residents.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Organizations ⁶⁸³	livability ²³⁰ council ⁴²⁶ news ¹⁵²⁹³	Venray → Leunen ⁶⁹
dorpsraadvredepeel.nl	Vredepeel Village Council	Vredepeel is a small settlement in the municipality of Venray.	Local Government → Village Council ⁴⁷⁹ Local Economy & Development → Regional Development ²⁹⁶	council ⁴²⁶ agriculture ⁷⁷⁸ history ⁷²⁸⁶ community ⁷⁹³¹	Limburg → Venray ¹⁶⁰¹
schildmeerdorpen.nl	Dorpsbelangen Overschild	Village visions of various municipalities are central and determine the future plans.	Local Communities → Villages ¹⁰⁰⁵ Local Communities → Village Communities ¹²¹	village vision ²⁷ traffic ⁹¹⁶ housing ⁴³⁷⁸	Midden-Groningen → Hellum ³³
noordwolde-zuid.nl	Plaatselijk Belang Noordwolde-zuid	Noordwolde-Zuid is a small village with a unique character and history.	Local Communities → Villages ¹⁰⁰⁵ Landscape → Nature Areas ⁵⁸	forest ¹⁴¹⁸ history ⁷²⁸⁶ news ¹⁵²⁹³	Het Hogeland → Noordwolde ¹⁵²
casa-ciantri.nl	Casa Ciantri	Ciantri is a small village that exudes unique charm through its old architecture and the people who live there.	Italy → Liguria ¹⁹ Landscape → Mountains ⁸¹	liguria ¹⁴ mountain ²⁰⁰ river ³¹²
hhlm.nl	Houd Heeze-Leende Mooi Foundation	The project is specifically aimed at the village of Heeze-Leende, with the goal of improving the quality of life and cultural heritage of the community.	Cultural Heritage → Heritage Preservation ⁵¹ Monuments → Heritage ⁵²⁶	tradition ⁷³⁶ heritage ⁸¹⁸ building ³²⁰⁴ foundation ⁶⁶⁷⁸ nature ⁹⁰⁹⁴	North-Brabant → Heeze-Leende ⁷³¹
klankbordgroepoudalblas.nl	Klankbordgroep Oud-Alblas	The group works together to make the village of Oud-Alblas livable and sustainable for the future.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	resident ³²⁴⁵ community ⁷⁹³¹	Molenlanden → Oud-Alblas ⁹⁹
wogmeer.nl	Vereniging Oud Wogmeer	Wogmeer is a small village in West Friesland with a rich history.	Local Communities → Villages ¹⁰⁰⁵ Landscape → Polders ²¹²	chronicle ²⁵ photographs ²⁵⁴ polder ⁴⁷⁶ family ⁶⁴⁶²	De Fryske Marren → Lemmer ¹¹⁸⁸
dorpdeil.nl	Dorpsraad Deil	The website is about the village of Deil and the activities that take place there.	Local Government → Village Council ⁴⁷⁹ Lifestyle → Recreation ³⁴²⁴⁹	working group ¹³⁴ village council ¹⁴⁵ mill ⁴⁸⁷ agenda ⁴³⁷⁴ municipality ⁶⁸³⁷	West-Betuwe → Deil ⁶⁷
vierheerlijkheden.nl	Stichting de Vier Heerlijkheden	The website describes and presents information about four specific villages: Aalst, Brakel, Poederoijen, and Zuilichem.	Tourism → Regional Tourism ²⁴²	history ⁷²⁸⁶ collection ⁷⁵⁶⁶ photo ⁷⁷⁷⁸ book ¹¹³⁹⁶	Zaltbommel → Poederoijen ⁵⁶
degaastmar.nl	Dorpsbelangen Gaastmeer	The village of Gaastmeer is uniquely located in the Frisian Lake area and offers a rich association life.	Water → Lakes ²³² Accommodation → Group Accommodation ⁸⁴⁴	cultural heritage ⁵⁵ recreation ⁷⁹⁹ history ⁷²⁸⁶ association ⁸⁵⁶²	Southwest-Friesland → Gaastmeer ³⁴
niawier-wetsens.nl	The Walda Archive	The site is dedicated to the village of Niawier and Wetsens.	Local Events → Village Events ⁷⁵ Village Focus → Village Life ²⁶²	archive ²⁰⁶⁷ history ⁷²⁸⁶ photo ⁷⁷⁷⁸ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Friesland → Northeast-Friesland ¹⁸³¹
bakhuizen.nl	Bakhuizen, Mirns & Rijs	Bakhuizen and Mirns are both villages with their own unique histories and characteristics, as described in the village overview.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Life ²⁶²	dorpsbelang ¹² history ⁷²⁸⁶ sustainability ¹⁸⁴⁵¹ event ⁴⁵¹⁹⁹	De Fryske Marren → Bakhuizen ⁴⁵
dorpsraadaartswoud.nl	Dorpsraad Aartswoud	The website specifically focuses on the village of Aartswoud.	Local Politics → Municipal Council ⁴⁸⁴ Government & Administration → Local Government ⁴⁵⁹¹	dorpsraad ²⁸ history ⁷²⁸⁶	Opmeer → Aartswoud ³⁶
kerkinhetdorp.nl	Protestantse gemeente Winsum-Halfambt	The activities take place in various villages, such as Eenrum and Westernieland.	Protestant Churches → Congregations ³⁰⁴ Local Communities → Villages ¹⁰⁰⁵	merger ³²³ church service ⁸⁷⁹ church ³⁴³⁹	Het Hogeland → Den Andel ²⁷
lennisheuvel.nl	Stichting Rond de Kerk en Orion (RKO)	Lennisheuvel is a small village in the Boxtel municipality, known for its tranquil atmosphere and close-knit community.	Local Communities → Villages ¹⁰⁰⁵ Neighborhood Focus → Neighborhoods ¹⁰²⁸	community center ⁴⁴² community ⁷⁹³¹ association ⁸⁵⁶² nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Boxtel → Lennisheuvel ²⁹
dorpsverenigingnijeveen.nl	Dorpsvereniging Nijeveen	The Dorpsvereniging Nijeveen is primarily focused on improving the livability and preserving the unique characteristics of the village of Nijeveen.	Associations → Village Associations ¹⁵² Village Focus → Village Organizations ⁶⁸³	working group ¹³⁴ livability ²³⁰ initiative ¹²⁹⁷ community ⁷⁹³¹	Meppel → Nijeveen ¹⁵³
zorgzamedorpengroningen.nl	Zorgzame Dorpen Groningen	The website shows a map with initiatives in various villages, such as Garrelsweer, Loppersum, and Stedum, which are committed to community development.	Sustainability → Cooperatives ⁹⁷⁰ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	cooperatives ¹³ initiative ¹²⁹⁷ volunteer ⁸³⁶⁷	Het Hogeland → Uithuizermeeden ⁶⁶
reisvenne-oranje.nl	Reisvenne-Oranje	Reisvenne-Oranje is a charming village of 12 participating villages in the Corso and is actively involved in the organization.	Carnival → Parades ⁷⁶ Local Communities → Villages ¹⁰⁰⁵	corso ³¹ community ⁷⁹³¹ volunteer ⁸³⁶⁷	North-Brabant → Valkenswaard ¹¹⁷⁹
windfondsdelfzijlnoord.nl	Windfonds Delfzijl Noord	The fund is specifically focused on supporting the interests of the villages of Borgsweer, Farmsum, and Termunten/Termunterzijl.	Renewable Energy → Wind Energy ³⁹⁶ Village Focus → Village Organizations ⁶⁸³	fund ¹⁰⁶³ board ³⁴³⁸ municipality ⁶⁸³⁷	Eemsdelta → Delfzijl ⁶¹⁵
oudveessen.nl	Stichting Oud Veessen	The website focuses specifically on the villages of Veessen, Vorchten, and Marle, with a focus on their historical development.	Municipalities → Dutch Municipalities ⁵¹⁶ Internet → Archives ⁴²²	postcard ²⁷⁸ history ⁷²⁸⁶ photo ⁷⁷⁷⁸	Olst-Wijhe → Marle ²¹
infoberinge.nl	Steingood Village Cooperative	Beringe is a small village with a strong community spirit, as described on the website.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Life ²⁶²	social media ³³⁴² community ⁷⁹³¹	Peel and Maas → Beringe ⁸¹
beleefexmorra.nl	Gemeente Exmorra	The village of Exmorra offers a combination of historic buildings, associations and a population of approximately 490 inhabitants.	Travel Guides → Regional Travel Guides ⁸⁵ Local Communities → Villages ¹⁰⁰⁵	history ⁷²⁸⁶	Netherlands → Friesland ²⁷⁹¹¹
nieuwwehl.nl	Gemeente Doetinchem	Nieuw-Wehl is a village with approximately 500 inhabitants in the municipality of Doetinchem, located in Gelderland.	Municipalities → Dutch Municipalities ⁵¹⁶ Parks & Gardens → Parks ¹⁰⁴³	facility ²⁶¹⁶ municipality ⁶⁸³⁷ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Montferland → Didam ⁷⁵⁹
welkominoosterbeek.nl	Oosterbeek Business Association	Oosterbeek is a charming village in the Province of Utrecht, known for its green surroundings and rich history.	Context ¹⁶¹³⁹⁴	businessman ¹³ attraction ¹²⁷⁵ shop ⁶⁴⁸³ history ⁷²⁸⁶ nature ⁹⁰⁹⁴	Renkum → Oosterbeek ⁶⁰⁴
dorpwaardenburg.nl	Dorp Waardenburg	Dorp Waardenburg is a small village located in the municipality of West Betuwe, with a focus on improvement and connection.	Local Government → Village Council ⁴⁷⁹ Food & Dining → Hiking Routes ³⁹	resident ³²⁴⁵	West-Betuwe → Waardenburg ¹¹⁴
beusichemleeft.nl	Beusichem Leeft	Beusichem is a medieval village that receives attention from the foundation with many traditions and new initiatives.	Traditional Practices → Christmas Traditions ¹⁰ Village Focus → Village Organizations ⁶⁸³	tradition ⁷³⁶ initiative ¹²⁹⁷ resident ³²⁴⁵ collaboration ¹⁶⁰³⁶	Gelderland → Buren ¹⁰⁵⁴
stichtingschellinkhout.nl	Stichting Schellinkhout	Schellinkhout is a small village that is central to the activities of Stichting Schellinkhout.	Associations → Village Associations ¹⁵² Local Government → Village Council ⁴⁷⁹	resident ³²⁴⁵ foundation ⁶⁶⁷⁸ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Drechterland → Schellinkhout ⁵¹
nijevoert.nl	Municipality of Hoorn	Nijevoert is a village that offers a harmonious combination of traditional and modern living environments.	Villages → Dutch Villages ¹⁷ Landscape → Polders ²¹²	polder ⁴⁷⁶ city ¹⁸⁷⁵ vision ¹⁸⁸² water ²⁵⁰¹ history ⁷²⁸⁶	Stede Broec → Bovenkarspel ²⁷⁸
denham-fransum.nl	Plaatselijk Nut Den Ham – Fransum	Den Ham is described as a lively village offering a pleasant living environment, making ‘village’ relevant.	Village Focus → Village Life ²⁶² Village Focus → Village Initiatives ¹³⁷	community center ⁴⁴² municipality ⁶⁸³⁷ association ⁸⁵⁶²	Westerkwartier → Oldehove ⁵⁰
wonenopheterfgoed.nl	Developer (name not mentioned)	The location is De Erfjes, a historic village that exudes a warm and playful atmosphere.	New Construction → Neighborhood Development ⁹³³ Village Focus → Village Life ²⁶²	townhouse ⁷⁰ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
4h-archief.nl	Stifting Hantum Fitaal	The website is focused on the history and culture of the specific 4H villages.	Websites → Archive Websites ⁶⁹ Social Sciences → Genealogy & Family History ¹⁴⁰³	newspaper ³⁹⁶ archive ²⁰⁶⁷ film ³⁰⁰⁷ photo ⁷⁷⁷⁸ story ⁸²⁸⁵	Northeast-Friesland → Hantum ¹⁵
kleine-huisjes.nl	Kleine Huisjes Village Association	Kleine Huisjes is a small village located in northwest Groningen, notable for its agricultural history.	Local Communities → Villages ¹⁰⁰⁵ Nature → National Parks ⁸⁹⁸	council ⁴²⁶ polder ⁴⁷⁶ history ⁷²⁸⁶ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	Het Hogeland → Kloosterburen ⁶²
platformbuurtschappenhvt.nl	Stichting Platform Buurtschappen Hof van Twente	The foundation represents 13 different villages within the Hof van Twente.	Local Communities → Villages ¹⁰⁰⁵ Initiatives & Projects → Local Initiatives ¹⁰⁰¹	living environment ¹⁷⁷ interest ⁹¹¹ wellbeing ²⁶²⁰ foundation ⁶⁶⁷⁸	Hof van Twente → Markelo ³⁹⁹
nookennest.nl	Nook & Nest	The village of Nook & Nest is a place where visitors can relax and appreciate the charm of the houses.	Europe → Ireland ²⁶ Arts → Decorative Arts & Crafts ⁸²⁵	nest ¹⁴⁰ character ⁴⁴⁹ color ⁴¹⁵⁹ atmosphere ⁵⁵⁹¹ house ⁸¹²¹
dorpboazum.nl	Dorp Boazum	Dorp Boazum is a small village in the municipality of Makkum, located in Friesland.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	photo ⁷⁷⁷⁸ association ⁸⁵⁶²	Southwest-Friesland → Makkum ²²⁹
duurzaam-oudleusen.nl	Duurzaam Oudleusen	Oudleusen is the village that the organization aims to maintain and improve, with attention to both its history and future.	Local Communities → Villages ¹⁰⁰⁵ Initiatives & Collaboration → Initiatives ⁴⁵⁹	working groups ¹⁷¹ tradition ⁷³⁶ history ⁷²⁸⁶ community ⁷⁹³¹ sustainability ¹⁸⁴⁵¹	Dalfsen → Oudleusen ⁴⁷
clashofclay.nl	Clash of Clay	The village is the main structure of a clan that is defended and attacked.	Games → Mobile Games ⁴⁶	clan ²⁸ troop ⁷⁷
koudum.nl	Koudum.nl	Koudum is a small, centrally located village in Friesland.	Travel Guides → Regional Travel Guides ⁸⁵ Local Communities → Villages ¹⁰⁰⁵	tourism ³⁰³ friesland ⁶⁹² agenda ⁴³⁷⁴ history ⁷²⁸⁶	Southwest-Friesland → Koudum ¹³⁴
warten.nl	Gemeente Leeuwarden	The text describes the general characteristics and activities of the village of Warten.	Nature → National Parks ⁸⁹⁸ Travel → Tourism ³⁷⁵⁴	marina ⁴⁸⁷ recreation ⁷⁹⁹ boat ²⁹⁸⁰ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Smallingerland → Drachten ²⁰⁵²
glind.nl	De Glind Belangenvereniging	The website provides information about the village of De Glind, including its history, village plan, and current events.	Village Focus → Village Organizations ⁶⁸³ Community → Government & Administration ¹⁰⁵⁶⁷	youth ³¹²⁶ volunteer ⁸³⁶⁷ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Barneveld → De Glind ⁴⁹
musselonline.nl	Vereniging voor Plaatselijke Belangen Mussel	The association represents the interests of the residents of the village of Mussel.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Organizations ⁶⁸³	agenda ⁴³⁷⁴ photo ⁷⁷⁷⁸ association ⁸⁵⁶² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Stadskanaal → Mussel ³⁷
katlijk.nl	Plaatselijk Belang Katlijk	Katlijk is a small village in Friesland with a rich history and an active community.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	archive ²⁰⁶⁷ history ⁷²⁸⁶ community ⁷⁹³¹ association ⁸⁵⁶² news ¹⁵²⁹³	Netherlands → Friesland ²⁷⁹¹¹
heusdeninbeeld.nl	Municipality of Heusden	The website provides information about the 11 villages that make up the municipality.	Local & Regional → Local News Websites ³⁵⁸	municipality ⁶⁸³⁷ photo ⁷⁷⁷⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Heusden → Nieuwkuijk ¹⁷²
uutwiek.nl	Stichting Passantenhaven De Uutwiek	Odeberkoop is an old and historic village in Southwest Friesland.	Local Communities → Villages ¹⁰⁰⁵ Water Sports → Water ²⁹⁶³	harbor ⁶⁹¹ cycle ¹⁹⁰⁶ walk ²¹⁶¹ nature ⁹⁰⁹⁴	Heerenveen → Akkrum ²⁴⁶
hwwunseradiel.nl	Histoarysk Wurkferbân 'Ald' Wûnseradiel	A central goal of the website is to collect and share information about the history of the various villages.	Local Communities → Villages ¹⁰⁰⁵	photo ⁷⁷⁷⁸
westernielandweb.nl	westernielandweb.nl	The village of Westernieland has a rich history, including the impact of the Christmas Flood.	Local History → Northern Netherlands ¹⁷ TravelContent → Travel Guides ⁹³⁸	seal ²⁶⁴ polder ⁴⁷⁶ name ⁶⁸³ history ⁷²⁸⁶	Het Hogeland → Den Andel ²⁷
wittewierum.nl	None	Wittewierum is a small village with a rich history and a unique location.	Architecture & Sites → Middle Ages ¹⁸² Local Communities → Villages ¹⁰⁰⁵	chronicle ²⁵ abbey ⁴⁴ monastery ¹⁵¹	Eemsdelta → Appingedam ⁴²⁷
rosmalensbelang.nl	Rosmalens Belang	The party strives to maintain villages as strong and attractive places, with a focus on the needs of the local population.	Local Politics → Parties ⁶²² Community → Government & Administration ¹⁰⁵⁶⁷	neighborhood ²⁴²⁴ resident ³²⁴⁵ municipality ⁶⁸³⁷	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
onswindesheim.nl	Municipality of Windesheim	The website provides information about the village of Windesheim and its history and culture.	Reformed → Dutch Reformed Church ²¹⁹ Travel Guides → Regional Travel Guides ⁸⁵	church ³⁴³⁹ agenda ⁴³⁷⁴ event ⁴⁵¹⁹⁹	Olst-Wijhe → Olst ²⁸⁵
zwartebroekterschuur.nl	Plaatselijk Belang Zwartebroek-Terschuur	The website describes Plaatselijk Belang's activities in the villages of Zwartebroek and Terschuur.	Associations → Village Associations ¹⁵² Village Focus → Village Organizations ⁶⁸³	quality of life ¹¹¹ donation ⁵¹¹⁰ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Barneveld → Terschuur ⁸⁹
larensbehoud.nl	Larens Behoud	Larens Behoud strives to make Laren the most beautiful village in the Gooi.	Local Governance → Local Politics ²⁵⁵⁹ Context → Community ⁵⁷⁴¹⁰	issues ⁴⁷⁰ politics ¹²⁵⁹ community ⁷⁹³¹ membership ¹⁰⁴⁴²	North-Holland → Laren ¹²³⁴
wellaandemaas.nl	Stichting Archief Well e.o.	Well is a small village located on the Maas River, with a rich history.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	recreation ⁷⁹⁹ cycle ¹⁹⁰⁶ walk ²¹⁶¹ accommodation ⁴⁹²¹ history ⁷²⁸⁶	Peel and Maas → Baarlo ⁴⁴²
nswas.nl	Dutch Friends of Neve Shalom ~ Wahat al-Salam	The village, located between Jerusalem and Tel Aviv, is a specific place where this peace philosophy is practiced.	International Cooperation Projects → International Relations ⁴⁶⁵ SpecificDestinations → Destinations ¹¹⁰⁵	aid ⁴²⁷ cooperation ⁴³³ peace ¹¹¹³
verdwenendorpen.nl	Verdwenen Dorpen	The website focuses on vanished villages in the Netherlands, a subject with a rich history and often tragic events.	Local History → Dutch History ¹⁰⁶⁷ Context ¹⁶¹³⁹⁴	history ⁷²⁸⁶ story ⁸²⁸⁵ research ⁸⁹⁶⁷ book ¹¹³⁹⁶
teenage-party.nl	Teenage Party	The organization hosts its events in various villages, ranging from Leersum to Overberg.	Parties → Themed Parties ⁵⁸³ Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	party ⁵⁹²⁸ student ⁷⁶²³	Utrecht Hill Ridge → Amerongen ³¹²
chickfriend.nl	chickfriend.nl	The website focuses on news and information about various villages in Drenthe and South Holland.	Local Politics → Municipal Council ⁴⁸⁴ AccommodationTypes → Accommodation ¹²¹³⁰	business activity ¹⁸ climate ⁹³⁴ community ⁷⁹³¹ news ¹⁵²⁹³	Emmen → Klazienaveen ²⁹⁷
dorpsraadvelddriel.nl	Stichting dorpsraad Velddriel	Velddriel is the village where the council is active and implements projects.	Local Government → Village Council ⁴⁷⁹ Events → Places ¹²¹⁹	livability ²³⁰ council ⁴²⁶ traffic ⁹¹⁶ resident ³²⁴⁵	Maasdriel → Velddriel ⁹⁰
kerkendorp.nl	Overijsselse Vereniging voor Krachtige Kernen	The website addresses the role of churches within villages and the need for adaptation and repurposing.	Village Focus → Village Life ²⁶² Legal → Government Affairs ⁴²	future plan ¹² church building ¹⁶⁰ subsidy ²⁶⁴⁹ church ³⁴³⁹
dorpmiddelstum.nl	Stichting Dorps Belangen Middelstum	The website is specifically focused on the village of Middelstum.	Hiking → Walking Routes ²²⁶ Associations → Village Associations ¹⁵²	livability ²³⁰ resident ³²⁴⁵ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Eemsdelta → Middelstum ¹¹¹
gekopgendt.nl	gekopgendt.nl	Gendt is a charming village located on the Waal River, with a unique combination of charm and amenities.	Context ¹⁶¹³⁹⁴	center ¹¹¹⁵ parking ¹⁹²⁸ shop ⁶⁴⁸³ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Lingewaard → Gendt ¹⁹⁰
nieuwbouw-huysackers.nl	Nieuwbouw Huysackers Veldhoven	The new construction plan creates a new village with the characteristics of traditional Brabant villages.	House Types → Houses ²⁵⁴⁶ Context ¹⁶¹³⁹⁴	brabant ²³⁵ plot ¹⁰⁵¹ home ⁷⁹⁷⁶ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	North-Brabant → Veldhoven ¹⁴⁸⁵
ondernemersverenigingdwwz.nl	Ondernemersvereniging DWWZ	DWWZ represents the entrepreneurs in the villages of Doldersum, Wateren, Oude Willem and Zorgvlied.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Organizations ⁶⁸³	community ⁷⁹³¹ association ⁸⁵⁶² collaboration ¹⁶⁰³⁶	Westerveld → Old Willem ¹⁸
voorhoutonderneemt.nl	Business Platform Teylingen	Voorhout is described as a ‘vibrant village’ (bruisend dorp), emphasizing its lively atmosphere and community spirit.	Radio → Local Radio ²⁹¹ Economy → Local Economy & Development ⁷²¹	station ⁴²⁰ shop ⁶⁴⁸³ municipality ⁶⁸³⁷ event ⁴⁵¹⁹⁹	Almere → Almere City ⁹³⁴
wyjouwegjinkrimp.nl	Wim Beckers	The project focuses on a specific village, Witmarsum, which is grappling with the problems of decline and population loss.	Theater → Performances ⁶⁴⁹ Social Issues & Welfare → Social Issues ¹⁸⁵⁴⁴	play ⁶³¹ love ¹²⁴⁰
kommekeer.nl	Kommekeer	The initiative ‘Kommekeer’ specifically focuses on improving the livability of the village of Mariahout.	Social Issues → Livability ¹⁰ Local Government → Village Council ⁴⁷⁹	livability ²³⁰ initiative ¹²⁹⁷ resident ³²⁴⁵ newsletter ⁶⁵⁰⁴	Laarbeek → Mariahout ¹⁰⁷
windfondsbijvanck.nl	Windpark Bijvanck Environmental Fund Stichting	The villages of Loil and Angerlo receive financial compensation from the windpark through the stichting.	Wind Energy → Wind Farms ⁶⁵ Local Government → Village Council ⁴⁷⁹	windpark ⁹⁶ stichting ⁴⁸¹ fund ¹⁰⁶³ resident ³²⁴⁵	Montferland → Didam ⁷⁵⁹
ooijpolderonline.nl	Ooijpolder online	The website provides a central access point to the individual websites of the six villages in the Ooijpolder, allowing users to easily find the information and links they need.	Local Communities → Villages ¹⁰⁰⁵ Landscape → Polders ²¹²	connection ⁴⁰⁰⁷ nature ⁹⁰⁹⁴	Berg en Dal → Leuth ⁷⁴
kieldiepgang.nl	B&B Kieldiepgang	Kiel-Windeweer is an old and characteristic village, designated as a European protected village.	Accommodation → Guesthouses ⁷²⁶ Accommodation → Holiday Homes ⁷²⁷	peat ³² guest accommodation ⁵⁸	Midden-Groningen → Kropswolde ⁶⁸
1odijk.nl	1 Odijk	The village of Odijk is at the center of the concerns of the group of citizens managing the website, who are worried about the impact of the road connection.	Local Governance → Local Politics ²⁵⁵⁹ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	sound barrier ¹² housing development ¹³⁰ community ⁷⁹³¹	Bunnik → Odijk ²³²
hooghofzeijen.nl	Stichting Hooghof	The farm also houses the village library, playing an important role in the community.	Local Communities → Villages ¹⁰⁰⁵ Institutions → Libraries ⁴⁰²	library ⁹⁸⁸ farm ²⁶²² accommodation ⁴⁹²¹ book ¹¹³⁹⁶ garden ¹³¹²⁹	Tynaarlo → Zeijen ⁴⁸
henkscholtenfonds.nl	Henk Scholten Fonds	The foundation focuses on the villages of Vasse, Mander and Hezingen.	Volunteering → Community Initiatives ⁵²³ Village Focus → Village Organizations ⁶⁸³	grant ¹⁰² foundation ⁶⁶⁷⁸ community ⁷⁹³¹	Tubbergen → Vasse ⁶⁵
kantens.nl	Kantens	Kantens is a small village, which forms the core of the municipal activities.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	municipality ⁶⁸³⁷ association ⁸⁵⁶²	Het Hogeland → Kantens ¹⁹
vkknoordbrabant.nl	Vereniging Kleine Kernen Noord-Brabant	The association focuses on the development and well-being of villages in North Brabant.	Associations → Village Associations ¹⁵² Local Government → Village Council ⁴⁷⁹	livability ²³⁰ initiative ¹²⁹⁷ vitality ¹⁷²⁶ member ¹⁰¹⁵⁴	Netherlands → North-Brabant ⁷³³⁴¹
markustotaaladvies.nl	Markus Totaal Advies	Ja’akov Markus aims to create a global network of ecological villages that serve as inspiring incubators for the New Economy.	Economy & Finance → Economics ¹¹¹⁵ Social Issues → Participation ¹⁰²³	medicine ⁴³⁵ economy ⁶⁸² advisor ¹⁰⁵⁵ network ¹¹¹²³	Stichtse Vecht → Maarssen ¹⁰⁵¹
oud-zevenaar.nl	Municipality of Zevenaar	Oud-Zevenaar is a village with a rich history and preserved historic character.	Local History → Dutch History ¹⁰⁶⁷ Local Communities → Villages ¹⁰⁰⁵	windmill ²⁴⁹ castle ⁴⁹⁴ church ³⁴³⁹ history ⁷²⁸⁶ school ⁷⁸⁵⁶	Zevenaar → Oud-Zevenaar ²⁹
koningsbosch.nl	WBCE	Koningsbosch is a village with a strong religious history and community focus.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	photo archive ⁵⁵ municipality ⁶⁸³⁷ care ¹²³³⁸ news ¹⁵²⁹³	Echt-Susteren → Koningsbosch ⁴⁹
hoefenhaag.nl	Hoef en Haag	Hoef en Haag is presented as a complete new development village with 1800 homes, providing a community and facilities.	Property Location & Neighborhood → Residential ⁸⁵¹	housing supply ⁶⁴ district ³⁷¹ housing ⁴³⁷⁸ sustainability ¹⁸⁴⁵¹	Vijfheerenlanden → Hagestein ⁶⁰
centraledorpenraad.nl	Stichting Centrale Dorpenraad Landelijk Noord	The site is specifically focused on the five villages: Durgerdam, Holysloot, Ransdorp, Schellingwoude, and Zunderdorp.	Local Government → Village Council ⁴⁷⁹ Curriculum & Resources → Educational Content ⁷²	dike reinforcement ¹³ zoning plan ¹⁸⁶ resident ³²⁴⁵ news ¹⁵²⁹³	Amsterdam → Zunderdorp ⁷³¹
pb-ouwstertrijegeaen.nl	Plaatselijk Belang Ouwster-Trijegeaën	The website specifically focuses on the three villages of Ouwster-Nijega, Oldeouwer, and Ouwsterhaule.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Organizations ⁶⁸³	photo ⁷⁷⁷⁸ association ⁸⁵⁶² news ¹⁵²⁹³	Friesland → De Fryske Marren ²⁹²¹
hoonhorst.nl	Plaatselijk Belang Hoonhorst	Hoonhorst is a small village with approximately 1800 inhabitants located in the Dalfsen municipality.	Local Communities → Villages ¹⁰⁰⁵	schedule ²⁶²⁴ history ⁷²⁸⁶ community ⁷⁹³¹ nature ⁹⁰⁹⁴	Overijssel → Dalfsen ¹⁰⁹⁹
hansheijnenfilms.nl	Hans Heijnen Films	His films document the lives and social dynamics in Dutch villages.	Organizations → Society ⁷⁶⁷ Film → Documentaries ⁸¹³	documentary ¹⁰⁸¹ society ¹³⁷⁶ culture ³⁹²² history ⁷²⁸⁶	Meerssen → Bunde ¹¹³
bvhooglanderveen.nl	Hooglanderveen Residents’ Association	The Hooglanderveen Residents’ Association is committed to preserving the village character of Hooglanderveen, particularly through the presence of the church and the Green Zoom.	Village Focus → Village Organizations ⁶⁸³ Context → Environment ⁵⁴⁴³⁷	resident ³²⁴⁵ municipality ⁶⁸³⁷ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Amersfoort → Hooglanderveen ¹²⁵
lytsewierrum.nl	N/A	Lytsewierrum is a small village with only 22 residents in the built-up area.	Local Communities → Villages ¹⁰⁰⁵ Recreation → Theme Parks & Entertainment ⁸²⁵⁴	windmill ²⁴⁹ document ¹⁶⁷⁸ paintings ³⁹⁰⁷ history ⁷²⁸⁶ photography ⁹⁵⁰³	Southwest-Friesland → Sneek ¹⁹²¹
nisse-info.nl	Gemeente Borsele	The website details the village of Nisse and serves as an information resource for visitors.	Local Communities → Villages ¹⁰⁰⁵ TravelContent → Travel Guides ⁹³⁸	sight ⁸⁰ history ⁷²⁸⁶ association ⁸⁵⁶²	Borsele → Nisse ³⁶
westenesch.nl	Dorpsbelangen Westenesch	Westenesch is a small village in Drenthe with approximately 180 inhabitants.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Organizations ⁶⁸³	dorpsbelangen ¹⁵ agenda ⁴³⁷⁴ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Drenthe → Emmen ³³⁴⁸
fryskeflinterfonds.nl	Fryske Flinter Fonds	The projects and activities of the fund are targeted towards the villages of Oosterbierum, Sexbierum, Pietersbierum and Klooster-Lidlum.	Cooperatives → Energy Cooperatives ³¹⁵ Village Focus → Village Organizations ⁶⁸³	dorpsbelang ¹² energycooperative ¹⁶⁰ fund ¹⁰⁶³	Waadhoeke → Oosterbierum ²³
oudtullentwaal.nl	oudtullentwaal.nl	The text discusses the origin and location of the village Molenbuurt in Tull.	Water → Rivers ¹⁸⁰ Conferences & Meetings → Meeting Venues ⁷²⁹	fort ¹¹⁶ dike ¹⁴⁸ river ³¹² municipality ⁶⁸³⁷ history ⁷²⁸⁶	Houten → Tull and 't Waal ⁴¹
het-vlaemsche-erfgoed.nl	Het Vlaemsche Erfgoed	The Vlaemsche Erfgoed provides a detailed picture of the historical agricultural village of Groede, which is central to the presentation.	Local History → Dutch History ¹⁰⁶⁷ Visual Arts → Museums ²⁰⁴⁹	floor plan ³⁹⁴ gallery ¹⁹⁸³ museum ²⁰⁰²	Zeeland → Zeeuws-Vlaanderen ⁶⁷⁷
dorpbaard.nl	Jeroen van Denderen & Claudia Hogerhuis	The website is specifically focused on the village of Baard in Friesland.	Local & Regional → Local News Websites ³⁵⁸ Village Focus → Village Life ²⁶²	newsletter ⁶⁵⁰⁴ foundation ⁶⁶⁷⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Netherlands → Friesland ²⁷⁹¹¹
bokd.nl	BOKD	Villages serve as centers for community activities and provide facilities for residents.	Nonprofits → International Development ⁴²⁰	story ⁸²⁸⁵ energy ⁹⁰⁷⁵ news ¹⁵²⁹³ workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹	Drenthe → Assen ³⁵¹⁶
benbdewetenschap.nl	Bed & Breakfast De Wetenschap	Kruisland is a small, cozy village with a rich history.	Accommodation → Guesthouses ⁷²⁶ Cycling → Cycling Routes ¹⁰⁰²	pastoral ⁴⁹ monument ¹¹⁶⁸ breakfast ¹⁸²² room ³⁴¹¹ garden ¹³¹²⁹	Steenbergen → Kruisland ⁶⁴
myzwolle.nl	Stichting MYzwolle	The first project focuses on the village of Luch in the Mykolaiv region, followed by the planning of further villages.	Charities → International Aid ⁸⁵⁸ Foundations → Local Foundations ¹⁰	drinking water ⁷¹ ukraine ¹³¹ water ²⁵⁰¹	Overijssel → Zwolle ⁷³⁹⁵
stichtingspec.nl	SPEC Stichting Promotie Emmer Compascuum	The foundation’s goal is to make the village of Emmer Compascuum lively and atmospheric.	Local Communities → Villages ¹⁰⁰⁵ Business Associations → Local Business Associations ¹⁹²	st. nicholas ¹⁹ agenda ⁴³⁷⁴ volunteer ⁸³⁶⁷ event ⁴⁵¹⁹⁹	Emmen → Emmer-Compascuum ¹⁴⁴
gainwaterprojecten.nl	GAiN	GAiN’s projects focus on providing villages with access to clean water, improving the living environment and health.	International Aid → Development Aid ⁴⁰¹ Water → Drinking Water ¹¹	water pump ⁶³ sponsors ²⁶⁴²
welkominwoudsend.nl	Woudsend Promotie	The village of Woudsend is characterized by restored buildings and narrow alleys, creating a special atmosphere.	Local Communities → Villages ¹⁰⁰⁵ Places → Towns ³⁸⁰	street ²⁸¹ marina ⁴⁸⁷ watersport ⁵⁴⁰ event ⁴⁵¹⁹⁹	Netherlands → Friesland ²⁷⁹¹¹
rijsbergendigitaal.nl	Rijsbergen Digitaal	The website centers around the activities and engagement within the village of Rijsbergen.	Local & Regional → Local News Websites ³⁵⁸ Local Events → Municipal Events ⁸³	council ⁴²⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Zundert → Rijsbergen ²³⁸
folsgeare.nl	Stichting dorpshuis	Folsgeare is a village located in Friesland province.	News & Journalism → Regional News ⁹⁴⁸	dyke ²⁰ housing development ¹³⁰ municipality ⁶⁸³⁷ association ⁸⁵⁶²	Southwest-Friesland → Sneek ¹⁹²¹
zonnewijzerroutegeldermalsen.nl	Stichting Zonnewijzerroute Geldermalsen	The route aims to create a unique sundial in each village of the former municipality of Geldermalsen.	Food & Dining → Hiking Routes ³⁹ Nature → Forest ³⁸⁷	sundial ¹³ comments ⁷⁴ route ³⁴²⁵ foundation ⁶⁶⁷⁸	West-Betuwe → Buurmalsen ⁵²
visitregiobarneveld.nl	Visit Regio Barneveld	The Barneveld region comprises nine different villages, each with its own character and attractive sights.	News & Journalism → Regional News ⁹⁴⁸ Context ¹⁶¹³⁹⁴	region ⁵⁴¹² event ⁴⁵¹⁹⁹	Barneveld → De Glind ⁴⁹
kerknieuwbeerta.nl	Kerk Nieuw Beerta & Stichting Oude Groninger Kerken	Nieuw Beerta is a village that originated from poldering and has experienced disasters throughout its history.	Local Government → Village Council ⁴⁷⁹	church ³⁴³⁹ foundation ⁶⁶⁷⁸ history ⁷²⁸⁶	Oldambt → Nieuw Beerta ¹⁶
archiscienza.nl	ArchiScienza	The foundation has adopted the village of Krewerd in Groningen and is working on the development of this village.	Municipalities → Governance ¹⁰⁴³ Culture → Science ⁵²⁶¹	science ⁴⁹¹ architecture ³²²³	Eemsdelta → Krewerd ¹²
monumentenboz.nl	Municipality of Bergen op Zoom	The website focuses on listing and describing historical, small residential areas known as villages.	Local History → Historical Places ⁶⁰ Museums & Collections → Archaeology ²⁹¹	archaeology ²⁵⁶ municipality ⁶⁸³⁷ history ⁷²⁸⁶	Bergen op Zoom → Halsteren ²⁹⁸
oppadinlith.nl	MFA De Snoeck	Lith is a historic village located on the Maas River, with a long and interesting history.	Hiking → Walking Routes ²²⁶ Local Communities → Villages ¹⁰⁰⁵	walking route ³⁴⁰ history ⁷²⁸⁶	Oss → Lith ¹²⁷
voortvarendvoorst.nl	Voortvarend Voorst	Each village within the municipality receives a village budget to finance activities.	Local Politics → Governing Bodies ²⁰⁰	council ⁴²⁶ position ⁸⁷⁵ budget ¹³³⁵ resident ³²⁴⁵	Gelderland → Voorst ¹¹³⁸
kerstsfeeraartswoud.nl	Stichting Kerstsfeer in Aartswoud	The village of Aartswoud is temporarily transformed into a Christmas shopping village.	Christmas → Christmas Markets ¹⁶⁴ Village Focus → Village Life ²⁶²	event ⁴⁵¹⁹⁹	Opmeer → Aartswoud ³⁶
kessel-eik.nl	Gemeente Peel en Maas	Kessel-Eik is a village with a rich history, located in the Peel and Maas municipality.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	natural area ²⁰⁸ community center ⁴⁴² monument ¹¹⁶⁸ event ⁴⁵¹⁹⁹	Peel and Maas → Kessel ¹⁶²
eerdeopdekaart.nl	Eerde op de kaart	Eerde is a small, charming Brabant village with a close-knit community and a vibrant local government.	Travel Guides → Regional Travel Guides ⁸⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	reunion ²⁶⁷ map ⁸⁰¹ history ⁷²⁸⁶ association ⁸⁵⁶² nature ⁹⁰⁹⁴	North-Brabant → Meierijstad ²⁸⁸⁷
hendrikshinzen.nl	Hendriks-Hinzen	The Western Village village is a unique and custom solution for events.	Outdoor → Play Equipment ³¹³ Children’s Activities → Playgrounds ⁷⁰²	furnishing ²⁹² attraction ¹²⁷⁵ decoration ⁴⁰⁸⁵ event ⁴⁵¹⁹⁹
dossieratlantis.nl	Municipality of Rotterdam	The website is about the disappearance of the villages of Blankenburg and Nieuwesluis.	Local History → Dutch History ¹⁰⁶⁷ Specialized History → Industrial History ²⁹³	expropriation ⁴⁶ port ³²⁴ industry ¹⁷⁸⁰	Hollands Kroon → Wieringerwaard ⁷⁸
mensenvandendolder.nl	mensenvandendolder.nl	The stories are specifically connected to the village of Dolder and its activities.	News & Journalism → Local News ⁴⁸⁸ Topics → People ⁵⁴⁴	resident ³²⁴⁵ church ³⁴³⁹ community ⁷⁹³¹ story ⁸²⁸⁵
sautens.nl	Sautens.nl	Sautens is a charming village, an alternative to the more expensive, well-known ski resorts.	Europe → Austria ²⁴⁹ Winter Sports → Snowboarding ¹⁷⁹	winter ³³³ summer ⁴⁸³
dorpsraadbeinsdorp.nl	Beinsdorp Village Council	Beinsdorp is a small village located in the tulip fields of the Netherlands, known for its close-knit community.	Local Government → Village Council ⁴⁷⁹ Events → Places ¹²¹⁹	whatsapp ³⁸² newsletter ⁶⁵⁰⁴ community ⁷⁹³¹ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Haarlemmermeer → Beinsdorp ⁴¹
oranjecircuit.nl	De Spartaan	Each village run offers a relaxed atmosphere and distances of 6.5 to 7.5 kilometers.	Running → Running Events ⁶⁸⁴	circuit ³⁴² anniversary ⁶⁷⁰ run ⁸⁰⁰ sponsors ²⁶⁴²	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
geworteld013.nl	Geworteld013	The website focuses on the history of Hooge Mierde, Lage Mierde and Hulsel.	Municipalities → Peel ⁷² Internet → Archives ⁴²²	pdf ¹⁴² address ⁹⁰¹ archive ²⁰⁶⁷	Reusel-De Mierden → Lage Mierde ⁸⁰
parochiedgh.nl	Parochie De Goede Herder	The villages of Heesch, Geffen, Nistelrode, Nuland, Vinkel, and Vorstenbosch are the locations where the parish is active.	Catholic → Parishes ⁴⁵⁷ Local Communities → Villages ¹⁰⁰⁵	faith community ⁴⁹ sacraments ⁸⁹ parish ³⁵³ church ³⁴³⁹	Bernheze → Nistelrode ²³⁸
dorpsraadvelden.nl	Dorpsraad Velden	The core of the Dorpsraad's activities is the preservation and improvement of the village of Velden.	Local Governance → Local Politics ²⁵⁵⁹ Neighborhood Focus → Community Affairs ⁹⁵	dorpsraad ²⁸ working groups ¹⁷¹ livability ²³⁰ news ¹⁵²⁹³	Venlo → Velden ¹¹⁸
laat-empe-empe.nl	Laat Empe Empe	Laat Empe Empe is an initiative committed to preserving the character of the village of Empe.	Local Governance → Local Politics ²⁵⁵⁹ Social Issues → Participation ¹⁰²³	village vision ²⁷ housing development ¹³⁰ participation ¹⁴³⁰ municipality ⁶⁸³⁷	Brummen → Empe ⁵¹
sukarela.nl	Stichting Sukarèla Dian Darat	The village of Dian, located in Kei Kecil, is a small, self-sufficient village with limited infrastructure, but where the community works together for the common good.	Nonprofits → International Development ⁴²⁰	donor ⁷⁵⁷ tax ²¹⁰⁰ foundation ⁶⁶⁷⁸	North-Holland → Den Helder ¹⁸⁸⁶
gemeenschapsbelangen-azelo.nl	Stichting Gemeenschapsbelangen (groot) Azelo	The village of Azelo is the area where Stichting Gemeenschapsbelangen (groot) Azelo carries out its activities.	Local Communities → Villages ¹⁰⁰⁵ Organizations → Society ⁷⁶⁷	livability ²³⁰ wellbeing ²⁶²⁰ foundation ⁶⁶⁷⁸	Hof van Twente → Delden ⁴⁴²
gildederlagelanden.nl	't Gilde der Lage Landen	The organization focuses on enhancing the livability of the villages of Rijpwetering and Oud Ade.	Village Focus → Village Organizations ⁶⁸³ History → Historical Events ²⁰⁵		Kaag en Braassem → Oud Ade ⁴⁶
boskoopinbeeld.nl	Ad Spruijt Fotografie	Boskoop retains its character as a friendly village amidst the Randstad, and this is effectively shown in the project’s photographs.	Plants → Nurseries ¹⁰¹² Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	season ⁶⁹² nursery ⁹²⁶ photo ⁷⁷⁷⁸ photography ⁹⁵⁰³	Alphen aan den Rijn → Boskoop ⁶⁵²
stichtingavondzon.nl	Stichting Avondzon	The housing is rented in the villages of Zuidbroek and Noordbroek.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Sustainable Living → Housing Associations ³²⁵	seniors ⁹⁰⁴ housing ⁴³⁷⁸ region ⁵⁴¹² foundation ⁶⁶⁷⁸	Oldambt → Winschoten ⁸³⁰
tvransdaal.nl	tvransdaal.nl	Ransdaal is a small village in the valley, rich in history and with a lively association life.	Local Communities → Villages ¹⁰⁰⁵ Local Government → Village Council ⁴⁷⁹	cow ⁵⁹⁶ tradition ⁷³⁶ festival ³⁸⁰⁴ association ⁸⁵⁶²	Voerendaal → Ransdaal ²⁸
vp-baarle.nl	VPB	It describes a village as a meeting place where people can live, work, and recreate, and emphasizes the importance of considering human interests.	Village Focus → Village Organizations ⁶⁸³	association ⁸⁵⁶²
welkomstbordengve.nl	Gericht Voor Elkaar	The projects take place in Velp, Escharen, and Gassel, which together form the three church villages.	Local Government → Village Council ⁴⁷⁹ Initiatives & Projects → Nonprofits ⁷⁵⁰	foundation ⁶⁶⁷⁸	Land van Cuijk → Escharen ⁴⁸
gobk.nl	Stichting Geef om Beekse Kernen	The foundation is primarily focused on supporting the livability of specific villages in the Beekse Kernen.	Local History → Village History ³⁰ Historical Sites → Monuments ¹⁰²⁷	initiative ¹²⁹⁷ donation ⁵¹¹⁰ community ⁷⁹³¹ association ⁸⁵⁶²	North-Brabant → Hilvarenbeek ⁸⁴³
casapinna.nl	L. Passer	Donori is described as a small, picturesque Italian village with a charming atmosphere.	Italy → Sardinia ²⁷ Art Management & Sales → Art Projects ²⁶	sardinia ⁴² beach ³²¹⁰ wine ⁴⁴⁷⁶
geensteeninhetveen.nl	Geen Steen In Het Veen	The website is specifically focused on the village of Bavel and the specific challenges and opportunities it faces.	Initiatives & Projects → Nonprofits ⁷⁵⁰ Village Focus → Village Life ²⁶²	advocacy ³⁵⁷ testimonials ⁴¹⁶ board ³⁴³⁸ nature ⁹⁰⁹⁴	Breda → Bavel ²⁶⁴
baswienen.nl	Hoef en Haag	The project includes 1800 homes in total.	Property Location & Neighborhood → Residential ⁸⁵¹ Village Focus → Village Life ²⁶²	residential ²¹⁶ new construction ²⁶⁷² home ⁷⁹⁷⁶	Vijfheerenlanden → Hagestein ⁶⁰
ondernemersvereniginggemonde.nl	Sint-Michielsgestel Municipality	Gemonde is a village located in North Brabant with a rich history as a merger of four different nuclei.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Context ¹⁶¹³⁹⁴	river ³¹² carnival ⁹⁸⁶ church ³⁴³⁹ municipality ⁶⁸³⁷ school ⁷⁸⁵⁶	Meierijstad → Schijndel ⁹⁰⁸
tribalwars.nl	Innogames	In Tribal Wars and other games, players start by managing a small village.	Computer Games → Strategy ³² Games → Simulation Games ¹⁸	empire ²³ alliance ⁴⁶ city ¹⁸⁷⁵ game ²⁸⁰⁷
dorpshistorie.nl	Genealogie en Historie	The focus is on the history and development of the diverse villages in Drenthe.	Genealogy & Family History → Dutch Genealogy ⁷⁰	coat of arms ⁴² resources ³¹⁰ genealogy ⁵⁴³ family ⁶⁴⁶² history ⁷²⁸⁶	Emmen → Nieuw-Amsterdam ¹⁴⁹
dorpsplatform-prinsenbeek.nl	Dorpsplatform Prinsenbeek	Prinsenbeek is a village where the Dorpsplatform Prinsenbeek (DPP) is active and committed to improving its livability.	Social Issues → Livability ¹⁰ Local Government → Village Council ⁴⁷⁹	mobility ¹²⁶⁴ resident ³²⁴⁵ care ¹²³³⁸ sustainability ¹⁸⁴⁵¹	Breda → Prinsenbeek ³⁰²
hk-kortenhoef.nl	Historische Kring ,,In de Gloriosa”,	The association focuses on the history of the villages of Ankeveen, ‘s-Graveland and Kortenhoef.	Local Communities → Villages ¹⁰⁰⁵ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	objects ⁴²⁶ archive ²⁰⁶⁷ association ⁸⁵⁶²	Wijdemeren → 's-Graveland ¹⁹⁶
gietersbelang.nl	Vereniging Dorpsbelangen Giethoorn ‘t Gieters Belang	‘t Gieters Belang is an association of and for Giethoorn, with the goal of protecting and improving this village.	Local Governance → Local Politics ²⁵⁵⁹ Local Communities → Villages ¹⁰⁰⁵	livability ²³⁰ tourism ³⁰³ interest ⁹¹¹ safety ⁵⁸¹⁹ sustainability ¹⁸⁴⁵¹	Steenwijkerland → Giethoorn ⁵⁶⁵
kinderhulpoekraine.nl	Stichting Kinderhulp Oekraïne	The organization works closely with villages such as Brandwijk and Molenaarsgraaf in the reception of refugees.	Social Organization → Child Welfare ¹¹⁴⁷ Village Focus → Village Organizations ⁶⁸³	refugees ³⁴⁰ family ⁶⁴⁶² child ¹¹⁵⁶⁶	Molenlanden → Brandwijk ⁵¹
itbraakhok.nl	Vlasmuseum It Braakhok	Ie has a protected village character, highlighting the historical architecture and the picturesque atmosphere of the village.	Museums → Agricultural Museums ²⁵ Culture → Regional Culture ²³	flax ²⁸ demonstration ³⁷⁷ museum ²⁰⁰² volunteer ⁸³⁶⁷	Northeast-Friesland → Ia ⁴⁰
marrumonline.nl	Marrum Online	Marrum is a Frisian terp village and part of the Leeuwarden municipality, home to approximately 1400 residents and offering a variety of amenities.	Local Communities → Villages ¹⁰⁰⁵ Radio & Communication → Networks ³⁴¹	agenda ⁴³⁷⁴ association ⁸⁵⁶² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Northeast-Friesland → Marrum ³⁸
vrouger.nl	Cultural Historical Association of Ten Boer (CHVTB)	The site presents information about the different villages within the municipality of Ten Boer and their unique histories.	Local Communities → Villages ¹⁰⁰⁵ Monuments → Heritage ⁵²⁶	monument ¹¹⁶⁸ publication ²⁰¹⁸ route ³⁴²⁵ history ⁷²⁸⁶	Groningen → Ten Boer ¹⁴⁰
dorp-engwierum.nl	Editorial Team	Engwierum and Dokkumer Nieuwe Zijlen are twin villages in Friesland.	Local Government → Municipalities ³⁰²⁶ Nature → National Parks ⁸⁹⁸	recreation ⁷⁹⁹ municipality ⁶⁸³⁷ association ⁸⁵⁶²	Northeast-Friesland → Ingwierrum ²⁸
vierlingsbeek-groeningen.nl	Gemeente Land van Cuijk	Vierlingsbeek and Groeningen are two villages closely linked together and offering information on this website.	Municipalities → Land Van Cuijk ¹¹ Accommodation → Guesthouses ⁷²⁶	recreation ⁷⁹⁹ municipality ⁶⁸³⁷ history ⁷²⁸⁶ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Peel and Maas → Baarlo ⁴⁴²
oud-quadyck.nl	Oud-Quadyck	The website specifically focuses on the village of Kwadijk and its history.	Historical Sites → Monuments ¹⁰²⁷ Museums & Collections → Archaeology ²⁹¹	archaeology ²⁵⁶ society ¹³⁷⁶ history ⁷²⁸⁶ story ⁸²⁸⁵	Netherlands → North-Holland ⁹²⁹⁵⁶
hemelum.nl	Gemeente Súdwest-Fryslân	Hemelum is a small village in Friesland, known for its history and landscape.	Municipalities → Súdwest-Fryslân ¹¹ Local Communities → Villages ¹⁰⁰⁵	landscape ²⁶⁰⁹ facility ²⁶¹⁶ history ⁷²⁸⁶	Southwest-Friesland → Hemelum ³⁶
dorpsbelangenhellum.nl	Vereniging Dorpsbelangen Hellum	The Vereniging Dorpsbelangen Hellum is an organization committed to representing the interests and livability of the village of Hellum.	Associations → Village Associations ¹⁵² Local Government → Village Council ⁴⁷⁹	livability ²³⁰ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Midden-Groningen → Hellum ³³
decrommeleeck.nl	Historical Society De Cromme Leeck	The society specifically focuses on the history of the three aforementioned villages.	Local Government → Village Council ⁴⁷⁹ Social Sciences → Genealogy & Family History ¹⁴⁰³	document ¹⁶⁷⁸ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Dijk en Waard → Heerhugowaard ²⁰¹¹
dezuidlanden.nl	Projectbureau De Zuidlanden	The website informs about the diverse villages that make up De Zuidlanden, each with its own characteristics.	Local Communities → Villages ¹⁰⁰⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	facility ²⁶¹⁶ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
laag-soeren.nl	N/A	Laag-Soeren is a small village located on the Veluwezoom, which presents itself as a vibrant community.	Local Communities → Village Communities ¹²¹ Village Focus → Village Organizations ⁶⁸³	kulturhus ⁵⁰ bulletin board ⁵⁷ history ⁷²⁸⁶ association ⁸⁵⁶² music ¹³¹⁷⁰	Rheden → Laag-Soeren ⁹⁸
groenveld-dorp.nl	Groenveld	Groenveld is a small village with approximately 175 inhabitants and a unique culture.	Specialized History → Industrial History ²⁹³ Local Communities → Villages ¹⁰⁰⁵	mill ⁴⁸⁷ history ⁷²⁸⁶ photo ⁷⁷⁷⁸	Schagen → Sint Maarten ³⁶
haor.nl	HAOR	The site is focused on informing the residents of the village of Horn.	Local Communities → Village Communities ¹²¹ News & Journalism → Local News ⁴⁸⁸	announcement ¹¹⁵ photo ⁷⁷⁷⁸ association ⁸⁵⁶² news ¹⁵²⁹³	North-Holland → Hoorn ³⁰⁹⁰
historischeverenigingoosthuizen.nl	Historische Vereniging Oosthuizen	The association operates and focuses exclusively on the four villages of Eetersheim, Hobrede, Oosthuizen, and Schardam.	Associations & Societies → Music Associations ¹⁰⁰³ Local Communities → Villages ¹⁰⁰⁵	exhibition ⁵³³² history ⁷²⁸⁶ association ⁸⁵⁶² news ¹⁵²⁹³	Purmerend → Overwhere Noord ¹⁷
ressenonline.nl	Ressen Online	Ressen is a historic church village with a long history dating back to the beginning of the first century AD.	Local Politics → Parties ⁶²²	community center ⁴⁴² church ³⁴³⁹ municipality ⁶⁸³⁷ history ⁷²⁸⁶	Lingewaard → Ressen ³⁵
kwaliteitvanonderwijs.nl	Krommenie	Heeswijk-Dinther is described as a charming village with historical allure, identifying the location as a key element of the content.	Accommodation → Holiday Parks ¹⁰²⁴ News & Journalism → Regional News ⁹⁴⁸	nature park ⁵⁶ municipality ⁶⁸³⁷ history ⁷²⁸⁶ nature ⁹⁰⁹⁴ news ¹⁵²⁹³	Venlo → Tegelen ³²⁴
naoberzorgnederland.nl	Stichting Naoberzorg Nederland	The foundation focuses on activities within villages and neighborhoods.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	neighborhood ²⁴²⁴ volunteer ⁸³⁶⁷
neutrinofilm.nl	Hannee van den Bergh and Jan van den Berg	The documentary portrays the daily life and traditions of the villagers living near the Super-Kamiokande Neutrino Detector.	Philosophy → Existentialism ⁴⁰ Film → Documentaries ⁸¹³	detector ⁴⁵ film ³⁰⁰⁷
toeristischtraaie.nl	Fanatiek Media	Terheijden is a small Brabant village presented by Toeristisch Traaie.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Organizations ⁶⁸³	attraction ¹²⁷⁵ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Drimmelen → Terheijden ¹⁷⁸
dorpspleindiepenveen.nl	Ondernemersvereniging Diepenveen	Diepenveen is a village with a lively community, as evidenced by the events and attention given to local businesses.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Life ²⁶²	agenda ⁴³⁷⁴ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Deventer → Diepenveen ¹⁸⁷
roden.nl	Roden	Roden is officially a village in Drenthe, with a unique history and charming character.	Municipalities → Dutch Municipalities ⁵¹⁶ Local Communities → Villages ¹⁰⁰⁵	hospitality ³⁴⁹¹ culture ³⁹²² shop ⁶⁴⁸³ event ⁴⁵¹⁹⁹	Noordenveld → Roden ⁶²¹
hetgroenelint.nl	Het Groene Lint	The foundation connects schools in seven different villages: Alphen, Baarle-Nassau, Bavel, Chaam, Galder, Riel and Ulicoten.	International Aid → Development Aid ⁴⁰¹	foundation ⁶⁶⁷⁸ school ⁷⁸⁵⁶ network ¹¹¹²³ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Baarle-Nassau → Ulicoten ⁴⁶
dorpsraadgorssel.nl	Dorpsraad Gorssel	The website focuses on the village of Gorssel and the involvement of its residents in its future.	Local Politics → Municipal Council ⁴⁸⁴ Local Communities → Villages ¹⁰⁰⁵	council ⁴²⁶ governance ⁶¹⁰ resident ³²⁴⁵	Lochem → Gorssel ²⁸³
lopiknatuurlek.nl	Stichting De Utrechtse Waarden	Lopik is a region of nine villages, each with its own identity.	Cycling → Cycling Routes ¹⁰⁰² Regions → Regional Guides ⁵²	local products ⁷¹ route ³⁴²⁵ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Lopik → Cabauw ¹⁸
dewiekermeule.nl	Stichting De Wieker Meule	The mill is the central hub of the village of De Wijk.	Historical Sites → Mills ²²⁹ Village Focus → Village Life ²⁶²	miller ⁷³ mill ⁴⁸⁷ donor ⁷⁵⁷ history ⁷²⁸⁶	De Wolden → De Wijk ⁹⁶
nazomereninniedorp.nl	Nazomeren in Niedorp	The event takes place in nine villages within the municipality of Hollands Kroon.	Social Issues → Participation ¹⁰²³ Art & Culture → Art Events ³²⁷	participant ¹⁹³⁴ art ³⁸⁵⁶ culture ³⁹²² garden ¹³¹²⁹	Hollands Kroon → Haringhuizen ¹⁶
deleemstee.nl	Nelleke Metselaar and Bouwe Taverne	The guesthouse is located in the village of Eext, a rural village.	Water → Rivers ¹⁸⁰ Accommodation → Country Estates ⁷³⁸	guesthouse ²⁰⁹ farmhouse ⁸⁷⁸ bed ¹³⁸⁴	Aa en Hunze → Eext ⁷⁸
ermerhoek.nl	Gastenverblijf de Ermerhoek	Erm is a small village, meaning it traditionally is a farm community.	Hotels → Country Houses ¹⁷² Nature → National Parks ⁸⁹⁸	nature area ⁴⁹⁷ holiday ²²⁹⁵ route ³⁴²⁵ accommodation ⁴⁹²¹	Coevorden → Erm ⁴⁶
rondvaartderijp.nl	Rondvaart De Rijp	The villages of Graft and De Rijp, with their historical character, form the backdrop for the boat tours.	Water Travel → Boat Tours ⁶⁴⁰ Monuments → Cultural Heritage ⁵¹⁴	town hall ⁶² boat tour ⁹⁴ monument ¹¹⁶⁸ tour ²³¹⁵	Aa en Hunze → Spijkerboor ³²
prosliedrecht.nl	PRO Sliedrecht	Sliedrecht is described as 'a beautiful village by the river', highlighting the focus on the local community.	Political Parties → Dutch Political Parties ¹⁵⁸ Local Politics → Municipal Council ⁴⁸⁴	council ⁴²⁶ party ⁵⁹²⁸ member ¹⁰¹⁵⁴	South-Holland → Sliedrecht ⁸⁶³
deurnenu.nl	DeurneNU	The organization cherishes the uniqueness of the village centers and neighborhoods in Deurne.	Local Politics → Parties ⁶²²	inhabitant ¹⁹ politics ¹²⁵⁹ municipality ⁶⁸³⁷	North-Brabant → Deurne ¹³²⁹
rondjeoudeijsselstreek.nl	Atletico '73	The routes run through several villages in the Municipality of Oude IJsselstreek, including Ulft, Silvolde, Westendorp, Sinderen and Voorst.	Activity → Athletics ²⁶⁶	participant ¹⁹³⁴ course ¹⁴⁷²⁸	Oude IJsselstreek → Ulft ³⁹²
waddengemeente.nl	Waddengemeente Texel	The churches are located in the three villages of De Cocksdorp, Oosterend, and Oudeschild.	Reformed → Dutch Reformed Church ²¹⁹ Travel → Tourism ³⁷⁵⁴	church buildings ²¹ church service ⁸⁷⁹ church ³⁴³⁹ history ⁷²⁸⁶	North-Holland → Texel ²²⁰⁸
wegwijsinrhedenrozendaal.nl	Municipality of Rheden-Rozendaal	The website provides an overview of the different villages within the municipality of Rheden-Rozendaal.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Village Focus → Village Life ²⁶²	bulletin board ⁵⁷ financial support ⁷⁶ agenda ⁴³⁷⁴	Rheden → Laag-Soeren ⁹⁸
kunst-op-locatie.nl	Kunstcommissie Harenkarspel	The routes run through different villages within the former municipality of Harenkarspel, such as Warmenhuizen and Tuitjenhorn.	Hiking → Walking Routes ²²⁶ Galleries & Exhibitions → Art Routes ²¹⁵	art route ¹⁵³ commission ⁶⁰⁹ route ³⁴²⁵ art ³⁸⁵⁶ artist ⁵⁷⁴⁵	Schagen → Dirkshorn ¹⁰⁵
deoldehilde.nl	B&B de Olde Hilde	The farmhouse has served as a village hub over the years, including as a village house.	Nature → Nature Reserves ¹⁰³²	farmhouse ⁸⁷⁸ cycle ¹⁹⁰⁶ room ³⁴¹¹ nature ⁹⁰⁹⁴	Berkelland → Eibergen ⁴¹¹
gastvrijgrou.nl	Gastvrij Grou	Gastvrij Grou is a characteristic village in the municipality of Leeuwarden.	Local Communities → Villages ¹⁰⁰⁵ Nature → Nature Reserves ¹⁰³²	tourism ³⁰³ watersport ⁵⁴⁰ recreation ⁷⁹⁹ center ¹¹¹⁵ event ⁴⁵¹⁹⁹	Friesland → Leeuwarden ⁶⁰⁶⁸
hvhemony.nl	Historische Vereniging Hemony	The association encompasses the history of five specific villages: Avenhorn, De Goorn, Grosthuizen, Oudendijk and Scharwoude.	National Holidays → King’s Day ³⁸⁹	booklet ¹⁸² history ⁷²⁸⁶ association ⁸⁵⁶² membership ¹⁰⁴⁴²	Purmerend → Weidevenne ²⁷
amalfikust.nl	Amalfikust.nl	The Amalfi Coast hosts 13 UNESCO-protected villages, each with unique charm and history.	Italy → Campania ¹⁵ Vacations → Beach Vacations ⁸⁶⁶	city ¹⁸⁷⁵ beach ³²¹⁰ vacation ⁴²³⁴
nieuwsuitdorst.nl	Nieuws uit Dorst	The news stories and stories are specific to the village of Dorst.	Local & Regional → Local News Websites ³⁵⁸ Village Focus → Village Organizations ⁶⁸³	sponsorship ²⁶⁸⁶ association ⁸⁵⁶² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Oosterhout → Dorst ¹⁰²
keldonk.nl	Keldonk	‘Village’ refers to the village of Keldonk, used in a local, nostalgic context.	Local Communities → Villages ¹⁰⁰⁵ Local & Regional → Local Press ³⁰	municipal council ¹⁵⁸ agenda ⁴³⁷⁴ association ⁸⁵⁶² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Meierijstad → Erp ³⁰⁴
heemkundekringlith.nl	Heemkundekring Maasdorpen – Lith	The website focuses specifically on the history and culture of the villages ‘t Wild, Maren-Kessel, Lith, Lithoijen, Teeffelen, and Oijen.	Local Communities → Villages ¹⁰⁰⁵ Local Life → Local Culture ³⁸¹	walking route ³⁴⁰ lecture ¹⁶²⁴ archive ²⁰⁶⁷ history ⁷²⁸⁶ book ¹¹³⁹⁶	Oss → Lith ¹²⁷
alyzebos.nl	uitgeverij Clavis	She spent her childhood in a peaceful village in Friesland, which served as the backdrop for many of her early imaginative tales.	Books → Children’s Books ¹⁰⁴² Personal → Biography ¹⁰⁰³	poem ¹⁰¹⁴ story ⁸²⁸⁵ book ¹¹³⁹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
debruil.nl	Buurtvereniging de Bruil en Omstreken	The village of de Bruil is located in the municipality of Berkelland and is formally governed under Ruurlo.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	neighborhood association ¹⁷⁷ municipality ⁶⁸³⁷	Gelderland → Berkelland ¹⁵⁴⁶
hvvreewijk.nl	Huurdersvereniging Vreewijk	The Vreewijk garden village in Rotterdam is a protected cityscape and the primary focus of the Tenant Association.	Architecture → Urban Planning ¹⁴⁶⁵ Neighborhood Focus → Neighborhood Organizations ¹⁵⁹³	sale ⁵⁹³⁰ house ⁸¹²¹ association ⁸⁵⁶² member ¹⁰¹⁵⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
erfgoedtrynwalden.nl	Stichting Cultureel Erfgoed Trynwâlden	The website presents archives and photos of the villages of Oentsjerk, Gytsjerk, etc.	Archives → Local Archives ²³	photographs ²⁵⁴ archive ²⁰⁶⁷ collection ⁷⁵⁶⁶	Tytsjerksteradiel → Tytsjerk ²⁸
bblandelijkleur.nl	Bed & Breakfast Landelijk Leur	Leur is a small village in the Land of Maas and Waal, situated between the Maas and the Waal.	Accommodation → Group Accommodation ⁸⁴⁴ Nature → National Parks ⁸⁹⁸	quiet ²⁶ bed & breakfast ³¹⁹ sauna ¹¹⁷⁵ privacy ¹²⁸⁶ bedroom ²⁰⁵¹	Peel and Maas → Baarlo ⁴⁴²
toldiek.nl	Toldiek.nl	Toldijk is described as a small village with a limited population and a rich history.	Social Issues → Participation ¹⁰²³	housing ⁴³⁷⁸ municipality ⁶⁸³⁷ history ⁷²⁸⁶ association ⁸⁵⁶²	Nijkerk → Achterhoek ¹⁷³⁰
muziektheater-langweer.nl	Muziektheater Langweer	The piece takes place literally in the village of Langweer, with various locations used as a backdrop.	Theater → Outdoor Theater ⁷¹ Music & Performance → Music Events ⁷⁵⁸	fairy tale ⁶⁷ director ⁷¹⁶ theater ²⁵⁴⁴ performance ⁷⁵⁸⁶	Southwest-Friesland → Molkwerum ³⁰
dorpsverhalenkrommerijn.nl	Dorpsverhalen Kromme Rijn	The website focuses on the stories of the villages in the Kromme Rijn area.	Directories → Portals ³⁶⁹ Local Communities → Villages ¹⁰⁰⁵	canon ⁶⁷ castle ⁴⁹⁴ map ⁸⁰¹ brochure ¹⁶⁴² story ⁸²⁸⁵	Houten → Oud-Wulven ¹⁸
oudepostkantoorderijp.nl	Het Oude Postkantoor De Rijp	De Rijp is presented as one of the most beautiful villages in the Netherlands, with its historic canal houses and traditional Zaanse houses.	Historical Sites → Monuments ¹⁰²⁷ Hiking → Trails ³⁵⁶	pier ⁵⁸ room ³⁴¹¹ church ³⁴³⁹	Alkmaar → De Rijp ²²²
kernachtigwijchen.nl	Kernachtig Wijchen	Kernachtig Wijchen represents Wijchen and the eight surrounding villages: Alverna, Balgoij, Batenburg, Bergharen, Hernen, Leur, Niftrik and Woezik.	Local Politics → Parties ⁶²² Municipalities → Governance ¹⁰⁴³	think tank ²⁰ councilor ²¹ party ⁵⁹²⁸ member ¹⁰¹⁵⁴	Wijchen → Niftrik ³³
stichtinghvs.nl	Stichting HVS	The foundation operates in and supports the villages of Grou, Idaerd, Eagum, Reduzum, Friens, Warten, Wergea, Warstiens and Jirnsum.	Social Services → Youth Work ³⁵³ Youth Development → Youth ¹⁰³³	financial support ⁷⁶ young people ¹⁰⁴⁵ talent ³⁹⁸⁷ association ⁸⁵⁶²	Leeuwarden → Reduzum ²⁵
ondernemendlimmen.nl	Ondernemend Limmen	Limmen is presented as a business village.	Initiatives & Projects → Local Initiatives ¹⁰⁰¹ Village Focus → Village Organizations ⁶⁸³	community ⁷⁹³¹ association ⁸⁵⁶² membership ¹⁰⁴⁴²	Castricum → Limmen ³⁴³
jachtlusthoeve.nl	Hostingpoint.nl	The nearby village of Balk offers amenities and shops.	Nature → National Parks ⁸⁹⁸ Events → Places ¹²¹⁹	wifi ¹³⁷² campsite ²⁰⁹³ facility ²⁶¹⁶ market ²⁷⁷² bicycle ²⁸³⁸	Ameland → Nes ¹³
nieuwehorizon.nl	Stichting Nieuwe Horizon	The foundation is located in and works for the village of Montagu.	Religious Organizations → Christian Organizations ⁹⁵ Charities → International Aid ⁸⁵⁸	south africa ¹¹⁰ poverty ²⁹¹ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷
gb-hethogeland.nl	GemeenteBelangen Het Hogeland	GemeenteBelangen is actively involved in renovating and improving the villages in Het Hogeland.	Local Governance → Local Politics ²⁵⁵⁹ Local Government → Village Council ⁴⁷⁹	home ⁷⁹⁷⁶	Het Hogeland → Eemshaven ¹⁴⁶
cclv.nl	Contactcommissie Lage Vuursche	Lage Vuursche is a small village in the Utrecht region, known for its green surroundings and the natural beauty of the surrounding forests.	Humanitarian Aid → Refugees ¹²² Local Government → Village Council ⁴⁷⁹	azc ³⁴ refugees ³⁴⁰ fire safety ⁵⁸⁹ internet ¹⁶⁷⁸ history ⁷²⁸⁶	De Bilt → Bilthoven ⁹²⁰
beleefsprundel.nl	Stichting Dorpswerk Sprundel	Sprundel is presented as a charming and historical village with much to offer.	Architecture & Sites → Middle Ages ¹⁸² Hiking → Walking Routes ²²⁶	trail ¹⁵¹ mill ⁴⁸⁷ recreation ⁷⁹⁹ heritage ⁸¹⁸ event ⁴⁵¹⁹⁹	Maasgouw → Thorn ¹²⁰
photomuseum.nl	PhotoMuseum.nl	The museum focuses on Dutch city and village scenes.	Dutch History → 19th Century ⁷⁷ Visual Arts → Museums ²⁰⁴⁹	museum ²⁰⁰² technique ²¹⁵⁷ portrait ³⁶⁸⁵ collection ⁷⁵⁶⁶ photography ⁹⁵⁰³	Utrecht → Zeist ²⁶⁴⁴
doppetten.nl	DOP Petten	The activities of DOP Petten are focused on preserving the livability of the Petten village.	Local Government → Village Council ⁴⁷⁹	gatherings ¹⁹⁵ connection ⁴⁰⁰⁷ volunteer ⁸³⁶⁷	Schagen → Petten ¹⁰⁶
havendreefheemstede.nl	Havendreef Heemstede	The plan is designed as a new village core in the region, with a feel reminiscent of traditional Dutch living.	New Construction → Housing Projects ¹³⁴ Sustainable Living → New Developments ²⁰⁰	housing ⁴³⁷⁸ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	North-Holland → Heemstede ¹¹⁷³
plaatselijkbelangvilsteren.nl	Plaatselijk Belang Vilsteren	The website contains information about the village of Vilsteren and its amenities.	Local Government → Village Council ⁴⁷⁹ Government & Administration → Local Organizations ¹⁹	housing needs ²⁵ governance ⁶¹⁰ association ⁸⁵⁶²	Ommen → Vilsteren ³⁵
amersfoort-santimreu.nl	Stichting Amersfoort-Santimreu	Sântimreu is a small village with a sandy road network and an old church, characteristic of the region.	Europe → Romania ¹⁷ Community → Ethnic Groups ¹⁴	taxes ⁵⁰⁰ church ³⁴³⁹
ivospruit.nl	Uw Melkboer	The wagon is designed to serve local villages and guarantee the proximity of a store.	Food Delivery → Delivery ²²²⁷ Local & Regional Products → Local Shops ²⁴⁵	wagon ¹³³ groceries ³⁵⁸ route ³⁴²⁵
ondernemersverenigingbaflo.nl	Ondernemersvereniging Baflo E.O.	The association is active in the villages of Baflo, Rasquert, Tinallinge, Den Andel, and Saaxumhuizen.	Business Associations → Local Business Associations ¹⁹²	entrepreneurs association ²³ initiative ¹²⁹⁷ entrepreneurship ¹⁵⁷⁹ region ⁵⁴¹² member ¹⁰¹⁵⁴	Het Hogeland → Rasquert ¹⁴
vicus-woonprojecten.nl	Vicus	The projects are specifically targeted at the villages in Brabant.	New Construction → Housing Projects ¹³⁴ Context ¹⁶¹³⁹⁴	target group ⁵⁷⁸ building ³²⁰⁴ relationship ⁴²⁰⁵ housing ⁴³⁷⁸ sustainability ¹⁸⁴⁵¹	Netherlands → North-Brabant ⁷³³⁴¹
monnickendammerrijweg39.nl	Honig & Huis Makelaardij	Ilpendam is a charming village with amenities such as a village shop, elementary school, sports clubs and a community center.	House Types → Houses ²⁵⁴⁶ Cycling → Cycling Routes ¹⁰⁰²	bedroom ²⁰⁵¹ house ⁸¹²¹ nature ⁹⁰⁹⁴ garden ¹³¹²⁹	Waterland → Ilpendam ⁷⁸
bijvianen.nl	BijVianen	Hoef en Haag is a small village with its own character and amenities.	Local Governance → Regional Politics ²⁹ Village Focus → Village Initiatives ¹³⁷	new construction ²⁶⁷² house ⁸¹²¹	Almere → Almere City ⁹³⁴
begraafplaatsen-h-michael.nl	R.K. Begraafplaatsen H. Michael	The website provides information about the specific cemeteries in each of the mentioned villages.	Monuments → Cemeteries ¹⁷²	deceased ⁸³ cemetery ³⁹⁵ regulation ¹³⁵⁰ rate ²⁶⁰⁶ church ³⁴³⁹	Dinkelland → Saasveld ⁸⁹
stadsdorpaker.nl	Stadsdorp De Aker	The village focuses on enriching the living environment in the neighborhood.	Neighborhood Focus → Neighborhood Organizations ¹⁵⁹³ Village Focus → Village Initiatives ¹³⁷	neighborhood ²⁴²⁴ resident ³²⁴⁵ newsletter ⁶⁵⁰⁴
markeschool.nl	Markeschool	The school plays an important role in the village of Wachtum.	Local Communities → Villages ¹⁰⁰⁵ Primary Education → Elementary Schools ⁸³⁴	directing ⁹⁰ school ⁷⁸⁵⁶ community ⁷⁹³¹ education ¹³⁴⁷¹	Coevorden → Wachtum ¹⁵
lestremblades.nl	Les Tremblades	Nearby villages such as Brantôme and Bourdeilles are truly beautiful.	Accommodation → Lodging ³¹⁷ Context ¹⁶¹³⁹⁴	dordogne ⁵⁴ bed and breakfast ³⁰⁵ house ⁸¹²¹	North-Holland → Amsterdam ⁴¹²⁵³
5oldambtsterdorpen.nl	Stichting 5 Oldambtster Dorpen	The website describes projects focused on the five eastern villages of the Oldambt municipality, which are collaborating to develop tourism opportunities.	Public & Street Art → Land Art ²⁹ Tourism → Regional Tourism ²⁴²	artwork ²²⁴⁸	Groningen → Oldambt ¹³⁶⁴
bezoeknorg.nl	Norg	Norg is a village with a rich history and characteristic buildings.	Local Communities → Villages ¹⁰⁰⁵ Accommodation → Holiday Parks ¹⁰²⁴	brink ⁴⁴ forest ¹⁴¹⁸ swimming pool ¹⁶⁶⁴ municipality ⁶⁸³⁷ event ⁴⁵¹⁹⁹	Noordenveld → Roden ⁶²¹
adnew-aanboord.nl	Adnew aan Boord	During the sailing trips, visitors are invited to wander through the villages in between.	Conferences & Meetings → Meeting Venues ⁷²⁹ Marine & Watercraft → Yachts ¹⁸⁹	sailing trip ⁹¹ yacht ⁶⁴⁷ arrangement ³¹⁰⁴	Gelderland → Ermelo ¹²⁰⁷
verenigingdorpmijnsheerenland.nl	Vereniging Dorp Mijnsheerenland	The association is specifically focused on the village of Mijnsheerenland and its surroundings.	Local Governance → Local Politics ²⁵⁵⁹ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	board ³⁴³⁸ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Hoeksche Waard → Mijnsheerenland ¹³⁸
houtseheuvel.nl	Association of Owners of the Houtse Heuvel	Den Hout is an agricultural village strongly influenced by the presence of the Houtse Heuvel.	Events → Places ¹²¹⁹ Knowledge → Culture ⁸²⁶⁵⁹	hill ¹⁶ preservation ⁷⁶ community ⁷⁹³¹	Oosterhout → Den Hout ⁶⁹
villaroest.nl	Pourquoi Pas	The house was originally a village house in the village of Davejean, which contributes to the authentic French atmosphere.	Accommodation → Country Estates ⁷³⁸ Europe → France ¹⁰⁴¹	vineyard ²⁶⁰ vacation home ⁴⁸⁸ nature ⁹⁰⁹⁴
wonenineemnes.nl	WoneninEemnes.nl	Eemnes is a charming agricultural village that offers an attractive lifestyle.	Accommodation → Holiday Parks ¹⁰²⁴	living ⁵⁷⁸ agriculture ⁷⁷⁸ community ⁷⁹³¹ house ⁸¹²¹	Utrecht → Eemnes ⁷²⁹
herbestemmingchristuskoningzundert.nl	Parochie Christus Koning Zundert	The repurposing plans are specific to the villages of Achtmaal, Klein-Zundert, Wernhout, and Rijsbergen.	Catholic → Parishes ⁴⁵⁷ Reformed → Dutch Reformed Church ²¹⁹	repurposing ⁴¹ parish ³⁵³	Zundert → Wernhout ⁷⁷
winkeleninbleiswijk.nl	Municipality of Bleiswijk	Bleiswijk is presented as a trusted, authentic village environment with a unique atmosphere.	Protestant Churches → Congregations ³⁰⁴	shop ⁶⁴⁸³ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Lansingerland → Bleiswijk ⁵⁷⁹
schoolvangeduld.nl	School of Patience	The organization operates primarily in villages.	Nonprofits → International Development ⁴²⁰ Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	microcredit ¹⁹ kindergarten ⁴¹ education ¹³⁴⁷¹
klingelenberg.nl	Project Klingelenberg BV	Tuil, the village where Klingelenberg is located, is presented as an inviting living environment.	Accommodation → Villas ¹⁰¹⁸ Tourism → Regional Tourism ²⁴²	expansion ¹³⁶ sale ⁵⁹³⁰ home ⁷⁹⁷⁶	West-Betuwe → Tuil ²⁶
hollevatentheater.nl	Holle Vaten Theater	The initiative focuses on getting to know unknown villages through the submissions of the residents.	Holidays → Christmas ⁹³⁷ Village Focus → Village Initiatives ¹³⁷	post office ²⁶ mail ¹⁴⁹ theater ²⁵⁴⁴ coffee ³⁸³⁸	Het Hogeland → Sauwerd ³¹
expeditiesevenum.nl	Expeditie Sevenum	The villages of Evertsoord, Kronenberg, and Sevenum are central to the activities of Expeditie Sevenum.	Local Economy & Development → Regional Development ²⁹⁶ Village Focus → Village Organizations ⁶⁸³	collaboration ¹⁶⁰³⁶	Horst aan de Maas → Sevenum ²⁶⁴
dienwiersma.nl	studio dien wiersma	The village forms the basis for the tailor-made plans, with the village vision and expansion plans being developed.	Architecture → Urban Planning ¹⁴⁶⁵ Social Issues → Participation ¹⁰²³	spatial issues ¹⁰ human ¹⁴⁰ city ¹⁸⁷⁵ theme ⁴⁰¹⁵ nature ⁹⁰⁹⁴	Het Hogeland → Uithuizermeeden ⁶⁶
graftdijkerkermis.nl	Graftdijker Kermis	The fair is aimed at the village of De Graftdijken and surrounding villages.	Local Events → Fairs ⁷⁰⁷ Village Focus → Village Life ²⁶²	flyer ²⁷⁴ fair ⁵⁸³ sponsors ²⁶⁴² volunteer ⁸³⁶⁷	Netherlands → North-Holland ⁹²⁹⁵⁶
oostermoerlichtjestour.nl	The Tentoonstellingsvereniging Oostermoer (TTV)	The Lichtjestour travels through various villages in the Oostermoer region.	Holidays → Christmas ⁹³⁷ Machinery & Repair → Tractors ²⁶⁶	parade ⁵¹³ tractor ⁷⁸⁹ sponsorship ²⁶⁸⁶	Aa en Hunze → Rolde ¹⁷⁶
veldmeester.nl	Veldmeester	Velddriel is a small, but well-equipped village located in the Bommelerwaard.	House Types → Houses ²⁵⁴⁶ Outdoor Adventures → Landscape Recreation ²⁶	recreation ⁷⁹⁹ monument ¹¹⁶⁸ landscape ²⁶⁰⁹ house ⁸¹²¹	Maasdriel → Kerkdriel ²³⁴
despronk.nl	Sporthal de Spronk	The sports hall is part of the community and contributes to the livability of the village of Vledder.	Local Government → Village Council ⁴⁷⁹ Sport Facility → Sports Halls ⁹¹	sports hall ²⁷⁰ agenda ⁴³⁷⁴ event ⁴⁵¹⁹⁹	Westerveld → Vledder ⁹⁸
bommelerwaardsebierbrouwerijen.nl	Bommelerwaardse Bierbrouwerijen	The website categorizes breweries by village and hamlet in the Bommelerwaard.	Hobbies → Brewing ¹⁵⁷ Travel → Tourism ³⁷⁵⁴	brewery ⁴⁹⁸ archive ²⁰⁶⁷ beer ²⁸⁸⁷ history ⁷²⁸⁶ research ⁸⁹⁶⁷	Maasdriel → Alem ³²
dorpscontactwestzaan.nl	Dorpscontact Westzaan	Dorpscontact Westzaan strives to preserve the village's identity and improve it.	Associations → Village Associations ¹⁵² Parks & Gardens → Parks ¹⁰⁴³	playground ¹⁰⁸⁸ participation ¹⁴³⁰ board ³⁴³⁸ health ⁶³⁶⁶ community ⁷⁹³¹	Zaanstad → Westzaan ²⁰⁵
ikzegniets.nl	Not mentioned	Ome Toon was a permanent part of the village’s atmosphere in Klo van Wijk.	Personal Blog → Life Stories ³²	poem ¹⁰¹⁴ story ⁸²⁸⁵
clashofclansnl.nl	ClashOfClansNL	Villages in Clash of Clans serve as the players' bases, where they place their buildings and defenses.	Games → Mobile Games ⁴⁶ Hobbies → Gaming ⁶⁰⁵	attacks ¹² troop ⁷⁷ buildings ⁸⁹⁸ strategy ⁹³⁷⁹
eerselsamenanders.nl	Eersel Samen Anders	All villages within the municipality of Eersel are represented and involved in the party's activities.	Local Politics → Parties ⁶²² Village Focus → Village Life ²⁶²	policy ²¹⁴⁹ facility ²⁶¹⁶ resident ³²⁴⁵ municipality ⁶⁸³⁷ association ⁸⁵⁶²	Eersel → Wintelre ⁹⁹
famvanwell.nl	Not mentioned	Information is provided about two villages named Well.	Local Communities → Villages ¹⁰⁰⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	river ³¹² family ⁶⁴⁶² history ⁷²⁸⁶	Bergen → Well ¹¹⁵
grandwar.nl	Grand Game Media B.V.	Players can expand and strengthen a camp in Grandwar, forming a growing empire.	Games → Computer Games ²⁶³	empire ²³ unit ⁴⁰⁵ player ⁶⁷⁸ landscape ²⁶⁰⁹
hartvoorlopik.nl	Hart voor Lopik	Hart for Lopik is actively involved in the nine villages of Lopik.	Local Politics → Parties ⁶²² Local Politics → Municipal Council ⁴⁸⁴	livability ²³⁰ resident ³²⁴⁵ housing ⁴³⁷⁸ municipality ⁶⁸³⁷	Utrecht → Lopik ⁴⁶⁴
houwerzijl-dorp.nl	Dorpsbelangen Houwerzijl	The association represents the interests of the residents of the village of Houwerzijl.	Parks & Gardens → Parks ¹⁰⁴³ Village Focus → Village Organizations ⁶⁸³	newsletter ⁶⁵⁰⁴	Groningen → Het Hogeland ²⁴⁹²
nieuwbuurtschap.nl	NieuwBuurtschap	A village is a small, self-sufficient and socially connected community.	Living → Sustainable Living ⁸¹⁷ Village Focus → Village Initiatives ¹³⁷	community ⁷⁹³¹ energy ⁹⁰⁷⁵ nature ⁹⁰⁹⁴ sustainability ¹⁸⁴⁵¹
ondernemersclubvragender.nl	Ondernemers Club Vragender	Vragender is a rapidly growing and entrepreneurial village that needs its own entrepreneur’s club.	Business Associations → Local Business Associations ¹⁹² Village Focus → Village Organizations ⁶⁸³	member ¹⁰¹⁵⁴	Oost Gelre → Vragender ⁵⁷
puttenopwegnaarkerst.nl	Putten on the way to Christmas	The activity takes place in the village of Putten, spread across various locations.	Holidays → Christmas ⁹³⁷ Religion → Christianity ³⁸³⁹	nativity scene ¹⁷ christmas ³²⁰ jesus ⁴¹¹ story ⁸²⁸⁵	Gelderland → Putten ¹⁰⁶⁹
stichtingcanonhuizen.nl	Canon of Huizen Foundation	The text emphasizes the specific place of Huizen as a unique village within the Gooi.	Local Communities → Villages ¹⁰⁰⁵	unesco ⁵¹ canon ⁶⁷ culture ³⁹²² history ⁷²⁸⁶	Bunschoten → Bunschoten-Spakenburg ³⁸²
vriendenvandemoer.nl	Stichting Vrienden van het Openbaar Basisonderwijs De Moer	De Moer is a village with a large heart, and the foundation contributes to its development and community life.	Childcare → After-School Care ⁷⁶⁵ Village Focus → Village Life ²⁶²	primary school ¹⁴⁰ foundation ⁶⁶⁷⁸	Loon op Zand → De Moer ⁵¹
cantignergues.nl	Rob and Dorenda	The holiday house is located in an authentic village, which provides a unique and local experience.	Accommodation → Bungalows ¹⁰⁰⁸ Europe → France ¹⁰⁴¹	holiday house ⁴⁰² privacy ¹²⁸⁶ internet ¹⁶⁷⁸ environment ⁴⁸⁷³
dashausschulenberg.nl	Das Haus Schulenberg	The village of Schulenberg is a quiet village with few inhabitants and a picturesque atmosphere.	Water → Rivers ¹⁸⁰ Accommodation → Guesthouses ⁷²⁶	guesthouse ²⁰⁹ room ³⁴¹¹ solar panels ⁴⁷⁰¹ nature ⁹⁰⁹⁴
kvisser.nl	KV	The village core of A ldemardum is built in the style of a traditional Drenthe village, a typical settlement in the Drenthe area.	Games → Simulation Games ¹⁸	town ¹²⁶ landscape ²⁶⁰⁹	De Fryske Marren → Oudemirdum ⁷³
drenthelogies.nl	Appartementen ‘De Brinken”	Meppen is presented as a charming and historic village.	Accommodation → B&Bs ²¹⁰ Vacations → Nature Vacations ²⁶⁹	holiday house ⁴⁰² environment ⁴⁸⁷³ apartment ⁵⁰⁸⁸ nature ⁹⁰⁹⁴	Coevorden → Meppen ⁷⁰
rolde-info.nl	Rolde Info	Rolde is a small village located in Drenthe, with a long and interesting history.	Museums & Collections → Archaeology ²⁹¹ Camping → Campsites Netherlands ⁷⁹²	burial mound ¹⁵ history ⁷²⁸⁶	Het Hogeland → Eemshaven ¹⁴⁶
rolandseck.nl	Rolandseck Hoog	Doorwerth is the charming village where the apartment complex is located, and is known for its cozy atmosphere.	House Types → Apartment Living ³⁵⁵⁹	apartment complex ¹⁴⁰ history ⁷²⁸⁶ nature ⁹⁰⁹⁴	Renkum → Doorwerth ²⁰³
pearlsenkristles.nl	Stichting Pearls & Kristles	The foundation's projects are located in impoverished villages.	Nonprofits → International Development ⁴²⁰ Religion → Christianity ³⁸³⁹	bank account ¹⁰⁵ fund ¹⁰⁶³ foundation ⁶⁶⁷⁸	North-Holland → Amsterdam ⁴¹²⁵³
tinesbroodenzo.nl	Tine's Bread & Co.	Tine's Bread & Co. delivers to various villages including Gendringen, Voorst, Ulft and Bontebrug.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Business Services → Business Activities ²³⁰	pastries ⁹⁴⁶ bread ¹⁶²²	Oude IJsselstreek → Etten ⁷³
godehardusleane2.nl	Makelaardij Hoekstra	Hempens is the village where the villa is located.	Property Features & Details → Residential Agents ⁴⁵ Accommodation → Villas ¹⁰¹⁸	villa ¹³⁵¹ forest ¹⁴¹⁸ property ⁷⁴⁰⁶ garden ¹³¹²⁹	Friesland → Leeuwarden ⁶⁰⁶⁸
huisjeaugustusterschelling.nl	Augustus Vakanties BV	The house is located in the village of Striep, a central and quiet part of Terschelling.	Vacations → Nature Vacations ²⁶⁹ Accommodation → Bungalows ¹⁰⁰⁸	fireplace ⁷⁵² holiday home ²⁷⁵³ house ⁸¹²¹ garden ¹³¹²⁹	Terschelling → Midsland ¹⁰⁹
huisje-preigney.nl	La Comtessa	On one side, you see the valley with its meadows and the village with its typical French church tower.	Countries → Portugal ²⁹⁷ Accommodation → Villas ¹⁰¹⁸	views ⁷⁸ plot ¹⁰⁵¹ forest ¹⁴¹⁸ holiday ²²⁹⁵ property ⁷⁴⁰⁶
westerkwartier.nl	Municipality of Westerkwartier	The website contains information about village councilors, village budgets, and village contact coordinators.	Municipalities → Public Services ⁹⁵	social services ¹⁴ taxes ⁵⁰⁰ waste ¹³¹² sustainability ¹⁸⁴⁵¹	Groningen → Westerkwartier ²⁶⁹⁶
bezoeknoordenveld.nl	BezoekNoordenveld	The website describes the diverse villages within the municipality of Noordenveld.	Hiking → Trails ³⁵⁶ Local Communities → Villages ¹⁰⁰⁵	hiking ⁸⁴¹ cycle ¹⁹⁰⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Noordenveld → Roden ⁶²¹
bestemmingborgerodoorn.nl	Borger-Odoorn Tourist Organization	The site describes the various villages in the region, particularly the esdorp (villages) and peat colonies.	Local Communities → Villages ¹⁰⁰⁵	recreation ⁷⁹⁹ culture ³⁹²² history ⁷²⁸⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Borger-Odoorn → Exloo ²⁴⁸
wickengaard.nl	Wickengaard	The homes are built in a traditional village setting.	Cycling → Cycling Routes ¹⁰⁰² Food & Dining → Hiking Routes ³⁹	orchard ²⁴⁰ environment ⁴⁸⁷³ home ⁷⁹⁷⁶ energy ⁹⁰⁷⁵ sustainability ¹⁸⁴⁵¹	Haarlem → Schalkwijk ²¹⁴
prikstad.nl	Prikstad	Villages in the Netherlands are also featured in the guide.	Resources → Information Services ³¹⁴ Context ¹⁶¹³⁹⁴	search field ¹⁵ city ¹⁸⁷⁵ webshop ⁸⁶⁴⁸ restaurant ¹¹²¹⁵	The Hague → Scheveningen ¹⁶²⁵
kloosterenburen.nl	Coöperatie Klooster&Buren	The cooperative is based on the residents of the five mentioned villages.	Local Communities → Villages ¹⁰⁰⁵ Village Focus → Village Organizations ⁶⁸³	cooperative ⁶⁴⁹ culture ³⁹²² care ¹²³³⁸ event ⁴⁵¹⁹⁹	Het Hogeland → Kloosterburen ⁶²
visithaarlemmermeer.nl	Visit Haarlemmermeer	The region comprises 31 charming villages and neighborhoods, each with its unique character and attractions.	Local Communities → Villages ¹⁰⁰⁵	recreation ⁷⁹⁹ monument ¹¹⁶⁸ culture ³⁹²² nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	North-Holland → Haarlemmermeer ⁷⁴⁹⁰
nieuwwoelwijck.nl	Nieuw Woelwijck	The village is located on a beautiful natural area.	Care → Residential Care ³⁰⁵	resident ³²⁴⁵ housing ⁴³⁷⁸ care ¹²³³⁸	Midden-Groningen → Sappemeer ²⁰⁷
breekoever.nl	Breekoever	The houses are located in the village of Landsmeer, a popular residential area with a rich history.	Property Location & Neighborhood → Residential ⁸⁵¹ Property Location & Neighborhood → Property ⁶⁹⁵	living area ³⁴⁹ recreation ⁷⁹⁹ water ²⁵⁰¹ connection ⁴⁰⁰⁷ house ⁸¹²¹	Amsterdam → Landsmeer ³⁵
ewijcksluis.nl	Pension Van Ewijcksluis	Van Ewijcksluis is a small village located in the municipality of Anna Paulowna.	Nature → Nature Reserves ¹⁰³² Regions → Regional Destinations ²¹	pension ¹⁶⁸² walk ²¹⁶¹ bicycle ²⁸³⁸ hotel ³⁵⁴³	Hollands Kroon → Den Oever ¹⁶⁰
royalsantorini.nl	Royal Santorini	The villages of Santorini, such as Fira and Oia, are characterized by their typical white houses with blue domes.	Greece → Cyclades ¹¹ TravelContent → Travel Guides ⁹³⁸	sunset ⁶² museum ²⁰⁰²	Amersfoort → Vathorst-De Velden ³²
heyerkapel.nl	SHK	The mural paintings of the chapel depict scenes from the local village.	Religious Studies → Religious History ²¹⁷ Protestantism → Churches ¹⁰⁰⁹	pilgrim ⁵⁵ chapel ¹³³ pilgrimage ¹⁴⁸ monastery ¹⁵¹ paint ⁸⁷⁴⁷	Weert → Stramproy ¹²³
tribetool.nl	Tribe Tool	The site offers functionality to select villages on the map.	Online Games → Strategy Games ⁸⁹ Resources → Databases ³⁴⁸	timer ³⁶ filters ⁴²⁴ script ⁵³²
frieslandwonderland.nl	FrieslandWonderland	The website offers detailed information about the many villages of Friesland, with maps and archives.	Local Communities → Villages ¹⁰⁰⁵	maps ³³¹ friesland ⁶⁹² history ⁷²⁸⁶	Northeast-Friesland → Hegebeintum ¹³
mappea.nl	Mappea	Mappea.nl describes various villages in Colombia, such as Taganga, with details about their unique characteristics.	Regions → South America ⁷⁷	colombia ³¹ park ¹⁸⁶³ tips ²⁷⁸⁹ travel ⁷²¹⁰
woudsendonline.nl	Gemeente Súdwest-Fryslân	Woudsend is a small village with a rich history and diverse amenities.	Historical Sites → Monuments ¹⁰²⁷	monument ¹¹⁶⁸ neighborhood ²⁴²⁴ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Southwest-Friesland → Woudsend ¹¹⁷
gptv.nl	GPTV	'Dorpentocht' was a popular series that documented various villages in Friesland.	Local & Regional → Regional News Sources ²³ Entertainment → Television ¹¹³⁴	nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Waadhoeke → Tzummarum ⁵⁸
pbstanne.nl	Plaatselijk Belang Sint Annaparochie	The association is active in Sint Annaparochie and works for the village.	Local Governance → Local Politics ²⁵⁵⁹ Associations → Village Associations ¹⁵²	resident ³²⁴⁵ association ⁸⁵⁶² collaboration ¹⁶⁰³⁶	Waadhoeke → St.-Annaparochie ¹⁴⁶
bezoekmeierijstad.nl	Meierijstad	The website provides detailed information about the various villages and hamlets within Meierijstad, each with unique attractions.	Tourism → Regional Tourism ²⁴²	attraction ¹²⁷⁵ culture ³⁹²² nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Meierijstad → Erp ³⁰⁴
spaceoasisdelft.nl	Space Oasis Delft II	The design focuses on creating a self-sustaining village on Mars.	Astronomy → Space Exploration ³⁰ Construction → Civil & Infrastructure ³⁴⁵³	mars ¹⁷ research ⁸⁹⁶⁷ design ²⁷²⁰²	South-Holland → Delft ⁵³⁰⁹
hartvanlemmer.nl	Hart van Lemmer	Lemmer is a historic village that has developed into a charming maritime center.	Water → Boating ¹⁵⁹² Travel → Culture ⁶⁵⁵	waterway ¹²⁰ watersport ⁵⁴⁰ event ⁴⁵¹⁹⁹	De Fryske Marren → Lemmer ¹¹⁸⁸
ubbega.nl	Historical Circle Ubbega	The circle promotes the history of the villages of Adorp, Sauwerd and Wetsinge.	Carnival → Parades ⁷⁶ Local Communities → Villages ¹⁰⁰⁵	archive ²⁰⁶⁷ region ⁵⁴¹² history ⁷²⁸⁶ membership ¹⁰⁴⁴²	Het Hogeland → Sauwerd ³¹
hansbraakhuis.nl	Hans Braakhuis	The history of the different villages in the Renkum municipality is presented.	Architecture → Historical Buildings ²⁶⁶ Local Communities → Villages ¹⁰⁰⁵	buildings ⁸⁹⁸ estate ¹⁰⁹⁹ church ³⁴³⁹ history ⁷²⁸⁶ house ⁸¹²¹	Renkum → Oosterbeek ⁶⁰⁴
historischmarum.nl	Historical Association Marum and Heemkundekring Vredewold-West	The website contains a list of the various villages within the municipality of Marum.	Associations & Societies → Music Associations ¹⁰⁰³	archive ²⁰⁶⁷ history ⁷²⁸⁶ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Westerkwartier → Boerakker ¹⁷
wiki-raamsdonk.nl	Raamsdonks Erfgoed	The website is specifically dedicated to the ‘village’ of Raamsdonk, as opposed to the municipality.	Websites → Local Websites ⁴⁵ Context ¹⁶¹³⁹⁴	wiki ⁴⁹ donor ⁷⁵⁷ archive ²⁰⁶⁷ history ⁷²⁸⁶ volunteer ⁸³⁶⁷	Geertruidenberg → Raamsdonk ¹²⁴
karakteristyk.nl	Stichting Karakteristyk	The website offers information about the characteristic villages within the municipality of Tytsjerksteradiel.	Historical Sites → Monuments ¹⁰²⁷ Cycling Routes → Regional Routes ²¹	monument ¹¹⁶⁸ landscape ²⁶⁰⁹ building ³²⁰⁴ route ³⁴²⁵ news ¹⁵²⁹³	Tytsjerksteradiel → Earnewâld ¹¹⁷
nieuwbouwinelst.nl	Gemeente Elst	Elst is presented as an authentic village with a pleasant atmosphere.	Sustainable Living → New Developments ²⁰⁰ Local Communities → Villages ¹⁰⁰⁵	district ³⁷¹ accessibility ⁵⁷¹ green ⁸⁸⁹ new construction ²⁶⁷² house ⁸¹²¹	Overbetuwe → Elst ⁸⁸⁶
muziekverenigingwilhelmina.nl	Muziekvereniging Wilhelmina	Muziekvereniging Wilhelmina is a local village organization with a long tradition and an important role in village life.	Associations & Societies → Music Associations ¹⁰⁰³ Village Focus → Village Organizations ⁶⁸³	youth orchestra ³⁹ percussion group ⁶⁹ fanfare ¹⁷¹ association ⁸⁵⁶²	West-Betuwe → Herwijnen ⁹¹
pbdetrijedoarpen.nl	Plaatselijk Belang De Trije Doarpen	The association focuses on the villages of Echten, Echtenerbrug and Delfstrahuizen.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Village Organizations → Local Interests ¹³	interest ⁹¹¹ meeting ²³⁸¹ board ³⁴³⁸ municipality ⁶⁸³⁷ association ⁸⁵⁶²	De Fryske Marren → Echtenerbrug ²⁴
anloo-info.nl	Stichting Dorpshuis Anloo	Anloo is a small village with a rich history and an attractive environment.	Architecture & Sites → Middle Ages ¹⁸² Nature Conservation → Landscape Conservation ¹¹⁴	walk ²¹⁶¹ history ⁷²⁸⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Borger-Odoorn → Borger ²⁸⁸
bramfietst.nl	Bram Fietst	Bram’s initiative started with a bet about visiting villages in Brabant.	Europe → Germany ⁶⁵⁴ Motor → Cycling ⁴⁸⁸⁰	germany ¹⁸⁵ netherlands ¹³⁷⁶ cycle ¹⁹⁰⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
toeristenbelanglaren.nl	Toeristenbelang Laren	The website introduces Laren as a charming village.	Events → Walking Tours ¹⁶⁶ Travel → Tourism ³⁷⁵⁴	countryside ⁹⁹ tours ¹⁰⁴⁸ cycle ¹⁹⁰⁶ walk ²¹⁶¹ event ⁴⁵¹⁹⁹	Gelderland → Lochem ¹⁵⁸⁷
pietvanerp.nl	Piet van Erp	Balgoy and Keent are central subjects of the site.	Local Communities → Villages ¹⁰⁰⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	publication ²⁰¹⁸ family ⁶⁴⁶² history ⁷²⁸⁶ book ¹¹³⁹⁶	Oss → Keent ²⁰
szdm.nl	N.V.	The text describes the villages of Abcoude and Leersum, their location and characteristics.	Local Politics → Parties ⁶²² Context ¹⁶¹³⁹⁴	nitrogen ⁸² nature ⁹⁰⁹⁴ car ¹⁰⁸⁶⁵	De Ronde Venen → Abcoude ⁴⁷²
nieuwbouw-tzandnoord.nl	Development Company 't Zand-Noord	The project aims for a village character through the small-scale design of the neighborhood and the preservation of the local atmosphere.	Village Focus → Village Life ²⁶² Beach Life → Beach ⁵³²	housing supply ⁶⁴ new construction ²⁶⁷² beach ³²¹⁰ finance ⁵³⁴¹ house ⁸¹²¹	Schagen → Callantsoog ²⁴⁰
vkgallery.nl	Victoria Kovalenchikova	Laren is portrayed as a charming village renowned for its artistic and cultural assets.	Local Events → Fairs ⁷⁰⁷ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	fair ⁵⁸³ gallery ¹⁹⁸³ art ³⁸⁵⁶ exhibition ⁵³³² artist ⁵⁷⁴⁵	North-Holland → Laren ¹²³⁴
gonoordnederland.nl	GO Noord Nederland	The improvements are specifically targeted at villages.	Social Issues → Participation ¹⁰²³ Social Issues → Public Health ¹⁶⁷	living environment ¹⁷⁷ measures ¹⁹² method ¹⁵⁰⁵ resident ³²⁴⁵	Groningen → Westerkwartier ²⁶⁹⁶
taxi2airport.nl	Taxi2Airport	The website focuses on discovering picturesque villages worldwide.	TravelContent → Travel Guides ⁹³⁸ TravelStyles → Adventure ⁶³⁵	lighthouse ⁸⁷ guide ¹³⁶⁴ market ²⁷⁷² travel ⁷²¹⁰ story ⁸²⁸⁵
delepelaarjisp.nl	De Lepelaar Jisp	De Lepelaar Jisp is located in the picturesque village of Jisp.	Hiking → Trails ³⁵⁶ Landscape → Polders ²¹²	skating ³¹⁴ b&b ¹⁰⁶⁰ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵	Wormerland → Jisp ⁴²
wapenvanhaarzuylen.nl	Restaurant Thuis	The restaurant is located in the village of Haarzuilens, originally adjacent to Castle de Haar.	Local Communities → Villages ¹⁰⁰⁵ Features & Services → Traditional Restaurants ⁸³	brink ⁴⁴ cozy ²²⁷ newsletter ⁶⁵⁰⁴ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Utrecht → Haarzuilens ¹¹²
beleefbommelerwaard.nl	Tourist Info Bommelerwaard	Charming villages such as Rossum, Kerkdriel and Ammerzoden offer an authentic atmosphere.	Local History → Dutch History ¹⁰⁶⁷ Hiking → Routes ²⁷⁹	fortified city ¹⁵ river ³¹² cycling route ⁴⁵¹ water ²⁵⁰¹	Maasdriel → Kerkdriel ²³⁴
werelddorpenvoorkinderen.nl	World Villages for Children	World Villages for Children operates 13 world villages where children in poverty are received.	Nonprofits → International Development ⁴²⁰ Youth Development → Educational Initiatives ⁴⁰	poverty ²⁹¹ donation ⁵¹¹⁰ story ⁸²⁸⁵ child ¹¹⁵⁶⁶ education ¹³⁴⁷¹
beleefboxtel.nl	Municipality of Boxtel (via Beleef Boxtel)	The website presents the various villages of the municipality of Boxtel.	Municipalities → Peel ⁷² Water → Lakes ²³²	calendar ¹⁵⁵⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Boxtel → Esch ¹⁰⁸
ontdeknoordgroningen.nl	Discover North Groningen	The website describes the picturesque villages of the region, such as Niehove and Winsum, which have been awarded prizes for their beauty.	Nature → National Parks ⁸⁹⁸	dyke ²⁰ field ⁵²⁷	Oldambt → Winschoten ⁸³⁰
vanstillegrond.nl	De Tamboer	The performance takes place in the village of Nieuwlande, which keeps a secret.	Specialized History → World War II ¹¹³⁴ Theater → Stage Plays ¹²	resistance ²³⁰ memory ¹⁶⁴¹ performance ⁷⁵⁸⁶
kunstencultuurbenr.nl	Culturele Commissie Bodegraven - Reeuwijk	The theme ‘Together one village’ is central to the commission’s activities.	Theater → Theater Groups ⁶⁷³ Governance → Cultural Organization ¹⁵¹	theater ²⁵⁴⁴ film ³⁰⁰⁷ art ³⁸⁵⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
vvd-deurne.nl	VVD Deurne	The party focuses on maintaining and adapting the livability of the village centers.	Local Politics → Parties ⁶²² Construction Companies → Residential Construction ¹⁰¹³	business park ³⁷² freedom ⁸⁴⁸ housing ⁴³⁷⁸	Deurne → Helenaveen ⁷⁴
vrijstaatschoterland.nl	vrijstaatschoterland.nl	Oude- and Nieuwehorne are the locations where the peaceful revolution is taking place.	Local Governance → Local Politics ²⁵⁵⁹ Social Issues → Migration ⁵³	azc ³⁴ asylum seekers ⁹⁶ resident ³²⁴⁵ municipality ⁶⁸³⁷	Heerenveen → Nieuwehorne ³²
sutelaksje.nl	Sutelaksje	The Sutelaksje is linked to village life and promotes social cohesion.	Charities → Fundraising ¹⁰⁰⁵ Youth Development → Youth ¹⁰³³	cashflow ¹¹¹ club ⁴²²⁵ association ⁸⁵⁶² book ¹¹³⁹⁶	Leeuwarden → Warten ⁸¹
dekoehorn.nl	Familie van Heijst	The proximity of villages like Griendtsveen and Helenaveen provides cultural experiences and local products.	Camping → Farm Camping ³⁸⁶	nature reserve ³³⁹ cycling route ⁴⁵¹ campsite ²⁰⁹³ farm ²⁶²² restaurant ¹¹²¹⁵	Deurne → Helenaveen ⁷⁴
kano-avontuur.nl	Kano Avontuur	The routes lead participants through picturesque villages and historic locations along the Maren.	Vacations → Family Vacations ⁴⁷³ TravelStyles → Active Travel ⁵⁸	canoe ²⁶⁹ holiday ²²⁹⁵ water ²⁵⁰¹ family ⁶⁴⁶² nature ⁹⁰⁹⁴	Netherlands → Groningen ²³⁷³⁴
ooij.nl	Ooij.nl	Ooij and the surrounding area include various villages, which are part of the local community.	Landscape → Polders ²¹²	river ³¹² nature ⁹⁰⁹⁴	Berg en Dal → Ooij ¹⁴⁴
historisch-okd.nl	Stichting Historisch Oost-knollendam	Oost-Knollendam is a beautiful rural village located on the Zaan River.	Municipalities → Municipality of Zaanstad ¹⁴	archive ²⁰⁶⁷ history ⁷²⁸⁶ association ⁸⁵⁶²	Zaanstad → Zaandam ²⁷⁴⁰
eilanderij.nl	Eilanderij Kolhorn	Eilanderij Kolhorn is located in the most beautiful village of West Friesland.	Accommodation → Country Estates ⁷³⁸ Brasseries & Bistros → Bistro ⁵⁹⁴	bistro ²¹⁹ pizza ⁴¹⁵⁸ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵	De Fryske Marren → Lemmer ¹¹⁸⁸
7realms.nl	Seven Realms	The village in Seven Realms is the setting for the LARP, where players build a community and defend it.	Family Activities → Outings ⁷⁶³ Lifestyle → Events ³²⁴⁷⁵	game master ¹¹ larp ²⁹ wilderness ³¹	Overijssel → Enschede ⁵⁵⁵⁴
dorpsoverleghazerswouderijndijkoost.nl	Dorpsoverleg Hazerswoude-Rijndijk Oost	The Dorpsoverleg Hazerswoude-Rijndijk Oost is focused on improving the village and supporting the residents.	Village Focus → Village Organizations ⁶⁸³	working groups ¹⁷¹ initiative ¹²⁹⁷ newsletter ⁶⁵⁰⁴	Alphen aan den Rijn → Hazerswoude-Rijndijk ²³⁵
bnbtorenzicht.nl	B&B Torenzicht	The B&B is located in the quiet village of ‘s-Heer Arendskerke, located in the region of Zuid Beveland.	Accommodation → Guesthouses ⁷²⁶ Cycling → Cycling Routes ¹⁰⁰²	living room ¹³²⁵ bicycle ²⁸³⁸ apartment ⁵⁰⁸⁸ kitchen ⁶⁴⁴³	Goes → 's-Heer Arendskerke ⁷⁵
deplattelandshoeve.nl	B&B De Plattelandshoeve	Achterberg is a small, charming village with historic farmhouses.	Accommodation → Guesthouses ⁷²⁶	bed and breakfast ³⁰⁵ walk ²¹⁶¹ environment ⁴⁸⁷³	Rhenen → Achterberg ⁶³
eifelreizen.nl	Eifelreizen	The charming villages in the Eifel offer an authentic local atmosphere and historical sights.	Sports Activities → Football ⁴¹⁴⁴ Accommodation → Guesthouses ⁷²⁶	eifel ³⁸ path ⁴⁶⁶ hiking ⁸⁴¹ landscape ²⁶⁰⁹ holiday home ²⁷⁵³
portesdusoleil.nl	Portes du Soleil	The ski area features 12 different villages, such as Avoriaz, Morzine, and Châtel.	Skiing → Ski Resorts ²⁰⁶	lift pass ²¹ slope ¹⁰⁰ ski area ¹⁷⁶ accommodation ⁴⁹²¹
amelandhotel.nl	Hotel Ameland	The site highlights the picturesque villages of Ameland as part of the charm of the island.	Hotels → Hotels in Netherlands ¹⁰ Vacations → Island Vacations ²⁴³	tips ²⁷⁸⁹ beach ³²¹⁰ hotel ³⁵⁴³	Friesland → Ameland ⁹³⁰
gambianaarschool.nl	Gambia naar School	The school project was realized in the village of Madiana, and the development of the village is linked to the impact of the school.	Nonprofits → International Development ⁴²⁰	teacher ²⁸⁹⁰ foundation ⁶⁶⁷⁸ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹
eilandcorfu.nl	Vakanties Griekse Gids	The report describes several villages on the northeast coast of Corfu, each with its own character.	Islands → Corfu ¹⁷	travel report ⁷¹ island ⁷⁸⁰ landscape ²⁶⁰⁹ photography ⁹⁵⁰³
landschaprijnwaarden.nl	Stichting Landschap Rijnwaarden	The foundation has projects in various villages within the Rijnwaarden municipality.	Hiking → Trails ³⁵⁶ Village Focus → Village Organizations ⁶⁸³	biodiversity ⁷²⁰ recreation ⁷⁹⁹ landscape ²⁶⁰⁹ nature ⁹⁰⁹⁴	Zevenaar → Lobith ¹¹⁰
amalfikustvoorbeginners.nl	Amalfikust voor beginners	The Amalfi Coast is known for its charming villages, such as Positano and Vietri sul Mare.	Italy → Campania ¹⁵ Vacations → Beach Vacations ⁸⁶⁶	attraction ¹²⁷⁵ holiday ²²⁹⁵
dezwerfkei.nl	Partycentrum De Zwerfkei	De Zwerfkei is located in the charming village of Gees, known for its protected village views.	Accommodation → Group Accommodation ⁸⁴⁴ Conferences & Meetings → Meeting Locations ¹⁷¹	meeting space ²⁰⁰ group accommodation ²⁶⁰ facility ²⁶¹⁶ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Coevorden → Gees ⁷²
fietsenopdewadden.nl	Fietsen op de Wadden	Vlieland has one village, Oost-Vlieland, with a historic core and terraces.	Cycling → Cycling Routes ¹⁰⁰²	cycling route ⁴⁵¹ dune ⁶¹¹ island ⁷⁸⁰ nature ⁹⁰⁹⁴	Huizen → Bovenmaten ¹³⁶
geesdeklencke.nl	Boswachterij Gees	The nearby esdorp (villages) offer a unique atmosphere and are a must-see for visitors.	Landscape → Nature Areas ⁵⁸ Nature → Estates ⁷⁷¹	nature area ⁴⁹⁷ estate ¹⁰⁹⁹ photo ⁷⁷⁷⁸	Coevorden → Oosterhesselen ⁶⁶
novarixmc.nl	novarixmc.nl	An expansion requiring basic buildings and resources, accommodating more players and allies.	Games → Simulation Games ¹⁸	empire ²³ kingdom ⁸⁹ town ¹²⁶ resources ³¹⁰ camp ²⁴⁶⁶
suzanneveerman.nl	Suzanne Veerman	The website pays attention to the villages along the route.	Accommodation → Country Estates ⁷³⁸ Places → Towns ³⁸⁰	walk ²¹⁶¹ route ³⁴²⁵ transport ⁶¹⁰⁵
italiaanse-riviera.nl	Sunweb, Arke, Suncamp Holidays	The website describes the diverse, colorful villages located along the Italian Riviera.	Italy → Liguria ¹⁹ TravelContent → Travel Guides ⁹³⁸	beach ³²¹⁰ vacation ⁴²³⁴ accommodation ⁴⁹²¹ travel ⁷²¹⁰
toerismerh.nl	Landal Twenhaarsveld	Holten is described as a cozy village with a small offering of daily necessities.	Accommodation → Holiday Parks ¹⁰²⁴ Vacations → Beach Vacations ⁸⁶⁶	sight ⁸⁰ town ¹²⁶ shop ⁶⁴⁸³ history ⁷²⁸⁶	Raalte → Luttenberg ⁵³²
valuwsetwist.nl	De Valuwse Twist	The website emphasizes the village atmosphere of the location, with the benefits of proximity to urban facilities.	Houses → Corner House ²⁸¹	district ³⁷¹ facility ²⁶¹⁶ house ⁸¹²¹	Land van Cuijk → Cuijk ⁸³²
otterlosbelang.nl	Otterlo’s belang	Otterlo's Belang focuses specifically on the community and improving the quality of life within the village of Otterlo.	Village Focus → Village Life ²⁶² Village Focus → Village Organizations ⁶⁸³	livability ²³⁰ resident ³²⁴⁵ municipality ⁶⁸³⁷ association ⁸⁵⁶² sustainability ¹⁸⁴⁵¹	Ede → Otterlo ³⁷¹
theatergroepfier.nl	Komeedzje	The location of the events is the village of De Haan and Reduzum.	Legal & Regulatory → Legal ³⁴ Legal → Notaries ⁸⁴⁸	bark ²⁷ judge ⁸³ lawsuit ⁸⁹ legal ⁹³⁷ dog ⁵⁴⁸³	Leeuwarden → Reduzum ²⁵
kloosterboek.nl	Uitgeverij Damon	The exhibitions of the Bernardusdagen describe the connection between four villages and the Bernardus abbey.	Monuments → Cultural Heritage ⁵¹⁴ Religion → Christianity ³⁸³⁹	monk ²³ monastery ¹⁵¹ book ¹¹³⁹⁶	Halderberge → Oud Gastel ²⁵¹
kunstinschinnen.nl	kunstinschinnen.nl	The route runs through six different villages: Amstenrade, Doenrade, Oirsbeek, Puth, Schinnen, and Sweikhuizen.	Galleries & Exhibitions → Art Routes ²¹⁵ Art & Culture → Art Events ³²⁷	visitors ¹⁰⁴⁸ route ³⁴²⁵ artist ⁵⁷⁴⁵	Beekdaelen → Sweikhuizen ²⁴
woneninbuitenhuys.nl	Buitenhuys	Buitenhuys is located in the new village of Steenbrugge, offering a combination of village and urban living.	Living → Sustainable Living ⁸¹⁷	green ⁸⁸⁹ home ⁷⁹⁷⁶	Raalte → Luttenberg ⁵³²
hallesbelang.nl	Halle's Belang	The organization represents the interests of both the residents of Halle and the residents of the surrounding villages.	Government & Administration → Local Government ⁴⁵⁹¹ Village Focus → Village Life ²⁶²	association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Bronckhorst → Halle ¹¹⁸
sytzevisser.nl	Sytze Visser Advies	The new Central Axis connects and unlocks various villages in Northeast Friesland.	Local Communities → Villages ¹⁰⁰⁵ Nature → Environmental Management ⁵²⁹	traffic ⁹¹⁶ safety ⁵⁸¹⁹ collaboration ¹⁶⁰³⁶	Smallingerland → Drachten ²⁰⁵²
reindersmafonds.nl	Stichting Sake Sietzes Reindersmafonds	The fund contributes to the preservation and development of the villages and hamlets where it is active.	Social Issues → Social Organization ¹³³¹⁵ Community → Government & Administration ¹⁰⁵⁶⁷	fund ¹⁰⁶³ application ³³⁷⁷ region ⁵⁴¹²	Smallingerland → Drachten ²⁰⁵²
boomgaardridderkerk.nl	De Vries en Verburg Ontwikkeling B.V.	The plan aims to transform the location into a village, an self-sufficient community focused on green and agriculture.	Sustainability → Green Spaces ¹²³⁵ Nature Conservation → Landscape Conservation ¹¹⁴	vision ¹⁸⁸² landscape ²⁶⁰⁹	Ridderkerk → Rijsoord ⁴²
mooigrunnen.nl	Diemer Bosma	The website focuses on the picturesque villages in Groningen.	Visual Arts → Drawing ¹⁰⁴⁶ Nature & Landscape → Landscape Photography ⁵³⁰	calendar ¹⁵⁵⁶ artwork ²²⁴⁸ image ²⁶⁰⁵ landscape ²⁶⁰⁹ print ⁵⁵¹¹	Netherlands → Groningen ²³⁷³⁴
kerkdenham.nl	Kerk Den Ham & Stichting Oude Groninger Kerken	The village of Den Ham originated in the late Middle Ages and is characterized by its linear layout.	Protestantism → Churches ¹⁰⁰⁹ Village Focus → Village Organizations ⁶⁸³	abbey ⁴⁴ church ³⁴³⁹ agenda ⁴³⁷⁴ foundation ⁶⁶⁷⁸	Westerkwartier → Aduard ⁹⁸
zoutelandevakantie.nl	Zoutelandevakantie	The old village of Zoutelande offers various shops and cozy terraces.	Accommodation → Bungalows ¹⁰⁰⁸	holiday house ⁴⁰² wifi ¹³⁷² beach ³²¹⁰ terrace ⁴⁸⁴⁷ kitchen ⁶⁴⁴³	Veere → Zoutelande ²⁸⁵
boxmeers.nl	Boxmeerinfo	The text explicitly identifies Boxmeer as a village.	Local Communities → Villages ¹⁰⁰⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	north brabant ²⁹	Land van Cuijk → Boxmeer ⁸⁶¹
zomerroutedezeevang.nl	zomerroutedezeevang.nl	The route goes through the villages of Oosthuizen, Middelie, Warder, and Beets, each with its own unique characteristics.	Lifestyle → Travel ⁴²⁹¹²	tour ²³¹⁵ landscape ²⁶⁰⁹ route ³⁴²⁵	Netherlands → North-Holland ⁹²⁹⁵⁶
nieuwbouw-meerkerk.nl	Droomweide Construction Company	Droomweide strives for a village character with local amenities and a sense of community.	Business Associations → Local Business Associations ¹⁹² Village Focus → Village Initiatives ¹³⁷	home ⁷⁹⁷⁶ nature ⁹⁰⁹⁴ sustainability ¹⁸⁴⁵¹	Vijfheerenlanden → Meerkerk ¹⁸⁷
mei-inoargrien.nl	Mei-inoargrien	The cooperative operates specifically in the villages of Ferwerderadiel.	Cooperatives → Energy Cooperatives ³¹⁵ Economy → Local Economy & Development ⁷²¹	energy supply ³⁰ energycooperative ¹⁶⁰ fee ⁶⁴⁰ board ³⁴³⁸	Northeast-Friesland → Marrum ³⁸
fryskeflinter.nl	Fryske Flinter	The cooperative operates in and supports the villages of Klooster-Lidlum, Oosterbierum, Pietersbierum, and Sexbierum.	Energy → Sustainable Energy ⁵³³ Village Focus → Village Organizations ⁶⁸³	cooperative ⁶⁴⁹ fund ¹⁰⁶³ energy ⁹⁰⁷⁵	Waadhoeke → Oosterbierum ²³
siebengewaldsarchief.nl	Siebengewalds Archive	Siebengewald is a border village in North Limburg with an interesting history and a specific location on the German border.	Travel & Exploration → Natural History ¹⁷ Local Communities → Villages ¹⁰⁰⁵	border ¹¹⁹ brochure ¹⁶⁴² archive ²⁰⁶⁷ history ⁷²⁸⁶ book ¹¹³⁹⁶	Sittard-Geleen → Sittard ¹⁹⁹⁷
psbwonen.nl	PSBwonen.nl	PSBwonen.nl rents homes in various Friesland villages, such as Burdaard and Noordwolde.	Sustainable Living → Housing Associations ³²⁵ Nature Conservation → Landscape Conservation ¹¹⁴	friesland ⁶⁹² housing ⁴³⁷⁸ newsletter ⁶⁵⁰⁴ rental ⁷²⁵⁷ repair ¹⁴⁵⁷⁶	Northeast-Friesland → Marrum ³⁸
bestemmingwolvega.nl	Bestemming Wolvega	Bestemming Wolvega strives to rediscover and improve Wolvega as a more lively and inclusive village.	Local Economy & Development → Regional Development ²⁹⁶ Context → Community ⁵⁷⁴¹⁰	initiative ¹²⁹⁷ society ¹³⁷⁶ subsidy ²⁶⁴⁹	Weststellingwerf → Wolvega ⁵²⁴
stichtingtotnut.nl	Stichting tot Nut Arum	The foundation focuses on projects in specific villages, including Arum, Kimswerd and Witmarsum.	International Aid → Development Aid ⁴⁰¹	donation ⁵¹¹⁰ foundation ⁶⁶⁷⁸ association ⁸⁵⁶²	Waadhoeke → Oosterbierum ²³
parcganuenta.nl	Parc Ganuenta	The holiday park is set up as a charming village	Accommodation → Holiday Parks ¹⁰²⁴	investment ²⁰⁷⁰ holiday home ²⁷⁵³ energy ⁹⁰⁷⁵ sustainability ¹⁸⁴⁵¹	North-Beveland → Colijnsplaat ⁹⁴
zeeuwsmopje.nl	zeeuwsmopje.nl	The village where Kat participates in local initiatives and encounters new people, is a key element of her experience.	Literature → Non-Fiction ⁵¹⁹	neighborhood association ¹⁷⁷ clay ⁴⁹⁵ farmhouse ⁸⁷⁸	Zeeland → Walcheren ⁵¹⁸
historischeschepenturfroute.nl	Stichting Historische Schepen Turfroute	The foundation strives to connect the villages along the Turfroute and highlight their cultural historical value.	Water → Boating ¹⁵⁹² Museums → Regional Museums ³⁹⁰	ship ⁵¹⁰³ foundation ⁶⁶⁷⁸	Heerenveen → Akkrum ²⁴⁶
mooiakkrum.nl	Mooi Akkrum	Mooi Akkrum is aware of the needs and interests of the Akkrum-Nes village.	Local Governance → Civic Engagement ⁵¹⁵ Parks → Recreation Parks ³⁷	expansion ¹³⁶ petition ²²³ politics ¹²⁵⁹ park ¹⁸⁶³	Heerenveen → Akkrum ²⁴⁶
supermarktanjum.nl	Coop Supermarkt Anjum	The supermarket serves customers from several nearby villages.	Supermarkets & Grocery → Local Supermarkets ⁵⁶	delivery service ²³⁶ supermarket ⁴⁰⁶ parking ¹⁹²⁸ assortment ⁷⁷⁹⁹	Northeast-Friesland → Ingwierrum ²⁸
snsfondsmiddelstum.nl	Stichting SNS Fonds Middelstum	The fund specifically focuses on improving the livability in the villages of Huizinge, Toornwerd, Westerwijtwerd, Kantens, Rottum and Stitswerd.	Initiatives & Projects → Local Initiatives ¹⁰⁰¹ Village Focus → Village Initiatives ¹³⁷	fund ¹⁰⁶³ initiative ¹²⁹⁷ community ⁷⁹³¹	Eemsdelta → Middelstum ¹¹¹
avondvierdaagseysbrechtum.nl	Stichting Avondvierdaagse Ysbrechtum e.o.	The Avondvierdaagse is organized for the residents of the listed villages (Folsgeare, Nijlân, etc.) and those connected to them.	Associations → Village Associations ¹⁵² Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	avondvierdaagse ⁹⁵ photographer ¹³⁶⁶ sponsors ²⁶⁴² volunteer ⁸³⁶⁷	Southwest-Friesland → Scharnegoutum ⁴⁵
begraafplaatsharichruigahuizen.nl	Stichting Kerkhoven Harich and Ruigahuizen	Management of the cemeteries remains in the villages.	Monuments → Cemeteries ¹⁷² Protestantism → Churches ¹⁰⁰⁹	beneficiary ²¹ cemetery ³⁹⁵ stichting ⁴⁸¹ church ³⁴³⁹	De Fryske Marren → Ruigahuizen ¹³
stichtingnepalsambandha.nl	Stichting Nepal Samandha	The foundation works in various villages in Nepal and reports on the impact of disasters on these communities.	Humanitarian Aid → Emergency Relief ¹⁵	contribution ³⁵³ aid ⁴²⁷ family ⁶⁴⁶² clothing ⁹⁴⁴³
gcijsseldelta.nl	Gebiedscoöperatie IJsseldelta	Strengthening the villages in the IJsseldelta is an important part of the cooperative's approach.	Sustainability → Cooperatives ⁹⁷⁰ Local Economy & Development → Regional Economy ¹⁷¹	ijsseldelta ¹² economy ⁶⁸² nature ⁹⁰⁹⁴	Overijssel → Zwartewaterland ¹⁰⁶⁶
soms-suriname.nl	Stichting Ondersteuning Marrons Suriname	The project focuses on providing care in twelve villages.	Humanitarian Organizations → International Organizations ⁷³⁴ Charities → International Aid ⁸⁵⁸	childcare facility ⁵⁷ girl ²⁵⁶ healthcare ²³¹⁶ sponsors ²⁶⁴² child ¹¹⁵⁶⁶
moumousse.nl	moumousse.nl	The house is located in a small, quiet village in Northeast France.	Hotels → Country Houses ¹⁷² Europe → France ¹⁰⁴¹	vineyard ²⁶⁰ plot ¹⁰⁵¹ sauna ¹¹⁷⁵ living room ¹³²⁵ house ⁸¹²¹	Amsterdam → South ¹⁴⁸⁸
wachterliedplantsoen.nl	Wachterliedplantsoen	The event focuses on constructing a miniature village.	Children’s Activities → Summer Camps ⁹⁷ Parks & Gardens → Parks ¹⁰⁴³	community ⁷⁹³¹ nature ⁹⁰⁹⁴ child ¹¹⁵⁶⁶	Amsterdam → Nieuw-West ⁸⁴⁴
enclave-tours.nl	Enclave Tours	The focus is on the village of Baarle-Nassau and its distinctive border situation.	Cycling → Cycling Tours ¹¹⁷ Culture → Cultural Travel ⁴²¹	border ¹¹⁹ bicycle ²⁸³⁸ route ³⁴²⁵	Alphen-Chaam → Strijbeek ⁵²
amerongshistorischmuseum.nl	Amerongs Historisch Museum	The website describes Amerongen as a charming village with a rich history.	Local History → Dutch History ¹⁰⁶⁷ Museums → Historical Museums ³⁴¹	tobacco ⁴¹ castle ⁴⁹⁴ heritage ⁸¹⁸ museum ²⁰⁰² history ⁷²⁸⁶	Utrecht Hill Ridge → Amerongen ³¹²
spigno.nl	Family House Spigno Italia	The village of Spigno Monferrato is within walking distance of the house and offers amenities such as restaurants, supermarkets, and a bar.	Hotels → Country Houses ¹⁷² Context ¹⁶¹³⁹⁴	pizza oven ⁸⁹ walking route ³⁴⁰ swimming pool ¹⁶⁶⁴ house ⁸¹²¹ garden ¹³¹²⁹	Netherlands → Utrecht ⁴⁸⁹⁰¹
hetlanghuus.nl	Het Langhuus	Schellinkhout is described as a beautiful village, promising guests a charming atmosphere.	Water Travel → Boat Tours ⁶⁴⁰ Accommodation → Country Estates ⁷³⁸	bed and breakfast ³⁰⁵	Drechterland → Schellinkhout ⁵¹
garagesale-rijkevoort.nl	Garagesales Land van Cuijk	The site provides information for various villages within Land van Cuijk.	E-Commerce → Marketplaces ¹⁰⁵³ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	garage sale ¹¹ possession ⁴¹ household ³⁸² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Land van Cuijk → Maashees ³⁷
culinairgilze.nl	Culinair Gilze	Culinair Gilze was founded to discover the village of Gilze in a delicious way.	Outdoor Adventures → Walking ¹²⁶⁰ Culinary & Tastings → Culinary Events ⁶⁵	route ³⁴²⁵ dish ⁵⁹³⁶ event ⁴⁵¹⁹⁹	Gilze and Rijen → Gilze ³³³
familielely.nl	Family Lely	The website focuses on the villages of Ehrwald and Wieringen.	Travel Guides → Regional Travel Guides ⁸⁵ Holidays & Commemorations → National Culture ²³	photo ⁷⁷⁷⁸ community ⁷⁹³¹ story ⁸²⁸⁵	Hollands Kroon → Hippolytushoef ²⁰⁸
dorpjesshop.nl	Dorpjesshop	The website is focused on building and decorating villages, with various products offered for this purpose.	Shopping → Hobbies ⁵²³⁴	figure ⁵⁶⁰ theme ⁴⁰¹⁵ light ⁵¹⁴⁸ house ⁸¹²¹
lovetostay.nl	Love to Stay	Both properties are situated near attractive villages such as Uzès and Egmond aan Zee.	Accommodation → Villas ¹⁰¹⁸ Europe → France ¹⁰⁴¹	france ³²⁸ netherlands ¹³⁷⁶ swimming pool ¹⁶⁶⁴ property ⁷⁴⁰⁶ home ⁷⁹⁷⁶
deschotsehooglander.nl	B&B De Schotse Hooglander	Several picturesque villages are within cycling distance of the B&B.	Accommodation → Guesthouses ⁷²⁶ Nature → Forest ³⁸⁷	heathland ⁴⁰ b&b ¹⁰⁶⁰ forest ¹⁴¹⁸	Midden-Drenthe → Smilde ²⁰³
westenschouwenswelvaren.nl	VWW	The association strives to preserve the character of the village of Westenschouwen and develop it.	Village Focus → Village Life ²⁶² Travel → Tourism ³⁷⁵⁴	social cohesion ³⁶ tourism ³⁰³ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Schouwen-Duiveland → Burgh-Haamstede ⁴⁰¹
slapeninde7dehemel.nl	Vakantieappartement ‘s-Gravenpolder	The apartment is situated in a quiet village with all necessary amenities.	Apartment Living → Holiday Apartments ⁴²	rooftop terrace ²⁴⁴ apartment ⁵⁰⁸⁸ kitchen ⁶⁴⁴³	Eersel → Knegsel ¹³⁵⁹
rheezerstay.nl	Rheezerstay	Rheezerstay is situated in a historic village, Rheeze, which is a landmark.	Hiking → Trails ³⁵⁶ Nature → Forest ³⁸⁷	pieterpad ⁹⁸ farmhouse ⁸⁷⁸ breakfast ¹⁸²² environment ⁴⁸⁷³ accommodation ⁴⁹²¹	Utrecht → Vecht ¹⁵³
life-center.nl	LifeCenter	The project involves the construction of four large villages in Kiev.	Humanitarian Aid → Disaster Relief ⁷⁴ Humanitarian Aid → Refugees ¹²²	slider ⁴² refugees ³⁴⁰ aid ⁴²⁷ donation ⁵¹¹⁰
vakantiewoning-oostkapelle.nl	Family Pattenier	In the nearby village there are various shops and eateries.	Nature → Nature Reserves ¹⁰³²	forest ¹⁴¹⁸ holiday home ²⁷⁵³ market ²⁷⁷² beach ³²¹⁰	Veere → Oostkapelle ²⁰⁵
vvoudesluis.nl	V.V. Oudesluis	Oudesluis is the village where the club is located and where most activities take place.	Sports Clubs → Football Clubs ⁴⁶⁷ Lifestyle → Sports ⁴³⁸⁰⁰	football club ⁶⁰³ café ⁹⁴⁴ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Netherlands → North-Holland ⁹²⁹⁵⁶
dorpsbelangenzeegse.nl	Dorpsbelangen Zeegse	Zeegse is a small village in Drenthe that is central to the information and activities on the website.	Local Communities → Villages ¹⁰⁰⁵ Neighborhood Focus → Community Affairs ⁹⁵	agenda ⁴³⁷⁴ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Drenthe → Drentsche Aa ⁵⁰
pbvarsen.nl	Plaatselijk Belang Varsen	Plaatselijk Belang Varsen is committed to the village of Varsen.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Village Focus → Village Life ²⁶²	board ³⁴³⁸ membership ¹⁰⁴⁴² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Overijssel → Ommen ¹⁰⁹⁵
ondernemersverenigingsmilde.nl	Smilde Entrepreneurs’ Association	The association aims to form a village comprised of the three villages of Smilde.	Business Associations → Local Business Associations ¹⁹² Village Focus → Village Organizations ⁶⁸³	collaboration ¹⁶⁰³⁶	Midden-Drenthe → Smilde ²⁰³
jabuti.nl	Jabuti Vakantiewoningen	The location in the East Algarve provides access to beaches, local villages, and Faro airport.	Portugal → Algarve ¹⁰² Vacations → Nature Vacations ²⁶⁹	swimming pool ¹⁶⁶⁴ holiday home ²⁷⁵³ terrace ⁴⁸⁴⁷ accommodation ⁴⁹²¹
voordedorpen.nl	For the Villages	The party focuses on improving the living conditions in the villages of Landerd, Uden and the entire municipality of Maashorst.	Local Governance → Local Politics ²⁵⁵⁹ Care → Elderly ⁸²	election ⁴⁰⁴ policy ²¹⁴⁹ party ⁵⁹²⁸ municipality ⁶⁸³⁷ member ¹⁰¹⁵⁴	Maashorst → Uden ¹⁵⁴⁰
jilderdadamwald.nl	Jilderda's Damwâld Flowers	Additional delivery costs are required for delivery to villages outside of Damwâld.	Commerce → Flower Retail ²⁵ Commerce → Flowers ²²³⁸	bouquet ¹¹⁴⁷ card ¹⁹⁷⁵ flowers ³²⁴⁸ shop ⁶⁴⁸³	Dantumadiel → Damwâld ¹⁵³
woneninblaricum.nl	WoneninBlaricum.nl	Blaricum is an authentic and historic village with winding streets and a unique atmosphere.	Local Communities → Villages ¹⁰⁰⁵ Accommodation → Holiday Homes ⁷²⁷	dwelling ¹¹⁸ peace ¹¹¹³ nature ⁹⁰⁹⁴	Gooise Meren → Naarden ¹¹⁵⁴
cadiughi.nl	Agriturismo Cà di Ughi	Diano San Pietro is a village full of olive trees and historic paths, with medieval villages in the area.	Greece → Crete ⁶⁸ Europe → Italy ⁷⁸⁶	olive grove ¹⁴ olive oil ³⁴⁶ beach ³²¹⁰ food ³⁸⁷² apartment ⁵⁰⁸⁸
bami-magazine.nl	BaMi Magazine	BaMi Magazine is specifically focused on the two Brabant villages of Balkum and Mirroi.	Magazines → Local Magazines ¹¹ Context ¹⁶¹³⁹⁴	distribution ¹⁰¹¹ magazine ²¹⁸² packaging ²²³⁶ resident ³²⁴⁵ story ⁸²⁸⁵	Sint-Michielsgestel → Berlicum ³²⁷
makelaars-in-wijdenes.nl	RE/MAX Connect	The website describes the villages of Wijdenes and Oosterleek and their character.	Property Location & Neighborhood → Residential ⁸⁵¹ Context ¹⁶¹³⁹⁴	listings ⁵²⁵ agent ¹²⁵³ market ²⁷⁷² property ⁷⁴⁰⁶ price ⁸³²⁸	Drechterland → Venhuizen ¹⁵⁴
bynkebos.nl	N.V. De Bynkebos	The village of Schiermonnikoog offers cozy shops and various hospitality establishments.	Accommodation → Holiday Parks ¹⁰²⁴ Vacations → Nature Travel ¹⁸⁶	wadden sea ¹⁷⁰ bungalow ⁶⁸⁷ island ⁷⁸⁰ beach ³²¹⁰ garden ¹³¹²⁹	Friesland → Schiermonnikoog ⁴⁸⁹
tekst-oke.nl	Tekst Oké	Gaanderen is a small village in the Achterhoek.	Local Communities → Villages ¹⁰⁰⁵ Communication → PR ⁸⁷⁹	agency ⁹⁴⁴ text ²⁴⁶⁷ communication ¹⁰¹⁶²	Doetinchem → Oud-Gaanderen ¹⁶¹
tubbergenbruist.nl	Tubbergen Bruist	Tubbergen Bruist is a project group that is committed to the development of the village of Tubbergen.	Municipalities → Overview ¹¹	center ¹¹¹⁵ initiative ¹²⁹⁷ agenda ⁴³⁷⁴ municipality ⁶⁸³⁷	Overijssel → Tubbergen ⁸⁸⁵
vakantiehuisjeallier.nl	Mariage CC	Montaigu le Blin is a small, charming village with a population of approximately 300 inhabitants.	Europe → France ¹⁰⁴¹	gîte ⁶⁹ holiday ²²⁹⁵ garden ¹³¹²⁹
stichtingzevenwouden.nl	Stichting Zevenwouden	The village of Siebengewald is the primary focus of the foundation's activities.	Local Communities → Villages ¹⁰⁰⁵ Social Issues & Welfare → Rights ³⁸⁴	livability ²³⁰ contribution ³⁵³ board ³⁴³⁸ foundation ⁶⁶⁷⁸	Bergen → Siebengewald ⁵⁵
prefabtelecom.nl	Prefab Telecom	The website specifically focuses on the installation of fiber optic in small villages and rural areas.	Internet → Fiber Optic Internet ¹⁰⁰ Economy → Local Economy & Development ⁷²¹	fiber optic ²⁷⁹ speed ⁴⁶¹ infrastructure ¹⁴⁶⁰ internet ¹⁶⁷⁸ registration ⁴³⁶⁶	De Ronde Venen → Vinkeveen ⁴⁷²
hejtaleheurd.nl	Stichting hej 't al eheurd	The audio tour and performance focus on the historic village of Den Ham.	Historical Sites → Monuments ¹⁰²⁷ Monuments → Cultural Heritage ⁵¹⁴	audio tour ⁵³ cultural heritage ⁵⁵ performance ⁷⁵⁸⁶ story ⁸²⁸⁵	Westerkwartier → Den Ham ²³⁹
kibbelstuk8.nl	Groenhout Makelaars	Dwingeloo is a welcoming and vibrant village with a rich history.	Accommodation → Bungalows ¹⁰⁰⁸ Context ¹⁶¹³⁹⁴	heathland ⁴⁰ brochure ¹⁶⁴² house ⁸¹²¹	Amsterdam → West ⁷⁷⁷
dorpsraad-teteringen.nl	Teteringen Village Council	Teteringen is a village that combines old and new with nature and charm, where urban and rural life harmoniously merge.	Local Government → Village Council ⁴⁷⁹ Parks & Gardens → Parks ¹⁰⁴³	history ⁷²⁸⁶ association ⁸⁵⁶² nature ⁹⁰⁹⁴	Breda → Teteringen ²¹⁷
dorpsoverlegkoudekerk.nl	Stichting Dorpsoverleg Koudekerk	The village of Koudekerk aan den Rijn is central to the activities and decisions discussed on the website.	Municipalities → Dutch Municipalities ⁵¹⁶ Village Focus → Village Organizations ⁶⁸³	future vision ¹³ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Koudekerk aan den Rijn ¹³⁶
stichtinglnw.nl	Stichting LNW	The foundation organizes events for the village of Oosterhesselen.	Festivals → Regional Festivals ⁸² Monuments → Cultural Heritage ⁵¹⁴	ticket ²⁷⁸⁵ event ⁴⁵¹⁹⁹	Coevorden → Oosterhesselen ⁶⁶
alpentussenstop.nl	Alpentussenstop.nl	It offers a selection of cozy and authentic villages that can provide a quiet and charming experience.	Cycling Routes → Regional Routes ²¹ TravelStyles → Road Trips ¹⁸⁷	rest stop ¹² city ¹⁸⁷⁵ hotel ³⁵⁴³ restaurant ¹¹²¹⁵
kunstinkootwijk.nl	Stichting Kunst in Kootwijk	Kootwijk transforms once a year into an artist village, with artwork displayed in various locations.	Culture → Cultural Travel ⁴²¹ Art & Culture → Art Events ³²⁷	art ³⁸⁵⁶ artist ⁵⁷⁴⁵ event ⁴⁵¹⁹⁹	Barneveld → Kootwijk ⁷⁵
bedandbreakfast-lutjeborg.nl	Bed & Breakfast Lutje Borg	The location of the B&B in Mitling-Mark is in a rural village in Ostfriesland.	Hiking → Trails ³⁵⁶ Europe → Germany ⁶⁵⁴	b&b ¹⁰⁶⁰ landscape ²⁶⁰⁹ nature ⁹⁰⁹⁴	Netherlands → Groningen ²³⁷³⁴
samenindebreedeweg.nl	Stichting Gemeenschapscentrum Breedeweg	The website is specifically focused on the village of Groesbeek and the Breedeweg.	Village Focus → Village Life ²⁶² Village Focus → Village Initiatives ¹³⁷	church building ¹⁶⁰ community center ⁴⁴² accommodation ⁴⁹²¹ event ⁴⁵¹⁹⁹	Berg en Dal → Groesbeek ⁶⁵³
doornboomhuren.nl	Doornboom Huren	The website focuses on renting properties in the charming villages of Oost West Middelbeers.	Municipalities → Peel ⁷² Municipalities → Maas ²⁶	apartment ⁵⁰⁸⁸ studio ⁵⁴⁶⁵ property ⁷⁴⁰⁶	Oirschot → East-West-and Middle Beers ²¹⁴
mooigoudriaan.nl	Stichting Mooi Goudriaan	Goudriaan is renowned for its historical farm belt and the numerous historic farms within it.	Local Communities → Villages ¹⁰⁰⁵ Nature → Nature Reserves ¹⁰³²	farm ²⁶²² foundation ⁶⁶⁷⁸	Molenlanden → Goudriaan ⁴⁴
tanzaniatours.nl	Caracal Tours & Safaris Tanzania Ltd	The website offers the opportunity to visit traditional Maasai and Chagga villages to experience local life.	Adventure → Safari ⁵⁶ Stories → Travel Blogs ¹⁰¹⁶	kilimanjaro ¹⁰ tanzania ⁷⁴ safari ¹⁸¹ travel ⁷²¹⁰ sustainability ¹⁸⁴⁵¹
amalfivakantie.nl	AmalfiVakantie.nl	AmalfiVakantie.nl offers information on various villages along the Amalfi Coast, such as Positano and Ravello, each with its unique charm.	Europe → Italy ⁷⁸⁶ Vacations → Beach Vacations ⁸⁶⁶	sight ⁸⁰ tour ²³¹⁵
benbtorenzicht.nl	B&B Torenzicht	The B&B is located in the quiet village of 's-Heer Arendskerke.	Hiking → Trails ³⁵⁶ Accommodation → Guesthouses ⁷²⁶	cycling route ⁴⁵¹ bike ¹⁵⁴¹ breakfast ¹⁸²² apartment ⁵⁰⁸⁸	Goes → 's-Heer Arendskerke ⁷⁵
corfuvakantie.nl	Follow Media	The site describes the picturesque villages of Corfu, such as Afionas, and highlights the authentic atmosphere.	Islands → Corfu ¹⁷	corfu ²¹ sight ⁸⁰ beach ³²¹⁰ vacation ⁴²³⁴
elcieloenlatierra.nl	Villa El Cielo en la Tierra	The villa is near the charming Spanish villages of Algarrobo and Arenas.	Andalusia → Costa Del Sol ¹⁰² Accommodation → Villas ¹⁰¹⁸	spain ³⁶³ view ¹⁰⁴⁵ villa ¹³⁵¹ beach ³²¹⁰
historischcolmschate.nl	IJsselstudio	The website describes Colmschate as a proud village with a rich history.	Local Communities → Villages ¹⁰⁰⁵ Neighborhood Focus → Neighborhoods ¹⁰²⁸	people ⁶²⁷ buildings ⁸⁹⁸ estate ¹⁰⁹⁹ neighborhood ²⁴²⁴ history ⁷²⁸⁶	Deventer → Colmschate ¹²⁴
lampenvanmellema.nl	Lampen van Mellema	The titles of the lamps are often based on the names of small villages in Groningen, adding a personal touch.	Design → Product Design ⁷²²	detail ⁶³⁸ lamp ¹¹⁴² design ²⁷²⁰²	Het Hogeland → Uithuizen ¹⁸⁷
meltemi.nl	Meltemi	The surrounding area features picturesque villages such as Marpissa and Pisso Livadi, offering a glimpse into traditional Cycladic life.	Andalusia → Costa Del Sol ¹⁰² Europe → Greece ⁵⁸⁸	bus ⁸⁹⁴ beach ³²¹⁰ accommodation ⁴⁹²¹
pedicuresl.nl	Pedicure SL	The website mentions several villages where mobile pedicure services are offered.	Foot Care → Professional Foot Care ¹¹⁶ Services → Personal Services ¹⁰⁶²	foot problems ³²⁰ pedicure ²¹⁹⁶ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Bergeijk → Westerhoven ¹¹⁶
peeldorpen.nl	Peeldorpen.nl	The website presents an overview of various villages located within the Peel region.	Landscape → Wetlands ²¹ Nature → Nature Reserves ¹⁰³²	peel ¹³⁹ food ³⁸⁷² accommodation ⁴⁹²¹ photo ⁷⁷⁷⁸	Deurne → Helenaveen ⁷⁴
samensantpoortzuid.nl	Stichting Samen Santpoort-Zuid	Santpoort-Zuid is the center of the foundation’s efforts, focused on preserving the village’s identity and living environment.	Local Governance → Local Politics ²⁵⁵⁹ Village Focus → Village Organizations ⁶⁸³	azc ³⁴ document ¹⁶⁷⁸ plan ²⁵⁶⁶ environment ⁴⁸⁷³ municipality ⁶⁸³⁷	Velsen → Santpoort-Zuid ⁸⁸
slochterwoldspektoakel.nl	Stichting Aigenwies	Teams come from various villages in the region.	Cycling → Cycling Events ¹³⁰ Nature Conservation → Landscape Conservation ¹¹⁴	sponsors ²⁶⁴² event ⁴⁵¹⁹⁹	Midden-Groningen → Hellum ³³
tummetot.nl	Vakantiewoning Tummetot	The nearby Drenthe village of Norg offers an authentic atmosphere and is just 20 km from Groningen and Assen.	Hiking → Trails ³⁵⁶ Vacations → Nature Vacations ²⁶⁹	holiday home ²⁷⁵³	Noordenveld → Norg ³²²
vakantiehuislanorma.nl	La Norma Holiday Home	The village of La Norma is a car-free and family-friendly environment.	Europe → France ¹⁰⁴¹ Europe → Austria ²⁴⁹	ski resort ⁷⁴ national park ⁹⁸ mountain ²⁰⁰ animation ¹⁷⁷⁷ holiday home ²⁷⁵³
zijtaartzuid.nl	Raadhage Makelaardij Wendy Kappen	Zijtaart Zuid offers a cozy village life and a solid base for a comfortable life.	Houses → Corner House ²⁸¹ Houses → Semi-Detached Houses ⁷⁵¹	lot ⁹⁸ sustainable ⁷³⁹ brochure ¹⁶⁴² sale ⁵⁹³⁰ house ⁸¹²¹	Meierijstad → Veghel ¹²⁸⁸
oberstdorf-kleinwalsertal.nl	N/A	The ski area is formed by five villages, each with its own charm and amenities.	Europe → Germany ⁶⁵⁴ Europe → Austria ²⁴⁹	piste ⁴² ski area ¹⁷⁶ route ³⁴²⁵ accommodation ⁴⁹²¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
labellepoire.nl	La Belle Poire	The area offers many picturesque historical villages, such as Oupia.	France → Occitanie ²⁷	vacation home ⁴⁸⁸ pool ¹⁵³² wine ⁴⁴⁷⁶ garden ¹³¹²⁹
ardennen-laluna.nl	La Luna	Tresfontaines is a typical rustic village in the Ardennes, near the farm.	Vacations → Nature Vacations ²⁶⁹ Landscape → Mountains ⁸¹	ardennes ⁹⁸ river ³¹² forest ¹⁴¹⁸ farm ²⁶²²
verderosso.nl	Verde Rosso	The village of Stella Cilento serves as the location for these rental properties, offering a charming and authentic Italian experience.	House Types → Houses ²⁵⁴⁶ Europe → Italy ⁷⁸⁶	terrace ⁴⁸⁴⁷ rental ⁷²⁵⁷ house ⁸¹²¹
decomert.nl	Hertoghave Projectontwikkeling	Living in Grubbenvorst is presented as an experience in a quiet, rural environment with a strong sense of community.	Municipalities → Horst Aan de Maas ¹⁴ Nature → Environmental Management ⁵²⁹	green ⁸⁸⁹ plan ²⁵⁶⁶ architecture ³²²³ housing ⁴³⁷⁸	Horst aan de Maas → Grubbenvorst ¹³³
chaletmaupertuus.nl	Chalet Maupertuus van de Familie Hart	The chalet overlooks the village of Château-d'Oex.	Europe → Switzerland ⁸⁴ Context ¹⁶¹³⁹⁴	switzerland ⁴⁶ winter ³³³ summer ⁴⁸³ vacation home ⁴⁸⁸ chalet ¹²⁶⁴
costaitalia.nl	Costa Italia	Costa d'Azzetta is a small village in the mountains, important for the location of the farm.	Landscape → Polders ²¹² Landscape → Mountains ⁸¹	eating ⁸³ walk ²¹⁶¹ holiday ²²⁹⁵ farm ²⁶²² nature ⁹⁰⁹⁴
christelijkvakantieparkzwitserland.nl	Christelijke Vakantieparken Zwitserland	The holiday village of Blatten is a picturesque mountain village with a rich history.	Accommodation → Holiday Parks ¹⁰²⁴ Tourism → Holidays ¹⁰⁸⁶	holiday park ⁵⁶⁶ church service ⁸⁷⁹ holiday home ²⁷⁵³
itsjustanotherday.nl	itsjustanotherday.nl	The author describes her life and experiences in a small village.	Personal Stories → Autobiography ²²² Stories → Travel Blogs ¹⁰¹⁶	family ⁶⁴⁶² story ⁸²⁸⁵ blog ¹³³⁹²
stopuitlaatherriepurmerland.nl	Stop Uitlaatherrie Purmerland	The website is specifically focused on the problem in the village of Purmerland.	Events & Festivals → Motorcycling ⁵¹⁵ Environment → Noise Pollution ⁵⁸	noise ¹⁰⁸ exhaust ¹³³ motorcycle ²¹¹⁰ resident ³²⁴⁵ vehicle ³⁷⁴³	Landsmeer → Purmerland ⁴²
gilzerijen.vvd.nl	VVD Gilze and Rijen	The VVD branch serves the villages of Gilze, Rijen, Hulten, and Molenschot.	Political Parties → VVD ¹⁸⁷ Local Politics → Parties ⁶²²	vvd ⁷⁵ council ⁴²⁶ municipality ⁶⁸³⁷ news ¹⁵²⁹³	Gilze and Rijen → Molenschot ⁷⁶
woonboerderijsalland.nl	Woonboerderij Salland	The farmhouse is located between the characteristic villages of Raalte, Heino and Dalfsen.	Hotels → Country Houses ¹⁷² Holiday Homes → Farms ³⁴	woods ⁷⁵ farmhouse ⁸⁷⁸ bedroom ²⁰⁵¹ holiday ²²⁹⁵ bathroom ³⁷⁸⁴	Raalte → Luttenberg ⁵³²
krantkiosk.nl	Krant Kiosk	The 18Dorpenkrant is distributed through a number of villages in the region.	Local & Regional → Local News Websites ³⁵⁸ News & Journalism → Local Newspapers ³⁸	circulation ¹⁵⁵ newspaper ³⁹⁶ publication ²⁰¹⁸ advertising ²³⁰² municipality ⁶⁸³⁷	Emmen → Nieuw-Amsterdam ¹⁴⁹
maisondordogne.nl	Maison Dordogne	The holiday home is located in the charming village of Villamblard.	Europe → France ¹⁰⁴¹ Context ¹⁶¹³⁹⁴	dordogne ⁵⁴ swimming pool ¹⁶⁶⁴ apartment ⁵⁰⁸⁸ house ⁸¹²¹ garden ¹³¹²⁹
marcovonk.nl	Marco Vonk	The website provides information about the history of several villages, including Zoetermeer and Buytenwegh.	Film → Documentaries ⁸¹³ Knowledge → Media ⁴⁶⁹⁶³	films ⁵⁸⁵ series ⁶⁴⁴ hiking ⁸⁴¹ game ²⁸⁰⁷ travel ⁷²¹⁰	Gouda → Broekhuizen ²⁴
groenehart.nl	Groene Hart Toerisme	Charming historical villages are scattered throughout the area and offer a glimpse into Dutch history.	Accommodation → Group Accommodation ⁸⁴⁴ Events & Activities → Outdoor Activities ¹⁰⁴³	polder ⁴⁷⁶ water ²⁵⁰¹ event ⁴⁵¹⁹⁹
herdenking.nl	Transport4Transport	The project focuses on improving transport between villages and clinics/hospitals.	International Aid → Development Aid ⁴⁰¹	malawi ³⁴ remembrance ¹⁶⁵
terpenenwierdenland.nl	Terpen- en Wierdenland	The website describes the various villages in Friesland and Groningen, which are a core part of the terpen and wieden landscape and play an important role in the story.	History → Social Sciences ¹⁰⁷⁸⁶ Context ¹⁶¹³⁹⁴	terp ²⁰ waddenzee ¹⁴² archaeology ²⁵⁶ landscape ²⁶⁰⁹	Netherlands → Groningen ²³⁷³⁴
zuwent.nl	Oudheidkundige Vereniging Zuwent	The association specifically focuses on the history of the villages of Zieuwent and Mariënvelde.	Local History → Village History ³⁰	history ⁷²⁸⁶ association ⁸⁵⁶²	Oost Gelre → Mariënvelde ³⁶
heemkundekringrijnwaarden.nl	Heemkundekring Rijnwaarden	The heemkundekring focuses on the history of the six villages of Aerdt, Herwen, Lobith, Pannerden, Tolkamer, and Spijk.	Personal Websites → Family ¹⁹¹ Websites → Archive Websites ⁶⁹	archive ²⁰⁶⁷ image ²⁶⁰⁵ history ⁷²⁸⁶ association ⁸⁵⁶²	Zevenaar → Lobith ¹¹⁰
welkomincoevorden.nl	Municipality of Coevorden	Coevorden consists of picturesque villages that embody the authentic atmosphere of Drenthe.	Municipalities → Overview ¹¹	route ³⁴²⁵ history ⁷²⁸⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Drenthe → Coevorden ¹⁴⁹²
balkstercourant.nl	Mediahuis	The newspaper reports on events in various villages and towns.	News & Journalism → Local Newspapers ³⁸ Context ¹⁶¹³⁹⁴	advertisement ¹⁷⁰⁷ region ⁵⁴¹² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	De Fryske Marren → Balk ²²⁴
deamelander.nl	De Amelander	The website describes the unique character of the villages on Ameland.	Vacations → Island Vacations ²⁴³	island ⁷⁸⁰ magazine ²¹⁸² shop ⁶⁴⁸³ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Friesland → Ameland ⁹³⁰
devrieswijck.nl	De Vrieswijck Development Company	The website highlights the village-like atmosphere and the focus on green facilities.	New Construction → Neighborhood Development ⁹³³	pond ⁶⁸⁶ plot ¹⁰⁵¹ plan ²⁵⁶⁶ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	Opsterland → Gorredijk ³⁹⁸
mooiskoatterwald.nl	Mooi Skoatterwald	The project aims to create the atmosphere and appearance of a classic English village.	Nature → Estates ⁷⁷¹ Parks & Gardens → Parks ¹⁰⁴³	energy-efficient ⁴⁸ housing type ¹²⁸ sustainable ⁷³⁹ house ⁸¹²¹	Heerenveen → Oranjewoud ⁶⁴
p-10.nl	P10 Cooperation	P10 is committed to maintaining and strengthening the vitality of vital villages.	Local Politics → Political Parties ⁸⁹⁸ Local Governance → Regional Politics ²⁹	countryside ⁹⁹ politics ¹²⁵⁹ facility ²⁶¹⁶ collaboration ¹⁶⁰³⁶ sustainability ¹⁸⁴⁵¹
woneninoss.nl	Municipality of Oss	The Municipality of Oss consists of 22 cozy villages with their own character.	New Construction → Neighborhood Development ⁹³³ Hiking → Trails ³⁵⁶	nature area ⁴⁹⁷ plot ¹⁰⁵¹ housing ⁴³⁷⁸ rental ⁷²⁵⁷	Oss → Megen ⁸²
royalazoren.nl	Royal Azoren	Authentic fishing villages are a major attraction on the Azores.	Portugal → Azores ¹¹ Greece → Islands ²⁹⁴	azores ¹⁸ plantation ²⁴ boat trip ¹⁸⁴ island ⁷⁸⁰ nature ⁹⁰⁹⁴
hoogland-onderneemt.nl	Ondernemers Vereniging Hoogland	Hoogland is a village where the business association focuses on improving the livability.	Associations & Groups → Business Associations ¹⁰¹⁸ Village Focus → Village Organizations ⁶⁸³	association ⁸⁵⁶²	Amersfoort → Hoogland ²⁸⁴
vpo-handreiking.nl	Verrassend Genieten Blog	Winterswijk is described as a picturesque village.	Travel Planning → Travel Advice ³⁷² Vacations → Tips ³²¹	market ²⁷⁷² tips ²⁷⁸⁹ travel ⁷²¹⁰ nature ⁹⁰⁹⁴	Gelderland → Winterswijk ¹²²¹
bezoekhilvarenbeek.nl	Municipality of Hilvarenbeek	Hilvarenbeek features six charming villages, each with its own unique character.	Nature → Nature Reserves ¹⁰³² Tourism → Regional Tourism ²⁴²	recreation ⁷⁹⁹ attraction ¹²⁷⁵ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Hilvarenbeek → Diessen ¹³⁶
akkrum-nes.nl	Plaatselijk Belang Akkrum Nes	The association is active in the villages of Akkrum and Nes.	Local Governance → Local Politics ²⁵⁵⁹ Village Focus → Village Organizations ⁶⁸³	livability ²³⁰ municipality ⁶⁸³⁷ volunteer ⁸³⁶⁷	Heerenveen → Akkrum ²⁴⁶
nesaandeamstel.nl	Municipality of Amstelveen	De Zwarte Kat is a village that is part of the Nes aan de Amstel area.	Local Politics → Municipal Council ⁴⁸⁴ Local Communities → Villages ¹⁰⁰⁵	council ⁴²⁶ document ¹⁶⁷⁸ meeting ²³⁸¹ municipality ⁶⁸³⁷	North-Holland → Amstelveen ³¹⁸⁰
inkijkmuseum.nl	totalwebshops	The museum is transforming the location into a global village with random visitors.	Accommodation → Hostels ⁸⁹ Museums → Local Museums ⁸⁷	museum ²⁰⁰² theater ²⁵⁴⁴ accommodation ⁴⁹²¹ exhibition ⁵³³²	North-Brabant → Eindhoven ¹¹⁸⁴⁵
landvanmaasenwaal.nl	Gemeente Vijfheerenlanden	Charming villages form an important part of the atmosphere and history of the Land of Maas en Waal.	Cycling → Cycling Routes ¹⁰⁰² Tourism → Regional ¹¹	dyke ²⁰ cycling route ⁴⁵¹ recreation ⁷⁹⁹ event ⁴⁵¹⁹⁹	West-Maas en Waal → Appeltern ¹¹³
erfgoedheumen.nl	Heumen Heritage Platform	The merger of the villages of Malden, Heumen, Overasselt, and Nederasselt forms the basis of the Heumen municipality.	Museums & Collections → Archaeology ²⁹¹ Monuments → Heritage ⁵²⁶	archaeology ²⁵⁶ heritage ⁸¹⁸ municipality ⁶⁸³⁷	Heumen → Nederasselt ⁵⁶
bbemmerschans.nl	Buurt- en Belangenvereniging Emmerschans	Natuurlijk Emmerschans describes itself as a neighborhood with a village character.	New Construction → Neighborhood Development ⁹³³ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	living ⁵⁷⁸ recreation ⁷⁹⁹ neighborhood ²⁴²⁴ house ⁸¹²¹ association ⁸⁵⁶²	Drenthe → Emmen ³³⁴⁸
pbmarle.nl	Plaatselijk belang Marle	The Buurtschap Development Plan (BOP) is designed to improve the livability of the village of Marle.	Municipalities → Governance ¹⁰⁴³ Local Communities → Villages ¹⁰⁰⁵	survey ³⁷⁰ housing ⁴³⁷⁸	Overijssel → Hellendoorn ¹²¹⁷
moezeldal.nl	Mosel Vacation	The website describes the many charming wine villages and towns along the Mosel, each with unique restaurants and wine taverns.	Vacations → European Vacations ⁵⁸ Europe → Germany ⁶⁵⁴	culture ³⁹²² wine ⁴⁴⁷⁶	Limburg → Maastricht ⁶⁰⁰⁸
casadelmundo.nl	Casa Del Mundo	The website describes the surroundings of Casa del Mundo, with mention of nearby villages.	Spain → Costa Blanca ²⁸⁴	roofing ²⁸⁰⁶ travel ⁷²¹⁰ rental ⁷²⁵⁷ property ⁷⁴⁰⁶ blog ¹³³⁹²
auvergne-toerisme.nl	Auvergne-toerisme.nl	The website describes several picturesque villages in Auvergne, such as Charroux.	Vacations → Nature Vacations ²⁶⁹ Context ¹⁶¹³⁹⁴	auvergne ²³ attraction ¹²⁷⁵ campsite ²⁰⁹³ holiday home ²⁷⁵³
localbus.nl	Old Holland Tour	The tours focus on visiting picturesque villages like Edam and Volendam, showcasing Dutch heritage.	Travel Agencies → Bus Tours ¹⁰² Planning → Tours ⁸⁷⁰	countryside ⁹⁹ bus ⁸⁹⁴ ticket ²⁷⁸⁵ app ⁴⁵⁹⁵	Waterland → Marken ¹⁵⁷
aa-land.nl	Coöperatie Aa-land	The villages of Schijndel, Den Dungen, Berlicum, Middelrode and Heeswijk-Dinther form the core of the region and offer recreational opportunities.	Water → Rivers ¹⁸⁰ Regions → Regional Destinations ²¹	recreation ⁷⁹⁹ hospitality ³⁴⁹¹ event ⁴⁵¹⁹⁹	Meierijstad → Veghel ¹²⁸⁸
neusiedlersee.nl	N/A	In addition to the lake, the charming villages of the region offer a unique cultural experience.	Vacations → Nature Vacations ²⁶⁹ Vacations → Wellness Vacations ¹⁸	vacation destination ¹¹ watersport ⁵⁴⁰ culture ³⁹²² nature ⁹⁰⁹⁴
beleefwestbetuwe.nl	West Betuwe Municipality	It describes the picturesque villages of West Betuwe, which is an important aspect of the region.	Context ¹⁶¹³⁹⁴	regional products ³⁹¹ cycling route ⁴⁵¹ attraction ¹²⁷⁵ route ³⁴²⁵ accommodation ⁴⁹²¹	West-Betuwe → Ophemert ⁵⁷
lekkerbijmaas.nl	LekkerbijMaas	The B&B is located in the green village of Dreischor, Schouwen-Duiveland.	Accommodation → Guesthouses ⁷²⁶ Nature → National Parks ⁸⁹⁸	coast ¹⁹⁹ b&b ¹⁰⁶⁰ bike ¹⁵⁴¹ breakfast ¹⁸²² room ³⁴¹¹	Terneuzen → Western Scheldt ⁶⁶
promotiewinsum.nl	Promotie Winsum	The organization strives to make the village of Winsum a vibrant and attractive place for residents and visitors.	Associations & Groups → Business Associations ¹⁰¹⁸ Village Focus → Village Organizations ⁶⁸³	lead ¹¹⁹⁵ agenda ⁴³⁷⁴ event ⁴⁵¹⁹⁹	Het Hogeland → Winsum ³⁶⁹
visiteersel.nl	Visit Eersel	The website presents the various villages and centers of the region.	Seasonal & Weather → Holidays ¹⁵³² Context ¹⁶¹³⁹⁴	cycle ¹⁹⁰⁶ walk ²¹⁶¹ agenda ⁴³⁷⁴	Eersel → Wintelre ⁹⁹
mooibarradeel.nl	Mooi Barradeel	The website provides information about the various villages and neighborhoods within Barradeel.	Local History → Northern Netherlands ¹⁷	wadden sea ¹⁷⁰ cycle ¹⁹⁰⁶ history ⁷²⁸⁶ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Waadhoeke → Tzummarum ⁵⁸
dekameleoneexterveen.nl	Openbare basisschool De Kameleon	Eexterveen is a farming village with approximately 475 residents and surrounded by green areas.	Elementary Schools → Public Elementary Schools ⁴⁰⁶ Local Communities → Villages ¹⁰⁰⁵	staff ³⁴⁰⁵ atmosphere ⁵⁵⁹¹ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶ education ¹³⁴⁷¹	Aa en Hunze → Eexterveen ¹⁷
amelandportal.nl	Amelandportal.nl	Ameland has charming villages with historic houses and churches.	Vacations → Island Vacations ²⁴³ Travel → Tourism ³⁷⁵⁴	wadden sea ¹⁷⁰ dune ⁶¹¹ museum ²⁰⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
jeugdteamhw.nl	Jeugdteam Hoeksche Waard	Through the ‘Village’ platform, courses and training are offered and the network of parents and caregivers can be further strengthened.	Sports Clubs → Football Clubs ⁴⁶⁷ Social Services → Youth Work ³⁵³	parent ⁴³¹⁸	South-Holland → Hoeksche Waard ²²²⁹
nieuwbouw-reeve.nl	Reeve Ontwikkeling b.v.	Reeve is presented as a new, complete village on the water, focused on a unique living environment.	Village Focus → Village Life ²⁶²	ijsseldelta ¹² housing supply ⁶⁴ water ²⁵⁰¹ house ⁸¹²¹	Almere → Waterway from the IJmeer via the Randmeren to the Ketelmeer ⁴¹
leoroest.nl	Leo Roest	The village of Moddergat is presented as a picturesque destination.	Nature & Landscape → Travel Photography ¹⁷⁰ Stories → Travel Stories ⁴⁶²	cruise ⁴⁰⁵ diving ⁴⁵⁹ park ¹⁸⁶³ travel ⁷²¹⁰ photography ⁹⁵⁰³	Netherlands → Gelderland ⁶⁷⁰¹⁵
agiossostis.nl	Niet vermeld	Agios Sostis is a charming coastal town that exudes timeless tranquility.	Greece → Zakynthos ¹³	island ⁷⁸⁰ beach ³²¹⁰ vacation ⁴²³⁴ apartment ⁵⁰⁸⁸ restaurant ¹¹²¹⁵
logementonderdepannen.nl	Logement Onder de Pannen	The area offers opportunities to discover the charming villages of Drenthe.	Accommodation → Country Estates ⁷³⁸ Accommodation → Lodging ³¹⁷	guest room ¹¹² nature area ⁴⁹⁷ farmhouse ⁸⁷⁸ holiday home ²⁷⁵³ terrace ⁴⁸⁴⁷	De Wolden → Ruinen ¹⁸⁸
pieterom.nl	Pieterom Camping	The campsite is located on the edge of the authentic ring village Sleen.	Camping → Farm Camping ³⁸⁶ Nature → National Parks ⁸⁹⁸	peace ¹¹¹³ campsite ²⁰⁹³ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Coevorden → Sleen ¹⁵⁷
bosparknorg.nl	Bospark Langeloërduinen Norg	The nearby village of Norg offers restaurants, terraces and shops for visitors.	Nature → Forest ³⁸⁷	forest ¹⁴¹⁸ park ¹⁸⁶³ camp ²⁴⁶⁶ holiday home ²⁷⁵³	Noordenveld → Norg ³²²
chdeurne.nl	CH Deurne	The festive village offers dining options, stands, and activities for visitors.	National Holidays → King’s Day ³⁸⁹ Equestrian → Show Jumping ⁴⁸	show jumping ¹¹ championship ²¹⁰ horse ⁴³³⁷	North-Brabant → Deurne ¹³²⁹
bezienswaardighedeneuropa.nl	Bezienswaardigheden Europa	The website covers various villages such as Albarracín.	Specialized History → European History ¹⁰⁷ Regions → Europe ⁶⁷⁶⁴	monastery ¹⁵¹ attraction ¹²⁷⁵ city ¹⁸⁷⁵ travel ⁷²¹⁰ history ⁷²⁸⁶
huysvanroosevelt.nl	Huys van Roosevelt	Oud-Vossemeer is the village where the Roosevelt family originated and where the center is located.	Politics & Governance → Political History ⁹⁴ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	brasserie ⁷⁵² terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Steenbergen → Nieuw-Vossemeer ⁶¹
tilburen.nl	Dirk Duipmans	Dirk Duipmans photographs village scenes, such as Naarden.	Nature & Landscape → Landscape Photography ⁵³⁰	landscape ²⁶⁰⁹ animal ²⁹⁰⁸ photo ⁷⁷⁷⁸ photography ⁹⁵⁰³ event ⁴⁵¹⁹⁹	Gooise Meren → Naarden ¹¹⁵⁴
bestegoed.nl	BesteGoed B&B	Amerongen is a charming village, located in the Utrechtse Heuvelrug National Park.	Landscape → Utrechtse Heuvelrug ⁷⁷ Activities → Excursions ²⁵⁷	tobacco ⁴¹ national park ⁹⁸ hiking ⁸⁴¹ b&b ¹⁰⁶⁰ nature ⁹⁰⁹⁴	Utrecht Hill Ridge → Amerongen ³¹²
anderhoes.nl	't Anderhoes	AndereN is a characteristic Drenthe village surrounded by forests and landscape.	Hotels → Country Houses ¹⁷² Accommodation → Group Accommodation ⁸⁴⁴	reunion ²⁶⁷ holiday ²²⁹⁵ terrace ⁴⁸⁴⁷ accommodation ⁴⁹²¹	Aa en Hunze → Gieten ²²⁵
sauerlandgids.nl	Sauerlandgids.nl	The website describes the many beautiful half-timbered villages that can be found in the Sauerland.	Vacations → Nature Vacations ²⁶⁹ Context ¹⁶¹³⁹⁴	sauerland ⁶⁹ hiking ⁸⁴¹ cycle ¹⁹⁰⁶ vacation ⁴²³⁴
siambeachresort.nl	Siambeachresort.nl	The Bang Bao fishing village, built on stilts over the sea, provides a unique experience and the chance to sample local cuisine.	Southeast Asia → Thailand ¹²³ Nature → National Parks ⁸⁹⁸	waterfall ²⁹ thailand ⁹⁶ island ⁷⁸⁰ forest ¹⁴¹⁸ beach ³²¹⁰
slamme.nl	Mini-camping de Slamme	The campsite is located near picturesque villages.	Camping → Farm Camping ³⁸⁶ Nature → National Parks ⁸⁹⁸	nature reserve ³³⁹ sanitary ⁷⁵⁰ wifi ¹³⁷² bike ¹⁵⁴¹ camp ²⁴⁶⁶	Weststellingwerf → Munnekeburen ²⁸
tholenweb.nl	Gemeente Tholen	The site contains links to several villages and towns in the area.	Directories → Portals ³⁶⁹ Neighborhood Focus → Community Affairs ⁹⁵	photo ⁷⁷⁷⁸ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	North-Brabant → Roosendaal ²⁶⁷⁷
historiezwartsluis.nl	Historic Society of Zwartsluis	The website focuses on the history of the village of Zwartsluis.	Social Sciences → Genealogy & Family History ¹⁴⁰³	imagery ²⁰⁰ genealogy ⁵⁴³ archive ²⁰⁶⁷ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Zwartewaterland → Zwartsluis ²²⁸
deedegids.nl	Municipality of Ede	The news covers the surrounding villages such as Bennekom and Lunteren.	Municipalities → Dutch Municipalities ⁵¹⁶ News & Journalism → Local News ⁴⁸⁸	permits ⁶⁴³ vacancy ⁶⁵⁹⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Ede → Ederveen ¹⁹⁵
destam.nl	De Stam	De Stam creates a temporary village where participants live and engage in activities.	Volunteering → Community Organization ⁷⁰ Initiatives & Collaboration → Initiatives ⁴⁵⁹	generation ¹⁵⁶ community ⁷⁹³¹ nature ⁹⁰⁹⁴
lefkas.nl	Follow Media	The island has several charming villages, such as Nidri and Karya, which offer visitors an authentic experience.	Europe → Greece ⁵⁸⁸ Vacations → Tips ³²¹	coast ¹⁹⁹ beach ³²¹⁰ vacation ⁴²³⁴ wine ⁴⁴⁷⁶
incostablanca.nl	InCostaBlanca.nl	Moraira is a former fishing village, now an exclusive resort with unique charm.	Spain → Costa Blanca ²⁸⁴ Places → Towns ³⁸⁰	costa blanca ⁹⁴ vacation rental ¹²⁶ spain ³⁶³ beach ³²¹⁰ restaurant ¹¹²¹⁵
capdagdeinfo.nl	capdagdeinfo.nl	Cap d'Agde is presented as a small village with various amenities.	France → Languedoc-Roussillon ¹³ Nature → Naturism ¹¹	beach ³²¹⁰
hetpostenhofje.nl	Menko and Wendy Kroes	The B&B is located in the quiet village of Puiflijk, in the Land of Maas en Waal.	Accommodation → Country Estates ⁷³⁸	tuscany ⁷⁰ bed and breakfast ³⁰⁵ netherlands ¹³⁷⁶ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹	Druten → Puiflijk ³⁶
hansengridje.nl	B&B Hans and Gridje	Princenhage, the village near the B&B, offers charming shops and restaurants.	Accommodation → Guesthouses ⁷²⁶ Vacations → City Breaks ⁵³⁶	b&b ¹⁰⁶⁰ breakfast ¹⁸²² city ¹⁸⁷⁵ bedroom ²⁰⁵¹	Breda → Princenhage ⁶³
kerkadorp.nl	Kerk Adorp & Stichting Oude Groninger Kerken	The Church of Adorp is an important part of the village and plays a central role in the community.	Protestantism → Churches ¹⁰⁰⁹ Local Communities → Village Communities ¹²¹	committee ⁶²⁹ building ³²⁰⁴ church ³⁴³⁹ foundation ⁶⁶⁷⁸	Het Hogeland → Adorp ³³
stichtinggebroedershessefonds.nl	Stichting Gebroeders Hesse Fonds	The foundation specifically focuses on the villages of Ter Apel, Sellingen, and Vlagtwedde.	Museums & Collections → Archaeology ²⁹¹ Museums → Regional Museums ³⁹⁰	cultural activities ²² archaeology ²⁵⁶ subsidy ²⁶⁴⁹	Westerwolde → Sellingen ⁹⁰
regio-maasduinen.nl	Regio-Maasduinen	The website presents an overview of the various villages within the Regio-Maasduinen.	Local Government → Village Council ⁴⁷⁹	walk ²¹⁶¹ art ³⁸⁵⁶ municipality ⁶⁸³⁷ event ⁴⁵¹⁹⁹	Bergen → Siebengewald ⁵⁵
ijs-skeelervereniging.nl	IJs- & Skeelervereniging Krabbendijke	The skating rounds and skating tours take place in the center of the village.	Skating → Inline Skating ⁵⁸	skater ²⁴ ice rink ²⁶⁵ skating ³¹⁴ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Reimerswaal → Krabbendijke ¹²⁰
pastorie.nl	De Pastorie	The restaurant is situated in the picturesque village of Sint-Oedenrode, contributing to the authentic atmosphere.	Local Communities → Villages ¹⁰⁰⁵ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	building ³²⁰⁴ drink ⁵¹⁹¹ party ⁵⁹²⁸ restaurant ¹¹²¹⁵	Meierijstad → Sint-Oedenrode ⁶³²
morairavakantievilla.nl	Moraira Vakantievilla	The village of Moraira is authentic and stylish, and has been preserved due to permitted low-rise building.	Spain → Costa Blanca ²⁸⁴ Accommodation → Villas ¹⁰¹⁸	golf course ⁵⁰⁷ villa ¹³⁵¹ pool ¹⁵³² beach ³²¹⁰
sebbarsingerhorn.nl	Stichting Evenementen Barsingerhorn	Barsingerhorn is the village where the foundation carries out its activities and where most of the events take place.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Organizations ⁶⁸³	fair ⁵⁸³ event ⁴⁵¹⁹⁹	Hollands Kroon → Barsingerhorn ⁴⁰
bb35elspeet.nl	B&B No35	B&B No35 is located in the charming Veluwe village of Elspeet.	Hiking → Trails ³⁵⁶ Nature → Nature Reserves ¹⁰³²	labrador ⁸⁵ guest room ¹¹² b&b ¹⁰⁶⁰ breakfast ¹⁸²² nature ⁹⁰⁹⁴	Nunspeet → Hulshorst ¹⁶⁵
joarum.nl	Joarum Bed and Breakfast	Kûbaard is a small village in the province of Friesland.	Nature → Nature Reserves ¹⁰³²	frisian lakes ¹⁴ bed and breakfast ³⁰⁵ farmhouse ⁸⁷⁸	Friesland → Southwest-Friesland ⁴¹⁹⁴
bbindewolkenuitgeest.nl	bbindewolkenuitgeest.nl	Bed and Breakfast In de Wolken is located in the beautiful village of Uitgeest.	Accommodation → Guesthouses ⁷²⁶ Cycling → Cycling Routes ¹⁰⁰²	train ³⁴¹ b&b ¹⁰⁶⁰ bicycle ²⁸³⁸	North-Holland → Haarlem ⁸⁶⁷⁴
hethofjevanwelsum.nl	Het hofje van Welsum	The B&B is situated in the village of Welsum, a quiet location in the Vechtdal.	Accommodation → B&Bs ²¹⁰ Cycling → Cycling Routes ¹⁰⁰²	cycling route ⁴⁵¹ b&b ¹⁰⁶⁰	Ede → Kernhem ²³⁹
huisjeaanhethof.nl	Huisje aan het Hof	The location of the B&B is in the village of Bronkhorst, a small town with a unique charm.	Cycling → Cycling Routes ¹⁰⁰² Planning → Tours ⁸⁷⁰	b&b ¹⁰⁶⁰ cycle ¹⁹⁰⁶ terrace ⁴⁸⁴⁷	Gelderland → Zutphen ²⁶⁹⁰
burdaarderbier.nl	Admiraals BierBrouwerij	The beer supports the village of Burdaard by returning its profits to the local community.	Hobbies → Brewing ¹⁵⁷ Context ¹⁶¹³⁹⁴	brewery ⁴⁹⁸ museum ²⁰⁰² beer ²⁸⁸⁷ art ³⁸⁵⁶ community ⁷⁹³¹	Tytsjerksteradiel → Aldtsjerk ²⁹
ontdektsjechie.nl	Náš Dům	A key aspect of the website is offering the opportunity to discover picturesque villages in the area.	Europe → Czech Republic ⁴² Vacations → City Breaks ⁵³⁶	czech republic ¹⁸ winter sports ¹⁹⁶ b&b ¹⁰⁶⁰
braassemzicht.nl	Ontwikkelingsmaatschappij Braassemzicht	The surrounding villages of Oude Wetering and Roelofarendsveen offer facilities such as shops.	Spain → Costa Blanca ²⁸⁴ Accommodation → Villas ¹⁰¹⁸	villa ¹³⁵¹ water ²⁵⁰¹ apartment ⁵⁰⁸⁸ home ⁷⁹⁷⁶	Kaag en Braassem → Rijnsaterwoude ⁸⁶
vanhaladviespraktijk.nl	Van Hal Adviespraktijk	Eloy van Hal played a significant role in the development of The Hogeweyk dementia village, a pioneering model for supportive living.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Senior & Geriatric → Geriatrics ²³⁰	elderly ³⁶⁷ dementia ⁶⁷⁴ society ¹³⁷⁶ concept ³³³⁸
westerveldvoorelkaar.nl	Stichting Westerveldvoorelkaar	The website shows an overview of the various villages in the Westerveld region.	Local Communities → Villages ¹⁰⁰⁵ Tourism → Regional Tourism ²⁴²	companion ⁶³ initiative ¹²⁹⁷ question ²²⁶¹ volunteer ⁸³⁶⁷	Westerveld → Havelterberg ¹⁸
despelthoeve.nl	De Spelthoeve Recreatie	The campsite and B&B are located near the village of ‘t Haantje.	Accommodation → Guesthouses ⁷²⁶ Accommodation → Lodging ³¹⁷	farmhouse ⁸⁷⁸ b&b ¹⁰⁶⁰ cafe ¹⁶²² campsite ²⁰⁹³	Borger-Odoorn → Odoornerveen ²⁸
lasainte.nl	La Sainte	The village of Frayssinet-le-Gélat is within walking distance and offers amenities such as a medieval church and local bakeries.	France → Occitanie ²⁷	estate ¹⁰⁹⁹ forest ¹⁴¹⁸ holiday home ²⁷⁵³ restaurant ¹¹²¹⁵
oostenrijkvakantieland.nl	Oostenrijk Vakantieland	The website mentions charming villages in Austria as a key destination.	Vacations → Active Vacations ⁵³ Europe → Austria ²⁴⁹	alps ⁵⁰ winter ³³³ vacation ⁴²³⁴ wine ⁴⁴⁷⁶ travel ⁷²¹⁰
eilandkythira.nl	eilandkythira.nl	Kythira is known for its small, deserted villages.	Greece → Islands ²⁹⁴ Vacations → Island Vacations ²⁴³	travel report ⁷¹ island ⁷⁸⁰ sea ⁷⁸² history ⁷²⁸⁶ nature ⁹⁰⁹⁴
valleedeladrome-toerisme.nl	Vallée de la Drôme	Mirmande, described as one of the most beautiful villages in France, represents the charm of the region.	Hiking → Routes ²⁷⁹ Context ¹⁶¹³⁹⁴	lavender ⁵⁶ river ³¹² forest ¹⁴¹⁸
spanjenatuurlijk.nl	Natuurlijk	The website describes the picturesque white villages in the mountains as a characteristic element of Andalusia.	Spain → Andalusia ²⁴² Accommodation → Guesthouses ⁷²⁶	train ³⁴¹ hiking ⁸⁴¹ holiday home ²⁷⁵³ beach ³²¹⁰ nature ⁹⁰⁹⁴
nieuwbouw-middenbeemster.nl	nieuwbouw-middenbeemster.nl	The website emphasizes the village character of De Keyser neighborhood.	Sustainable Living → New Developments ²⁰⁰ Context ¹⁶¹³⁹⁴	polder ⁴⁷⁶ green ⁸⁸⁹ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	Purmerend → Middenbeemster ³⁶⁷
bredevoortschittert.nl	Bredevoort Schittert	Bredevoort is characterized by an attractive environment and a vibrant community.	Local Government → Village Council ⁴⁷⁹	resident ³²⁴⁵ light ⁵¹⁴⁸ history ⁷²⁸⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Aalten → Bredevoort ¹¹⁷
erfgoeddiessen.nl	ERFGOED DIESSEN	The website focuses on the heritage and history of the villages of Diessen and the surrounding area.	Specialized History → World War II ¹¹³⁴ Internet → Archives ⁴²²	commemoration ¹⁸¹ archive ²⁰⁶⁷ exhibition ⁵³³² newsletter ⁶⁵⁰⁴ photography ⁹⁵⁰³	Reusel-De Mierden → High Mierde ⁶³
kansarmensrilanka.nl	Stichting Kansarmen Sri Lanka	The schools are located in remote villages characterized by poverty and limited resources.	Asia → Sri Lanka ¹⁷ Knowledge → Education ⁶⁹⁶⁶⁶	water ²⁵⁰¹ facility ²⁶¹⁶ teacher ²⁸⁹⁰ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶
algarvevoorbeginners.nl	TUI	The inland of the Algarve is rich in charming, historic villages with unique character.	Portugal → Algarve ¹⁰² Vacations → Beach Vacations ⁸⁶⁶	algarve ⁷⁰ portugal ¹³⁰ climate ⁹³⁴ beach ³²¹⁰ vacation ⁴²³⁴
comomeervoorbeginners.nl	N/A	The shores of the lake are dotted with typical Italian villages.	Italy → Lombardy ⁸⁵ Water Activity → Water Sports ²⁹⁴⁴	watersport ⁵⁴⁰ weather ⁸¹⁷ holiday ²²⁹⁵
corfuvoorbeginners.nl	Corfu voor beginners	The website highlights the many charming villages Corfu has to offer.	Islands → Corfu ¹⁷	corfu ²¹ weather ⁸¹⁷ attraction ¹²⁷⁵ transportation ²⁸⁵¹ vacation ⁴²³⁴
gardameervoorbeginners.nl	D-Reizen	The region around the Gardameer is home to several picturesque villages, such as Riva del Gara and Tórbole.	Italy → Lombardy ⁸⁵ Vacations → Beach Vacations ⁸⁶⁶	vacation ⁴²³⁴ history ⁷²⁸⁶
iameland.nl	iAmeland	Ameland has four villages: Hollum, Nes, Buren and Ballum, each with its own charm and attractions.	Vacations → Nature Travel ¹⁸⁶	natural area ²⁰⁸ holiday home ²⁷⁵³ beach ³²¹⁰ hotel ³⁵⁴³	Northeast-Friesland → Holwert ⁸³
dwarsdoorsalland.nl	Dwars door Salland	The routes are often based on walks along or through villages in the area.	Travel Guides → Regional Travel Guides ⁸⁵ Nature → National Parks ⁸⁹⁸	hiking route ¹⁵⁵ route ³⁴²⁵	Raalte → Luttenberg ⁵³²
hausmarlene.nl	Haus Marlene	Hochkrimml is presented as a quiet village, ideal for relaxing and exploring nature.	Skiing → Ski Resorts ²⁰⁶ Europe → Austria ²⁴⁹	ski area ¹⁷⁶ chalet ¹²⁶⁴ holiday ²²⁹⁵ apartment ⁵⁰⁸⁸
oranjevereniginggarderen.nl	Oranjevereniging Garderen	The association organizes activities in the village of Garderen.	National Holidays → King’s Day ³⁸⁹ Village Focus → Village Life ²⁶²	orange ⁵⁶ volunteer ⁸³⁶⁷ event ⁴⁵¹⁹⁹	Barneveld → Garderen ²⁰²
transport4transport.nl	Transport4Transport	The foundation aims to deliver one bicycle ambulance to every three villages in Africa, addressing critical transport needs.	Municipalities → Land Van Cuijk ¹¹ Nonprofits → International Development ⁴²⁰	logistics ³²⁵⁷ donation ⁵¹¹⁰ transport ⁶¹⁰⁵ foundation ⁶⁶⁷⁸
realtours.nl	Realtours	The tour takes visitors to authentic, small-scale villages in the region.	Portugal → Northern Portugal ¹⁰ Travel Agencies → Group Tours ⁵⁰	group tour ¹⁹ portugal ¹³⁰ vineyard ²⁶⁰ nature ⁹⁰⁹⁴
nezuidplas.nl	Nieuw Elan Zuidplas	The party is involved in the various villages within Zuidplas.	Local Politics → Parties ⁶²² Local Politics → Municipal Elections ⁸⁸	party program ¹⁷ council member ¹⁰⁷ politics ¹²⁵⁹ board ³⁴³⁸	Zuidplas → Moerkapelle ²¹³
fairtradegemeentekrimpenerwaard.nl	Municipality of Krimpenerwaard	The municipality of Krimpenerwaard consists of eleven villages.	Initiatives & Collaboration → Initiatives ⁴⁵⁹ Commerce → Fair Trade ¹⁹¹	fairtrade ²⁰⁰ campaign ³⁴²⁸ municipality ⁶⁸³⁷ news ¹⁵²⁹³	South-Holland → Krimpenerwaard ¹⁸⁴⁰
spanjeactief.nl	Spanje Actief	The village of Canillas de Albaida serves as a permanent base for the activities of Spanje Actief.	Andalusia → Costa Del Sol ¹⁰²	andalusia ⁶⁴ hiking ⁸⁴¹ culture ³⁹²² lesson ⁵¹⁵⁴ travel ⁷²¹⁰
villafranche.nl	Villafranche	Villafranche is a holiday home in a small, authentic village.	Cycling → Cycling Routes ¹⁰⁰² Conferences & Meetings → Meeting Venues ⁷²⁹	gastronomy ¹³³ holiday home ²⁷⁵³ environment ⁴⁸⁷³ nature ⁹⁰⁹⁴ garden ¹³¹²⁹
incorpore.nl	In Corpore Wagenborgen	The music association comes from the village of Wagenborgen.	Associations & Societies → Music Associations ¹⁰⁰³ Municipalities → Súdwest-Fryslân ¹¹	music association ²⁹³ concert ⁴⁴⁰⁹ event ⁴⁵¹⁹⁹	Pekela → Nieuwe Pekela ¹²²
tekstfabriek.nl	VPRO	The article describes the village of Alpedrinha in Portugal, where an invasion of buyers is taking place.	Countries → Portugal ²⁹⁷ Film → Documentaries ⁸¹³	footballer ⁵³ documentary ¹⁰⁸¹
heemkundemheer.nl	Stichting Heemkunde Mheer	The website provides information about neighboring villages around Mheer, and their own history.	Local History → Provincial History ¹²² Monuments → Heritage ⁵²⁶	heemkunde ²² tradition ⁷³⁶ publication ²⁰¹⁸ history ⁷²⁸⁶ news ¹⁵²⁹³	Eijsden-Margraten → Mheer ²⁵
santorini.nl	Santorini.nl	The website describes the villages of Santorini, such as Oia and Fira, and their specific characteristics.	Greece → Cyclades ¹¹	sunset ⁶² beach ³²¹⁰ vacation ⁴²³⁴ accommodation ⁴⁹²¹
reekexplosievrij.nl	Actiegroup Reek Explosief	The expansion of the training ground would affect the surrounding villages of Reek, Zeeland, Langenboom, Escharen, Grave, Velp and Schaijk.	Local Governance → Civic Engagement ⁵¹⁵ Nature → Environmental Management ⁵²⁹	explosives ²² disturbance ³⁴ petition ²²³	Land van Cuijk → Escharen ⁴⁸
studiopotlood.nl	Studio Potlood	Giersbergen is a small village, established in 1244, located near the Loonse- en Drunense dunes, where the workshops take place.	Books → Children’s Books ¹⁰⁴²	illustration ²⁴⁴⁷ studio ⁵⁴⁶⁵ workshop ¹⁹³²⁵	Heusden → Drunen ⁶⁵²
minicampinglugtenburg.nl	Minicamping Lugtenburg	Oostkapelle, the nearby village, offers various amenities and attractions.	Camping → Campsites Netherlands ⁷⁹² Nature → National Parks ⁸⁹⁸	recreation ⁷⁹⁹ campsite ²⁰⁹³ beach ³²¹⁰ nature ⁹⁰⁹⁴	Veere → Oostkapelle ²⁰⁵
lokaalvitaal.nl	Lokaal Vitaal	Lokaal Vitaal represents the interests of residents in several villages within the municipality of Castricum.	Political Parties → Local Parties ⁶⁸ Local Politics → Parties ⁶²²	alderman ⁶¹ college ¹²² party ⁵⁹²⁸ municipality ⁶⁸³⁷	Castricum → Bakkum ⁸⁹
keerpunt74.nl	Keerpunt74	The three villages within Geertruidenberg are specifically mentioned as part of the party's policy.	Local Politics → Political Parties ⁸⁹⁸	political party ⁷⁵ candidate ¹⁸⁹⁶ resident ³²⁴⁵ municipality ⁶⁸³⁷	North-Brabant → Geertruidenberg ⁶⁹⁴
haustendler.nl	Haus Tendler	The website mentions the proximity of the villages Sagritz im Möltall and Heiligenblut.	Winter Sports → Skiing ⁵⁹⁶ Nature → National Parks ⁸⁹⁸	vacation rental ¹²⁶ mountain ²⁰⁰ coziness ²³⁵ vacation ⁴²³⁴ nature ⁹⁰⁹⁴
srivd.nl	Stichting Rotterdam is vele Dorpen	The website focuses on the history and different identities of the villages that make up Rotterdam.	Local Politics → Parties ⁶²²	history ⁷²⁸⁶	Rotterdam → Pernis ¹⁴²
boschwegsetoneelgroep.nl	Boschwegse toneelgroep	The location of the performance is in the Brabant village of Schijndel.	Culture & Arts → Cultural News ⁶¹ Theater → Theater Groups ⁶⁷³	theatre group ⁶⁷ performance ⁷⁵⁸⁶ community ⁷⁹³¹	Meierijstad → Schijndel ⁹⁰⁸
campingdegroenestrook.nl	Minicamping de Groene Strook	The campsite is located on the edge of a village and easily accessible.	Camping → Farm Camping ³⁸⁶	camping spot ²⁶ beach house ⁵⁹ wifi ¹³⁷² campsite ²⁰⁹³ beach ³²¹⁰	Goes → Wolphaartsdijk ²¹²
campingweideveld.nl	Familie Landegent	Camping Weideveld and Dapperhof are centrally located in the village of Burgh-Haamstede.	Local Communities → Villages ¹⁰⁰⁵ Camping → Campsites Netherlands ⁷⁹²	nature area ⁴⁹⁷ internet ¹⁶⁷⁸ campsite ²⁰⁹³ beach ³²¹⁰ accommodation ⁴⁹²¹	Schouwen-Duiveland → Burgh-Haamstede ⁴⁰¹
voorbleiswijk.nl	Leefbaar 3B	Bleiswijk and the surrounding centers are presented as a cozy village with a strong sense of community.	Local Politics → Municipal Elections ⁸⁸ Village Focus → Village Initiatives ¹³⁷	loan ⁸³² politics ¹²⁵⁹ initiative ¹²⁹⁷ youth ³¹²⁶	Lansingerland → Bleiswijk ⁵⁷⁹
cafetaria-sunplein.nl	Cafetaria 't Sunplein	Cafetaria 't Sunplein is an established name in the village of Landgraaf.	Brasseries & Bistros → Bistro ⁵⁹⁴ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Limburg → Landgraaf ⁷¹⁹
kefaloniavakantie.nl	Unidentified	The charming and picturesque villages of Kefalonia are described on the website.	Europe → Greece ⁵⁸⁸ Vacations → Beach Vacations ⁸⁶⁶	landscape ²⁶⁰⁹ beach ³²¹⁰
texelsonderwijs.nl	Texels Onderwijs	The nine elementary schools are spread across the different villages of Texel.	Sustainable Living → New Developments ²⁰⁰ Village Focus → Village Life ²⁶²	island ⁷⁸⁰ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Texel → De Cocksdorp ⁸⁷
haven-idee.nl	Haven Idee	The goal of the platform is to improve the village of Almere, specifically Goede Rede.	Social Issues → Participation ¹⁰²³ Local Communities → Villages ¹⁰⁰⁵	haven ⁴⁹ participation ¹⁴³⁰ idea ²³⁶⁷ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	Almere → Almere Haven ²¹⁶
corfupagina.nl	Follow Media	The website presents information about various villages on Corfu, such as Kassiopi and Acharavi.	Islands → Corfu ¹⁷ SpecificDestinations → Destinations ¹¹⁰⁵	corfu ²¹ sight ⁸⁰ beach ³²¹⁰ vacation ⁴²³⁴ history ⁷²⁸⁶
pastapiu.nl	Pastapiü	The description of the village in August, with inhabited houses and plants in the window boxes, paints a picture of a lively community.	Fine Dining & Gastronomy → Gastronomy ⁵⁹⁹ Context ¹⁶¹³⁹⁴	legend ⁴⁴ view ¹⁰⁴⁵ terrace ⁴⁸⁴⁷ recipe ⁵¹⁴² workshop ¹⁹³²⁵
skulenboarch.nl	Coöperatie Enerzjyk Skûlenboarch	The revenues from the solar park will benefit the surrounding villages.	Cooperatives → Energy Cooperatives ³¹⁵	solar park ¹⁶² cooperative ⁶⁴⁹ energy ⁹⁰⁷⁵	Smallingerland → Drachten ²⁰⁵²
devlaschaard.nl	Minicamping De Vlaschaard	The surrounding area provides access to various charming villages and historic towns.	Camping → Farm Camping ³⁸⁶	sanitary facilities ⁹⁸ campsite ²⁰⁹³ beach ³²¹⁰ vacation ⁴²³⁴ accommodation ⁴⁹²¹	Veere → Koudekerke ²⁰⁰
theatertros.nl	Theater t Ros	The performance is based on stories from various villages of the Acht Zaligheden.	Music & Performance → Music Events ⁷⁵⁸ Context ¹⁶¹³⁹⁴	stage ⁷⁵⁸ song ¹²⁸⁵ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰	North-Brabant → Eindhoven ¹¹⁸⁴⁵
atretino.nl	atretino.nl	In addition to cities, villages and small towns are highlighted as attractive travel options.	Travel Planning → Travel Advice ³⁷² Regions → Europe ⁶⁷⁶⁴	train travel ¹⁶ tourism ³⁰³ city ¹⁸⁷⁵ vacation ⁴²³⁴ travel ⁷²¹⁰
verloskundigenpraktijknova.nl	Verloskundigen Praktijk Nova	The practice is accessible to patients in various villages, such as Nieuwkoop and Ter Aar.	Doctors → Midwives ⁸⁹	midwife ⁵⁵³ pregnancy ²⁷³⁹ practice ⁹⁰⁸⁹ care ¹²³³⁸	Kaag en Braassem → Rijnsaterwoude ⁸⁶
winkelinbreukelen.nl	Breukelen Merchants' Association	Breukelen is a charming shopping and recreational village located on the Vecht River.	Sustainable Living → New Developments ²⁰⁰ Economy → Local Economy & Development ⁷²¹	market ²⁷⁷² shop ⁶⁴⁸³ event ⁴⁵¹⁹⁹	Stichtse Vecht → Breukelen ⁶³²
beleefdeveluwezoom.nl	Stichting Toeristisch Platform Zuid- Oost Veluwezoom	Several picturesque villages, such as Rozendaal and Velp, are part of the region.	Hiking → Walking Routes ²²⁶	nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Rheden → Laag-Soeren ⁹⁸
gk-sgravenmoer.nl	Reformed Church 's Gravenmoer	's Gravenmoer is a village located in the Hollandic Water Line with a Protestant background.	Local Communities → Villages ¹⁰⁰⁵ Protestantism → Reformed ¹³²³	pkn ¹⁴ church ³⁴³⁹ member ¹⁰¹⁵⁴	Dongen → 's Gravenmoer ⁵⁷
dezwaanberkenwoude.nl	De Zwaan	De Zwaan is located in the charming village of Berkenwoude, in the Krimpenerwaard.	Conferences & Meetings → Meeting Venues ⁷²⁹ AccommodationTypes → Accommodation ¹²¹³⁰	venue ⁸⁷⁹ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Berkenwoude ⁶²
debeul.nl	Lech Tourism	The Lech Valley has charming mountain villages with unique architecture and traditions, reflecting the rich cultural history of the area.	Austria → Tyrol ²¹ Hiking → Europe ⁵¹	winter sports ¹⁹⁶ mountain ²⁰⁰ hiking ⁸⁴¹
hetverhaalvanrenkum.nl	The Story of Renkum	The website describes the history of the six villages within the municipality of Renkum.	Local History → Municipal History ¹⁴ Hiking → Walking Routes ²²⁶	walking route ³⁴⁰ museum ²⁰⁰² history ⁷²⁸⁶ story ⁸²⁸⁵	Renkum → Oosterbeek ⁶⁰⁴
olympi.nl	IOC	The Olympic Village in Tokyo serves as accommodation for athletes and staff during the Games.	News & Journalism → Sports News ⁵⁵⁹ Competitive Activity → Olympic Games ¹⁹	tokyo ¹⁵ olympics ²¹ karate ²⁷⁴ athlete ⁴²⁹
hiddenponds.nl	Hidden Ponds	The text describes several charming villages, such as Ardgroom, Eyeries and Castletownbere, which are characteristic of the area.	Europe → Ireland ²⁶ Context ¹⁶¹³⁹⁴	ireland ³⁸ gardening ⁵⁰⁵ webdesign ⁴⁰⁹²	Zeeland → Zeeuws-Vlaanderen ⁶⁷⁷
groenspanje.nl	N/A	Alternately rugged rock landscapes with meadows and medieval villages.	Accommodation → Guesthouses ⁷²⁶ Europe → Spain ¹³¹⁶	pilgrimage ¹⁴⁸ coast ¹⁹⁹ landscape ²⁶⁰⁹ culture ³⁹²² region ⁵⁴¹²
vayamosfietsreizen.nl	Vayamos Fietsreizen	The cycling routes lead through small historical villages, offering an authentic Catalan atmosphere.	Catalonia → Costa Brava ³⁶ Cycling → Cycling Holidays ²⁹⁵	costa brava ²⁰ cycling holiday ⁸³ bike ¹⁵⁴¹ tour ²³¹⁵ route ³⁴²⁵
buurtschaprodeo.nl	Buurtschap Rodeo BV	The website emphasizes that the homes are being placed in a village with village charm, creating a sense of community.	Accommodation → Villas ¹⁰¹⁸ Vacations → Beach Vacations ⁸⁶⁶	villa ¹³⁵¹ water ²⁵⁰¹ apartment ⁵⁰⁸⁸ construction ⁷⁴²¹ house ⁸¹²¹	Dijk en Waard → Broek op Langedijk ²⁴³
korteraarseweg141.nl	Houtman & de Vogel Makelaardij	Aarlanderveen is a charming village in South Holland, located in the Green Heart.	Houses → Semi-Detached Houses ⁷⁵¹ Property Features & Details → Previously Sold ²¹	recreation area ³⁵ street ²⁸¹ plot ¹⁰⁵¹ environment ⁴⁸⁷³ house ⁸¹²¹	Lingewaard → Bemmel ⁵⁰⁹
brandweerakkrum.nl	Brandweer Akkrum	Brandweer Akkrum provides its services and is involved in the safety of the village of Akkrum.	Emergency Services → Fire Department ¹³⁸	fire department ¹⁷¹ volunteer ⁸³⁶⁷	Heerenveen → Akkrum ²⁴⁶
erfgoededucatieopmaat.nl	Erfgoededucatie op Maat	The website offers expeditions through different villages, such as Baalderveld and Lemelerveld, to explore local history.	Monuments → Cultural Heritage ⁵¹⁴ Monuments → Heritage ⁵²⁶	heritage ⁸¹⁸ fund ¹⁰⁶³ lesson ⁵¹⁵⁴ school ⁷⁸⁵⁶	Hardenberg → Baalder ¹⁴
delindseacht.nl	De Lindse Acht	Leende is a vibrant village with a wide range of facilities and an attractive atmosphere.	Villages → Dutch Villages ¹⁷ Places → Towns ³⁸⁰	housing offer ²⁴ house ⁸¹²¹	Heeze-Leende → Leende ²⁵¹
sunne-energie.nl	Sunne Energie	The ultimate goal is a net-zero village by 2035.	Cooperatives → Energy Cooperatives ³¹⁵	cooperative ⁶⁴⁹ solar panels ⁴⁷⁰¹ energy ⁹⁰⁷⁵ member ¹⁰¹⁵⁴ sustainability ¹⁸⁴⁵¹	Dinkelland → Deurningen ¹²¹
zeelandvakantiehuisjes.nl	Zeeland Vakantiehuisjes B.V.	Each of the many villages in Zeeland has its own unique charm.	Accommodation → Bungalows ¹⁰⁰⁸	holiday home ²⁷⁵³ nature ⁹⁰⁹⁴ restaurant ¹¹²¹⁵	Veere → Oostkapelle ²⁰⁵
shopbeleefhw.nl	Hoeksche Waard	The website describes the charm and allure of the different villages.	Local Communities → Villages ¹⁰⁰⁵	shopping area ³⁶ market ²⁷⁷² shop ⁶⁴⁸³ nature ⁹⁰⁹⁴ restaurant ¹¹²¹⁵	Hoeksche Waard → 's-Gravendeel ²⁰⁰
thules.nl	Thules Noorse Boskatten Cattery	The cattery is located in the small village of Streefkerk, situated in the Alblasserwaard.	Pets → Cats ⁶³⁹ Travel → Culture ⁶⁵⁵	cat ¹⁵⁷⁸ region ⁵⁴¹² family ⁶⁴⁶²	Molenlanden → Kinderdijk ¹⁵⁸
helloameland.nl	Velsen	Ameland has four villages: Ballum, Buren, Hollum and Nes, each with its own character.	Hotels → Hotels in Netherlands ¹⁰	beach ³²¹⁰ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Friesland → Ameland ⁹³⁰
thedemaborg-nietap.nl	Thedemaborg	Nietap is a historic village that forms the basis for the new residential area Thedemaborg.	House Types → Houses ²⁵⁴⁶ Architecture & Sites → Historical Sites ¹⁹⁵¹	plan ²⁵⁶⁶ house ⁸¹²¹ nature ⁹⁰⁹⁴	Westerkwartier → Leek ⁶⁴²
huntershof.nl	Huntershof	The proximity to the tourist village of Diever adds another dimension to the location.	Accommodation → Group Accommodation ⁸⁴⁴ Nature → National Parks ⁸⁹⁸	farmhouse ⁸⁷⁸ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Westerveld → Diever ²²⁰
feestcomite.nl	Feestcomité Ammerstol	The events take place in the village of Ammerstol, where flags are also hung.	Local Events → Village Events ⁷⁵ Village Focus → Village Organizations ⁶⁸³	king's day ⁸⁸ christmas market ¹⁶³	Krimpenerwaard → Ammerstol ⁴⁹
nufilmpjeshier.nl	Nufilmpjeshier	The charm of small Italian villages is presented as an alternative to major cities, offering a distinct way of life.	Europe → Italy ⁷⁸⁶	court ⁹⁹⁹ woman ¹⁴¹⁹ culture ³⁹²² health ⁶³⁶⁶ technology ⁶⁸¹⁶
brigittekwantenvanloon.nl	Brigitte Kwanten - van Loon	A significant portion of the artwork depicts scenes of charming villages.	Visual Arts → Drawing ¹⁰⁴⁶ Painting → Oil Painting ³²⁶	portrait ³⁶⁸⁵
salzburgersportwelt.nl	Salzburger Sportwelt Tourismus GmbH	The website describes several villages, such as Flachau and Wagrain.	Skiing → Ski Resorts ²⁰⁶	summer holiday ³⁶ ski area ¹⁷⁶ winter sports ¹⁹⁶ hiking ⁸⁴¹ accommodation ⁴⁹²¹
kvwell.nl	KVW Ell	KVW Ell is an initiative of a small village that wants to show itself on a large scale, with the community playing a key role.	Games & Play → Games ³⁹¹¹ Vacations → Children’s Vacations ¹⁰	song ¹²⁸⁵	Leudal → Ell ⁵⁸
benbdehegewei.nl	BenBdeHegewei	The B&B is located in a small village on a quiet road.	Accommodation → Guesthouses ⁷²⁶ Nature → National Parks ⁸⁹⁸	lake ³⁵² b&b ¹⁰⁶⁰ forest ¹⁴¹⁸ breakfast ¹⁸²² accommodation ⁴⁹²¹	De Fryske Marren → Harich ³⁵
casadelafuente.nl	Vakantiehuis Casa de la Fuente	Sagra is presented as an authentic small village, characteristic of the region.	Spain → Costa Blanca ²⁸⁴	valley ³⁷ natural area ²⁰⁸ holiday ²²⁹⁵ beach ³²¹⁰
autoclubtrips.nl	Autoclubtrips	The area has idyllic villages, which are part of the holiday suggestions.	Accommodation → Guesthouses ⁷²⁶ TravelStyles → Road Trips ¹⁸⁷	castle ⁴⁹⁴ holiday ²²⁹⁵ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ car ¹⁰⁸⁶⁵
2santorini.nl	Travel Agency	It describes the most beautiful villages on Santorini, each with its own unique charm.	Greece → Cyclades ¹¹ Vacations → Island Vacations ²⁴³	beach ³²¹⁰ vacation ⁴²³⁴ accommodation ⁴⁹²¹ blog ¹³³⁹²
blauwblood.nl	Stichting Blauw Blood	The village forms the basis of the foundation’s events.	Christmas → Christmas Markets ¹⁶⁴ Village Focus → Village Initiatives ¹³⁷	nativity scene ¹⁷ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	Peel and Maas → Helden ¹⁶⁶
markantzeewolde.nl	Markant Zeewolde	The Dukdalf is designed with colors and materials reminiscent of a characteristic fishing village.	House Types → Apartment Living ³⁵⁵⁹ Neighborhood Focus → Neighborhoods ¹⁰²⁸	harbor ⁶⁹¹ neighborhood ²⁴²⁴ water ²⁵⁰¹ house ⁸¹²¹	Flevoland → Zeewolde ¹²⁴³
huisjeopcorfu.nl	Vakantiehuisje ‘huisjeopcorfu’	The idyllic village of Kastania offers an authentic Greek atmosphere and a cozy environment.	Islands → Corfu ¹⁷ Accommodation → Villas ¹⁰¹⁸	corfu ²¹ holiday house ⁴⁰² owner ⁵¹⁵ sea ⁷⁸² house ⁸¹²¹
vvdtholen.nl	VVD Tholen	The villages in the municipality of Tholen are considered attractive living and working environments.	Local Politics → Parties ⁶²² Local Politics → Municipal Council ⁴⁸⁴	election program ⁸⁵ traffic ⁹¹⁶ candidate ¹⁸⁹⁶ care ¹²³³⁸	Zeeland → Tholen ⁸⁶³
giethoorn-boat-rental.nl	Giethoorn Village	Giethoorn, often referred to as the ‘Venice of the North,’ is the primary destination for boat rentals offered on the website.	Water Travel → Boat Tours ⁶⁴⁰	canal ⁵⁰⁷ parking ¹⁹²⁸ boat ²⁹⁸⁰ app ⁴⁵⁹⁵	Steenwijkerland → Giethoorn ⁵⁶⁵
buurtschapdedeel.nl	Nieuwleusen Bouw BV	The project creates a new village in Nieuwleusen, a vibrant and safe living environment.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Community → Social Issues & Welfare ²⁸¹⁵⁹	courtyard ²⁰⁶ bungalow ⁶⁸⁷ sustainability ¹⁸⁴⁵¹	Dalfsen → Nieuwleusen ³¹⁸
kvyneflecht.nl	Kaatsvereniging Yn ‘e Flecht	The association is located in a village.	Associations → Village Associations ¹⁵² Local Organizations → Sports Clubs ²⁵²⁸	kaats ³⁰ report ⁴⁵⁵¹ membership ¹⁰⁴⁴² training ²⁸¹³³ event ⁴⁵¹⁹⁹	Southwest-Friesland → Ysbrechtum ¹³
dorpsoverlegkessel.nl	Stichting Dorpsoverleg Kessel	The Stichting Dorpsoverleg Kessel is an organization that represents the interests of the residents of Kessel and encourages involvement.	Local Government → Village Council ⁴⁷⁹ Village Focus → Village Life ²⁶²	resident ³²⁴⁵ municipality ⁶⁸³⁷ news ¹⁵²⁹³
albaneserivieravoorbeginners.nl	N/A	Traditional villages are a characteristic of the Albanian Riviera, contrasting with the crowds of popular coastal areas.	Balkan → Albania ¹⁹ Vacations → Beach Vacations ⁸⁶⁶	tourism ³⁰³ climate ⁹³⁴ beach ³²¹⁰
wouwpromotie.nl	Stichting Wouw Promotie	Wouw is known as the Geranium Village.	Associations & Groups → Business Associations ¹⁰¹⁸ Tourism → Regional Tourism ²⁴²	tourism ³⁰³ signage ⁸³⁸ municipality ⁶⁸³⁷ event ⁴⁵¹⁹⁹	Roosendaal → Wouw ¹⁴⁷
watervillaparck-giethoorn.nl	Van Wijnen Recreatiebouw	Giethoorn, the Venice of the North, is the location of Watervillaparck.	Accommodation → Villas ¹⁰¹⁸ Water → Boating ¹⁵⁹²	recreation ⁷⁹⁹ investing ⁹¹¹ villa ¹³⁵¹ park ¹⁸⁶³ housing ⁴³⁷⁸	Steenwijkerland → Giethoorn ⁵⁶⁵
delakermaat.nl	De Lakermaat	The development aims to strengthen the village atmosphere and community spirit.	Local Governance → Zoning Plans ⁴⁸ Context ¹⁶¹³⁹⁴	landscape ²⁶⁰⁹ municipality ⁶⁸³⁷ home ⁷⁹⁷⁶ nature ⁹⁰⁹⁴	Montferland → Lengel ²²
romeinenpoort28.nl	Mooi Wonen Makelaars	The Old Village, located within walking distance of the house, offers a wide range of restaurants and shops.	Apartment Living → For Sale ¹⁰⁰⁷ Property Features & Details → Residential Agents ⁴⁵	neighborhood ²⁴²⁴ solar panels ⁴⁷⁰¹ school ⁷⁸⁵⁶ house ⁸¹²¹ garden ¹³¹²⁹	Utrecht → Houten ¹⁶⁷⁷
partyco.nl	BUGALOE	Riverside villages are located on either side of the Linge.	Water Sports → Water Recreation ⁵⁹⁹ Marine & Watercraft → Watercraft ⁴⁴	sloop ²⁷² engine ⁷⁵⁸	Lingewaard → Doornenburg ¹²⁹
gite-frankrijk.nl	Château d'Impasse	The holiday home is located in a small, romantic village set on a hill.	Europe → France ¹⁰⁴¹ Nature → Nature Reserves ¹⁰³²	wood stove ²¹⁴ bakery ⁷¹⁸ holiday home ²⁷⁵³ room ³⁴¹¹ terrace ⁴⁸⁴⁷
piemontetips.nl	PiemonteTips	Piedmont is known for its charming villages, such as Alba and Neive.	Northern Italy → Piedmont ²⁷ Vacations → City Breaks ⁵³⁶	wine region ⁶² city ¹⁸⁷⁵ wine ⁴⁴⁷⁶ travel ⁷²¹⁰
kvwzjwame.nl	KVW Zjwame	The special week is an event that brings the entire village together.	Associations → Village Associations ¹⁵² Early Years → Childcare ⁶⁰²⁹	motorcycle ride ¹⁸ game ²⁸⁰⁷ staff ³⁴⁰⁵ sport ⁴²²⁸ child ¹¹⁵⁶⁶	Roermond → Swalmen ²⁵⁴
huren-casacarpediem.nl	Casa Carpe Diem	Moraira is a small, traditional fishing village with a unique charm, due to its low-rise buildings and strict building regulations.	Spain → Costa Blanca ²⁸⁴ Vacations → City Breaks ⁵³⁶	costa blanca ⁹⁴ watersport ⁵⁴⁰ harbor ⁶⁹¹ beach ³²¹⁰ accommodation ⁴⁹²¹
fotospeurtocht.nl	Fotospeurtocht.nl	The hunts lead participants through various villages in the Netherlands and showcase their history.	Family Activities → Day Trips ⁴¹⁹ Events & Activities → Outdoor Activities ¹⁰⁴³	treasure hunt ⁵² children's party ¹¹⁵ company outing ¹⁶⁶ city ¹⁸⁷⁵ walk ²¹⁶¹	North-Brabant → Oirschot ⁹²⁹
capellevelt15-1.nl	demakelaarvanhier.nl	The house is located in the church village of Eerde.	Houses → Corner House ²⁸¹ Car Selling & Valuation → Cars ²⁶⁹⁸	plot ¹⁰⁵¹ garage ¹²¹⁰ bedroom ²⁰⁵¹ house ⁸¹²¹ garden ¹³¹²⁹	Maashorst → Uden ¹⁵⁴⁰
cottagenostalgie.nl	Cottage Nostalgie	Millen, a historic village, is an attractive destination in the area.	Accommodation → Lodging ³¹⁷	stay ⁷⁰² b&b ¹⁰⁶⁰ room ³⁴¹¹ nature ⁹⁰⁹⁴	Sittard-Geleen → Sittard ¹⁹⁹⁷
smgvooralledorpen.nl	SMG	SMG emphasizes the importance of preserving the unique identity of the various villages within the municipality.	Local Politics → Municipal Elections ⁸⁸	political party ⁷⁵ election program ⁸⁵ municipality ⁶⁸³⁷ news ¹⁵²⁹³
villakyria.nl	Villa Kyria & Villa Anna	The villas are situated in the picturesque village of Kyrianna.	Greece → Crete ⁶⁸ Accommodation → Bungalows ¹⁰⁰⁸	crete ⁴³ view ¹⁰⁴⁵ villa ¹³⁵¹ pool ¹⁵³² family ⁶⁴⁶²
abdijinfrankrijk.nl	Sites4ondernemers	The abbey is located near several villages in the surrounding area.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Accommodation → Country Estates ⁷³⁸	abbey ⁴⁴ fireplace ⁷⁵² pool ¹⁵³² room ³⁴¹¹ terrace ⁴⁸⁴⁷
bbdewaterjuffer.nl	De Waterjuffer	The location is in the vicinity of the villages of Elim, Nieuwlande, and Hollandscheveld.	Hiking → Trails ³⁵⁶ Accommodation → Guesthouses ⁷²⁶	b&b ¹⁰⁶⁰ forest ¹⁴¹⁸ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bussare.nl	Holiday House Bussare	Olivetta San Michel, the nearest village, offers basic amenities and a relaxed atmosphere.	Accommodation → Group Accommodation ⁸⁴⁴ Landscape → Mountains ⁸¹	river ³¹² holiday house ⁴⁰² hiking ⁸⁴¹ holiday ²²⁹⁵ nature ⁹⁰⁹⁴
estrellabnb.nl	Estrella Bed&Breakfast	Guests can explore the picturesque villages in the area and enjoy the local culture.	Cycling → Cycling Routes ¹⁰⁰² Nature → National Parks ⁸⁹⁸	hill ¹⁶ stream ⁶⁸⁴ beer ²⁸⁸⁷	Limburg → Maastricht ⁶⁰⁰⁸
funride-france.nl	Fun Ride France	The rented cars make it possible to explore the charming villages of Burgundy.	Accommodation → B&B ²⁵ Rental Services → Car Rental ¹⁰⁴⁷	picnic basket ³³ river ³¹² car ¹⁰⁸⁶⁵
herbergenvannederland.nl	Herbergen van Nederland	Pubs are also presented that are central to their local villages.	Hotels → Inns ¹¹⁴ Architecture & Sites → Historical Sites ¹⁹⁵¹	pub ¹⁸⁵ city ¹⁸⁷⁵ history ⁷²⁸⁶ nature ⁹⁰⁹⁴	Mook en Middelaar → Mook ¹⁸⁰
laanvanhavezathen46.nl	Peter's makelaardij	Norg is a picturesque Drents brink village surrounded by extensive forests.	Houses → Corner House ²⁸¹ Apartment Living → For Sale ¹⁰⁰⁷	garage ¹²¹⁰ solar panels ⁴⁷⁰¹ property ⁷⁴⁰⁶ garden ¹³¹²⁹	Hoogeveen → Noordscheschut ¹⁰⁸
markanteplaatsen.nl	Markante Plaatsen	A traditional village, Penglipuran, was among the locations visited during the trip.	Indonesia → Bali ⁵⁶ Events → Solo Travel ¹³	waterfall ²⁹ bali ¹⁰⁹ temple ¹²² guide ¹³⁶⁴ photo ⁷⁷⁷⁸
moniquepeerlings.nl	Schoonheidssalon Monique Peerlings	The salon is located on the edge of the village with a peaceful, rural view.	Vacations → Wellness Vacations ¹⁸ Landscape → Nature Areas ⁵⁸	skincare ¹⁹⁷² stress ³⁹⁶⁵ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Weert → Stramproy ¹²³
nieuwbouwhoutens.nl	Nieuwbouw Houtens	Houtens is presented as a village with a traditional character and a lively center.	Apartment Living → New Construction ¹³⁶² Municipalities → Breugel ¹¹	green ⁸⁸⁹ home ⁷⁹⁷⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
positieflandsmeer.nl	Positief Landsmeer	The website emphasizes the importance of preserving the village character of Landsmeer.	Local Governance → Local Politics ²⁵⁵⁹ Village Focus → Village Life ²⁶²	situation ⁶⁵⁵ politics ¹²⁵⁹ housing ⁴³⁷⁸	North-Holland → Landsmeer ⁴¹³
regussehuis.nl	N/A	The house is within a 5-minute walk of a picturesque village.	Accommodation → Villas ¹⁰¹⁸ SpecificDestinations → Travel Destinations ³⁵	provence ⁵⁷ villa ¹³⁵¹ swimming pool ¹⁶⁶⁴
vbw-nieuwlekkerland.nl	VBW Nieuw-Lekkerland	All activities take place in the village of Nieuw-Lekkerland.	Protestantism → Reformed ¹³²³	adults ⁶¹⁷ youth ³¹²⁶ child ¹¹⁵⁶⁶	Molenlanden → Kinderdijk ¹⁵⁸
waardereiland.nl	Waarder Eiland	Waarder Eiland is designed to create a village atmosphere with cozy neighborhoods.	Hiking → Europe ⁵¹ Real Estate → Housing ¹¹¹²⁰	path ⁴⁶⁶ water ²⁵⁰¹ environment ⁴⁸⁷³ sale ⁵⁹³⁰ home ⁷⁹⁷⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
rondjeteylingen.nl	Municipality of Teylingen	The routes run through the villages of Sassenheim, Voorhout, and Warmond, each with its own unique characteristics.	Hiking → Trails ³⁵⁶ Nature → Forest ³⁸⁷	arrow ⁴¹ sports field ⁷⁵ walk ²¹⁶¹ route ³⁴²⁵	Teylingen → Warmond ³⁸⁴
maisonbeauverger.nl	N.V. Maison Beau Verger	The village of Montblainville is characterized by the rhythm of the day and the church bell.	Spain → Costa Blanca ²⁸⁴ France → Northern France ²⁰	orchard ²⁴⁰ cemetery ³⁹⁵ vacation home ⁴⁸⁸ fruit ¹¹⁶⁶ nature ⁹⁰⁹⁴
genietop10.nl	GENIET OP10	The house is located in the charming village of De Rijp.	Water Travel → Boat Tours ⁶⁴⁰ Nature → Nature Reserves ¹⁰³²	holiday home ²⁷⁵³ vacation ⁴²³⁴ garden ¹³¹²⁹	Zaanstad → Zaandam ²⁷⁴⁰
wintersportman.nl	Wintersportman B.V.	Valmorel is described as a beautiful romantic winter sports village.	Skiing → Ski Resorts ²⁰⁶	destination ²⁵⁸⁰
streetlightministries.nl	Stichting Streetlight Ministries	The evangelists visited impoverished villages in Malawi and Tanzania to preach the Gospel.	Christianity → Evangelism ¹³⁰ Social Issues → Humanitarian Aid ⁶²¹	evangelism ⁸⁶ god ⁵¹⁵ mission ¹⁰⁰⁰ bible ¹²⁷⁶ trip ²⁰³²	Netherlands → Utrecht ⁴⁸⁹⁰¹
harskampsbelang.nl	Harskamps Belang	The association functions as a village interest association working to improve the livability of Harskamp.	Associations → Community Associations ¹⁶ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	policy ²¹⁴⁹ meeting ²³⁸¹ resident ³²⁴⁵	Ede → Otterlo ³⁷¹
unicefloopdelier.nl	Unicef	Unicef is collaborating with villages in Madagascar to improve their living conditions through sustainable solutions.	Social Organization → Humanitarian Organizations ¹¹³⁵ Outdoor Adventures → Walking ¹²⁶⁰	loop ⁷² climate ⁹³⁴ water ²⁵⁰¹ donation ⁵¹¹⁰ education ¹³⁴⁷¹	Westland → De Lier ⁴⁰⁴
grubbenvorster-revue.nl	Grubbenvorster Revue	Grubbenvorster is the place where the Revue is active and where the performance takes place.	Theater → Revue ¹⁸ Village Focus → Village Organizations ⁶⁸³	revue ²⁴ theater ²⁵⁴⁴ community ⁷⁹³¹ music ¹³¹⁷⁰	Zoetermeer → Willem de Zwijgerlaan ²¹
villalaventure.nl	Fam. Van Der Weegen	The house offers a view of the picturesque village of Claviers.	Accommodation → Villas ¹⁰¹⁸ Europe → France ¹⁰⁴¹	private pool ¹² provence ⁵⁷ vacation house ¹³⁵ garden ¹³¹²⁹
vakantienaaribiza.nl	N.V.	The authentic villages of Ibiza offer another side of the island besides the beaches and parties.	Balearic Islands → Ibiza ⁸⁰ Vacations → Island Vacations ²⁴³	ibiza ⁸⁸ beach ³²¹⁰ party ⁵⁹²⁸ nature ⁹⁰⁹⁴
keningspleats.nl	Keningspleats	The location in Veenklooster offers access to several lovely villages.	Communication → WhatsApp ²⁵ Nature → Forest ³⁸⁷	sauna ¹¹⁷⁵ forest ¹⁴¹⁸ swimming pool ¹⁶⁶⁴ holiday home ²⁷⁵³	Northeast-Friesland → Holwert ⁸³
hetlevenvantoen.nl	hetlevenvantoen.nl	The stories come from various villages, including The Hague and Staphorst.	Specialized History → World War II ¹¹³⁴	storyteller ⁷⁴ world war ii ¹⁵³ adults ⁶¹⁷ story ⁸²⁸⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
la-grande-curtille.nl	Vacances chez nous	The farmhouse is located in Fontenois la Ville, a small tourist village.	Camping → Farm Camping ³⁸⁶ Camping → Campsites Netherlands ⁷⁹²	cycling route ⁴⁵¹ sanitary ⁷⁵⁰ farmhouse ⁸⁷⁸ campsite ²⁰⁹³	Netherlands → Utrecht ⁴⁸⁹⁰¹
villalamaria.nl	Villa La Maria	The holiday house is located in a small village, which is known for its friendly people and quiet atmosphere.	Accommodation → Villas ¹⁰¹⁸ Accommodation → Bungalows ¹⁰⁰⁸	holiday house ⁴⁰² swimming pool ¹⁶⁶⁴ bedroom ²⁰⁵¹ garden ¹³¹²⁹	Netherlands → Utrecht ⁴⁸⁹⁰¹
huizebokum.nl	The descendants of the farming tradition of Oud Bokum	The village of Bokum consists of two large farms, Oud Bokum and Nieuw Bokum.	Accommodation → Holiday Parks ¹⁰²⁴ Landscape → Polders ²¹²	polder ⁴⁷⁶ view ¹⁰⁴⁵ holiday home ²⁷⁵³ house ⁸¹²¹ garden ¹³¹²⁹	Het Hogeland → Kloosterburen ⁶²
boomkleverzeegse.nl	De Boomklever Zeegse	The nearby village of Zuidlaren offers various facilities and activities.	Accommodation → Holiday Homes ⁷²⁷ Nature Conservation → Landscape Conservation ¹¹⁴	wooded area ¹⁹ heat ²¹⁸⁸ holiday home ²⁷⁵³	Tynaarlo → Zeegse ³⁴
dedorpspomp.nl	De Dorpspomp	The project focuses on the village of Beerta and is based on the will of the residents.	Initiatives & Collaboration → Initiatives ⁴⁵⁹	enterprise ¹⁰¹ gas ⁴³⁴ resident ³²⁴⁵	Oldambt → Beerta ⁵⁴
kerkboekjes.nl	Huisje op Texel Huren	The text describes various villages on Texel, such as De Cocksdorp and Oudeschild.	Context ¹⁶¹³⁹⁴	holiday ²²⁹⁵ accommodation ⁴⁹²¹ house ⁸¹²¹	Texel → De Cocksdorp ⁸⁷
beeldbank.landvancuijk.nl	Beeldbank Land van Cuijk	The website offers photos of various villages within the Land van Cuijk area.	Parties → Themed Parties ⁵⁸³ Arts → Imaging & Photography ⁷⁶⁸⁷	photographer ¹³⁶⁶ results ³⁹⁵⁴ theme ⁴⁰¹⁵ photo ⁷⁷⁷⁸	Land van Cuijk → Boxmeer ⁸⁶¹
vakantiemorvan.nl	Vaupranges & Lormes	The small villages in the Morvan are presented as an authentic experience.	House Types → Houses ²⁵⁴⁶ Nature → Nature Reserves ¹⁰³²	morvan ²⁵ hiking ⁸⁴¹ forest ¹⁴¹⁸ holiday home ²⁷⁵³ nature ⁹⁰⁹⁴
vakantieverblijfduitsland.nl	vakantieverblijfduitsland.nl	The vacation home is located in the quiet village of Werfen.	Nature → Nature Experiences ²⁰ Nature → Forest ³⁸⁷	vacation home ⁴⁸⁸ forest ¹⁴¹⁸ wellness ¹⁵⁶¹ nature ⁹⁰⁹⁴	Gelderland → Nijmegen ⁹³⁸⁴
terp10.nl	Terp 10 Communicatie	The agency works on projects for villages, such as the ‘Gouddelven in Hitzum’ project.	Local Communities → Villages ¹⁰⁰⁵ Communication → PR ⁸⁷⁹	partner ⁴²⁷² communication ¹⁰¹⁶²	Waadhoeke → Oosterbierum ²³
monumentaalwestland.nl	Stichting Monumenten Westland	The website organizes the monuments by village.	Historical Sites → Monuments ¹⁰²⁷ Travel Guides → Regional Travel Guides ⁸⁵	monument ¹¹⁶⁸ foundation ⁶⁶⁷⁸ history ⁷²⁸⁶ photo ⁷⁷⁷⁸	Westland → Monster ³⁶⁰
onverwachtehoek.nl	Onverwachte Hoek	Winterswijk is described as a village with the qualities of a town.	Local Economy & Development → Regional Development ²⁹⁶ Career & Guidance → Career Planning ³⁷⁵	living ⁵⁷⁸ work ³¹²² region ⁵⁴¹² story ⁸²⁸⁵	Tubbergen → Geesteren ²⁰⁰
mfcwillemsoord.nl	MFC Willemsoord	The MFC is described as a central part of the local village life in Willemsoord.	Local Government → Municipal Organizations ⁴¹⁶ Village Focus → Village Centers ¹⁶	mfc ⁴²	Steenwijkerland → Willemsoord ⁶⁶
buurtschapboswijk.nl	Development Corporation	Buurtschap Boswijk is the project located in Doorn, focused on transforming a parking lot into a living environment.	Sustainable Living → New Developments ²⁰⁰ Landscape → Utrechtse Heuvelrug ⁷⁷	parking lot ⁷⁵ greenery ¹⁰¹ living ⁵⁷⁸ housing ⁴³⁷⁸	Utrecht Hill Ridge → Doorn ⁶¹⁵
wisselsbelang.nl	Gemeente Epe	The village of Wissel is involved in the project.	Safety → Traffic Safety ¹¹⁷ Government & Administration → Local Government ⁴⁵⁹¹	traffic plan ³⁷ traffic safety ⁹⁹ measures ¹⁹² survey ³⁷⁰ resident ³²⁴⁵	Apeldoorn → Driehuizen ⁶⁶
sunflight.nl	sunflight.nl	The picturesque fishing village of Kokkari on the Greek island of Samos is presented as an attractive destination.	AccommodationTypes → Accommodation ¹²¹³⁰ Environment → Nature ⁸⁴⁵⁴	volcano ¹⁴ caves ¹⁹ stacaravan ²⁰ sea ⁷⁸² vacation ⁴²³⁴
harfsen.nl	Harfsen	Harfsen is the center of the information and events presented on the website.	Local Communities → Villages ¹⁰⁰⁵	festival ³⁸⁰⁴ community ⁷⁹³¹ association ⁸⁵⁶² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Lochem → Harfsen ¹⁰⁸
olgaschefferlie.nl	Olga Schefferlie	The story about Neerpelt is described as 'charming and open-hearted'.	Organizations → Society ⁷⁶⁷ Personal → Personal Stories ¹⁰²⁷	fountain pen ¹⁵ poverty ²⁹¹ dialogue ⁴²⁶ exhibition ⁵³³² story ⁸²⁸⁵	South-Holland → Schiedam ²²⁴⁹
midwinterhoornblazentwenthe.nl	Stichting Midwinterhoornblazen Twenthe	Midwinter horn blowers play their music from farm to farm and further afield, often in rural communities (villages).	Traditional Practices → Christmas Traditions ¹⁰ Spiritual Practices → Intangible Heritage ¹⁷	midwinter horn ¹⁰ tradition ⁷³⁶ heritage ⁸¹⁸	Assen → Assen West ⁵⁴
kollumermuseum.nl	Kollumer Museum MR. ANDREAE	The website provides information about villages in the area around Kollum.	Museums → Regional Museums ³⁹⁰	exhibit ³⁶ museum ²⁰⁰² family ⁶⁴⁶² history ⁷²⁸⁶	Northeast-Friesland → Burum ²⁰
kritegrou.nl	Krite Grou	The jubilee year is celebrated throughout the village of Grou.	Catholic → Parishes ⁴⁵⁷ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	jubilee ²⁴⁴ theater ²⁵⁴⁴ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Leeuwarden → Grou ³⁶⁶
vogtland.nl	Vogtland und Ertsgebergte Tourismus GmbH	The Vogtland and Ertsgebergte are known for their picturesque villages.	Europe → Germany ⁶⁵⁴ Winter Sports → Skiing ⁵⁹⁶	christmas market ¹⁶³ ski ²⁵⁶ vacation home ⁴⁸⁸ hiking ⁸⁴¹
grenslandmuseum.nl	Stichting Grenslandmuseum Dinxperlo	Dinxperlo and Suderwick are presented as twin villages due to their location on the border.	Museums & Collections → National History ⁵⁰ Museums → Local Museums ⁸⁷	border ¹¹⁹ museum ²⁰⁰² collection ⁷⁵⁶⁶ story ⁸²⁸⁵	Aalten → Dinxperlo ²⁴⁹
drenthemagazine.nl	Drenthe Magazine	The articles deal with the aspects of the diverse villages in the Hondsrug area.	Travel Guides → Regional Travel Guides ⁸⁵ Blogs & Publications → Regional ²⁷²	landscape ²⁶⁰⁹ theme ⁴⁰¹⁵ photo ⁷⁷⁷⁸ story ⁸²⁸⁵	Westerwolde → Bourtange ⁸⁵
hetspanjevanosborne.nl	hetspanjevanosborne.nl	The website mentions the cozy villages in Spain as an important part of the cultural experience.	Spain → Costa Blanca ²⁸⁴	place ²⁴² destination ²⁵⁸⁰ beach ³²¹⁰ culture ³⁹²² vacation ⁴²³⁴
hongaarshuis.nl	Hongaars Huis	The website presents houses in various villages in Hungary, such as Döbrököz.	Property Location & Neighborhood → Property ⁶⁹⁵ Europe → Hungary ⁵³	plot ¹⁰⁵¹ bedroom ²⁰⁵¹ region ⁵⁴¹² property ⁷⁴⁰⁶
visitbrummen.nl	Visit Brummen	The villages of Brummen and Eerbeek are named as attractive destinations.	Water → Rivers ¹⁸⁰ Cycling → Cycling Routes ¹⁰⁰²	river ³¹² cycle ¹⁹⁰⁶ walk ²¹⁶¹ festival ³⁸⁰⁴	Brummen → Eerbeek ³²⁸
chbennekom.nl	Concours Hippique Bennekom	A center with various companies and stalls.	Family Activities → Day Trips ⁴¹⁹ Equestrian → Show Jumping ⁴⁸	castle ⁴⁹⁴ horse ⁴³³⁷ competition ⁴⁷⁵⁹ child ¹¹⁵⁶⁶ event ⁴⁵¹⁹⁹	Ede → Bennekom ⁵⁵⁷
de4daagselive.nl	de4daagselive.nl	Dwingeloo is a picturesque village in Drenthe focusing on a livable environment.	Local History → Dutch History ¹⁰⁶⁷ Maintenance & Repair → Plumbers ⁸⁷⁹	life coaching ¹⁴⁷ plumber ¹²¹⁰ sustainability ¹⁸⁴⁵¹	Brummen → Eerbeek ³²⁸
sprookjestuinen.nl	The Sprookjestuinen van Drenthe	A cheerful fairy village is part of the festival environment.	Theater → Children’s Theater ³³ Festivals → Children’s Festivals ²¹	fairy ¹⁷ performance ⁷⁵⁸⁶ garden ¹³¹²⁹	Westerveld → Diever ²²⁰
allebedrijveninnijmegen.nl	Allebedrijven	Malden, located just south of Nijmegen, offers a charming and tranquil residential environment.	Wellness → Location Specific ²⁶ Events → Places ¹²¹⁹	university ⁵⁹³ shop ⁶⁴⁸³ history ⁷²⁸⁶	Berg en Dal → Groesbeek ⁶⁵³
lytskanaan.nl	B&B Lyts Kanaän	The B&B is located in the village of Mantgum, known for its historical architecture and unique atmosphere.	Hiking → Trails ³⁵⁶ Accommodation → Group Accommodation ⁸⁴⁴	b&b ¹⁰⁶⁰ breakfast ¹⁸²² accommodation ⁴⁹²¹ apartment ⁵⁰⁸⁸ studio ⁵⁴⁶⁵	Leeuwarden → Mantgum ³¹
fiets3daagseasten.nl	Fiets3daagse Asten	Along the routes, various hospitable villages can be found, where participants can taste the local atmosphere and take a rest.	Cycling → Cycling Tours ¹¹⁷	distance ²⁷⁰ route ³⁴²⁵ region ⁵⁴¹²	North-Brabant → Asten ⁸⁰⁷
cdawestland.nl	CDA Westland	The website mentions the various villages within the municipality of Westland.	Political Parties → VVD ¹⁸⁷	election ⁴⁰⁴ position ⁸⁷⁵ news ¹⁵²⁹³	Westland → Monster ³⁶⁰
boekhandelburgum.nl	Boekhandel Burgum	The owners emphasize the importance of supporting local shops in the village.	Books → Bookstores ⁵⁸³ Context ¹⁶¹³⁹⁴	wordpress ³⁵⁵¹ book ¹¹³⁹⁶	Tytsjerksteradiel → Burgum ³⁷¹
de-corylus.nl	Vakantie Appartement De Corylus	Oosterhesselen is a characteristic esdorp with old farmhouses and amenities.	Camping → Campsites Netherlands ⁷⁹²	rest ⁴³⁵ wifi ¹³⁷² forest ¹⁴¹⁸ apartment ⁵⁰⁸⁸	Coevorden → Oosterhesselen ⁶⁶
benbdeheughte.nl	Stichting Bed and Breakfast Nederland	The village center of Oosterwolde, located on the edge of the Veluwe, offers an interesting history.	Accommodation → Country Estates ⁷³⁸ Nature → Forest ³⁸⁷	spa ³⁵⁵ b&b ¹⁰⁶⁰ pool ¹⁵³² breakfast ¹⁸²²	Ooststellingwerf → Oosterwolde ⁴¹⁷
oranjeverenigingsgravendeel.nl	Oranjevereniging ‘s-Gravendeel	The association operates and organizes its events within the village of ‘s-Gravendeel.	Associations → Village Associations ¹⁵² Holidays & Commemorations → National Holidays ⁴⁷⁶	social media ³³⁴² volunteer ⁸³⁶⁷ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Hoeksche Waard → 's-Gravendeel ²⁰⁰
ervedriestreek.nl	Vakantiehuis Erve Driestreek	Erve Driestreek is located in the village of Den Ham, which is a unique location.	Accommodation → Lodging ³¹⁷ Vacations → Beach Vacations ⁸⁶⁶	vacation home ⁴⁸⁸ vacation ⁴²³⁴ terrace ⁴⁸⁴⁷ house ⁸¹²¹	Raalte → Luttenberg ⁵³²
dwarsdoorzelhem.nl	Stichting Parkmanagement Bedrijventerreinen Zelhem	The website describes Zelhem as a small village with a lively atmosphere, which can be shown to visitors in a new way.	Cycling → Cycling Events ¹³⁰ Cycling → Bike Routes ¹⁹	bike route ⁷⁸ municipality ⁶⁸³⁷ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Bronckhorst → Zelhem ⁴²²
kleine-camping.nl	Kleine Camping BV	The website presents historic villages as part of the appeal of the camping destinations.	Camping → Farm Camping ³⁸⁶	campsite ²⁰⁹³ camp ²⁴⁶⁶ destination ²⁵⁸⁰ nature ⁹⁰⁹⁴	Netherlands → Gelderland ⁶⁷⁰¹⁵
steunpuntkindervakanties.nl	Steunpuntkindervakanties.nl	The picturesque village of Giethoorn, known as the 'Venice of the Netherlands,' offers a unique experience of peace and beauty.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Local Events → Fairs ⁷⁰⁷	foodtruck ⁶¹³ hotel ³⁵⁴³ coffee ³⁸³⁸	Steenwijkerland → Giethoorn ⁵⁶⁵
skigebiedengids.nl	SkigebiedenGids.nl	The article describes the atmosphere and character of different ski villages.	Skiing → Ski Resorts ²⁰⁶	ski resort ⁷⁴ slope ¹⁰⁰ winter sports ¹⁹⁶ lift ⁴⁴⁵ ticket ²⁷⁸⁵
hetouweland.nl	Het Ouweland	De Rijp is a historic village where visitors can experience a unique and sustainable experience.	Water Travel → Boat Tours ⁶⁴⁰ Cycling → Electric Bikes ⁴⁴⁵	e-step ²³ whisper boat ³⁵ arrangement ³¹⁰⁴	Alkmaar → De Rijp ²²²
le-blog.nl	N/A	Many articles describe the atmosphere and events in the village.	Europe → France ¹⁰⁴¹ Fiction → Short Stories ³¹¹	interview ¹³⁷¹ recipe ⁵¹⁴² article ⁶⁰⁰⁰ restaurant ¹¹²¹⁵ book ¹¹³⁹⁶
boodschappengemak.nl	Alles ûnder ien Dak	The supermarket is located in the charming village of Eastermar.	Food Delivery → Delivery ²²²⁷ Food → Supermarkets & Grocery ³⁵⁶⁸	groceries ³⁵⁸ supermarket ⁴⁰⁶ terrace ⁴⁸⁴⁷ assortment ⁷⁷⁹⁹	Achtkarspelen → Surhuisterveen ²⁸¹
pandeon.nl	Stichting Pandeon	In 2022, Pandeon, with partners, realized a cultural project in eight Groninger and two Frisian villages.	Village Focus → Village Life ²⁶² Initiatives & Projects → Local Initiatives ¹⁰⁰¹	initiative ¹²⁹⁷ culture ³⁹²² region ⁵⁴¹²	Netherlands → Groningen ²³⁷³⁴
bretagnevoorbeginners.nl	TUI.nl	Brittany is known for its charming villages, sometimes even still in medieval condition.	France → Brittany ¹³ TravelContent → Travel Guides ⁹³⁸	brittany ²¹ guide ¹³⁶⁴ beach ³²¹⁰ history ⁷²⁸⁶ nature ⁹⁰⁹⁴
angelwingsverhalen.nl	AnGeL-WinGs	The stories are often set in villages in the surrounding area	Freelancers → Writers ⁶⁰⁹ Fiction → Short Stories ³¹¹	poem ¹⁰¹⁴ internet ¹⁶⁷⁸ story ⁸²⁸⁵ book ¹¹³⁹⁶	Netherlands → Friesland ²⁷⁹¹¹
partijsouburgritthem.nl	Partij Souburg-Ritthem	The party strives to be the best for the villages and its residents.	Political Parties → Local Parties ⁶⁸ Context ¹⁶¹³⁹⁴	faction ¹³² election ⁴⁰⁴ party ⁵⁹²⁸ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Vlissingen → Lammerenburg ³⁸
slovenievoorbeginners.nl	N/A	The country has small fairytale villages that lie untouched in the green hills.	Vacations → Active Vacations ⁵³ Regions → European Travel ⁶³	slovenia ²¹ landscape ²⁶⁰⁹ vacation ⁴²³⁴ nature ⁹⁰⁹⁴
burgum2040.nl	Burgum 2040	The website is specifically focused on the municipality of Burgum.	Local Politics → Parties ⁶²² Local Politics → Political Parties ⁸⁹⁸	future ⁴⁰⁴ idea ²³⁶⁷ housing ⁴³⁷⁸ collaboration ¹⁶⁰³⁶	Tytsjerksteradiel → Burgum ³⁷¹
stichtingayudamaya.nl	Stichting Ayuda Maya	The foundation works with entire villages to provide water and improve living conditions.	Social Issues → Humanitarian Aid ⁶²¹ Nonprofits → International Development ⁴²⁰	maya ¹² water ²⁵⁰¹ donation ⁵¹¹⁰ maintenance ²⁰⁰⁹³
nagathai.nl	Naga Thai	The way a village earns its living from the Mekong River determines the ritual.	Folklore & Mythology → Mythology ²¹ Stories → Travel Blogs ¹⁰¹⁶	thailand ⁹⁶ ritual ⁵⁰⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
ontdekdeplek.nl	Discoverdeplek.nl	The routes bring visitors into contact with the charming village character of the area.	Cycling Routes → Regional Routes ²¹ Outdoor Adventures → Walking ¹²⁶⁰	monument ¹¹⁶⁸ route ³⁴²⁵ history ⁷²⁸⁶ nature ⁹⁰⁹⁴	Nijkerk → Nijkerkerveen ¹³²
ekaldeboarn.nl	Enerzjy Koöperaasje Aldeboarn	Aldeboarn is the focus of the organization	Cooperatives → Energy Cooperatives ³¹⁵ Energy → Renewable Energy ¹²⁶⁷	gas ⁴³⁴ cooperative ⁶⁴⁹ electricity ⁷⁴⁵ roof ³⁶⁶² energy ⁹⁰⁷⁵	Heerenveen → Aldeboarn ⁷⁷
benbdeloft.nl	Owners (Leo and Andrea)	The holiday home is located in a quiet village, 38 km from Antwerp.	House Types → Apartment Living ³⁵⁵⁹ Nature → Nature Reserves ¹⁰³²	loft ¹²⁴ nature area ⁴⁹⁷ accommodation ⁴⁹²¹	Hulst → Kloosterzande ⁷⁸
cafemoarkswal.nl	Moarkswâl B.V.	Aldtsjerk, a charming village in Friesland, houses Café Moarkswâl.	Planning → Tours ⁸⁷⁰ Parks & Gardens → Parks ¹⁰⁴³	elfstedentocht ²⁹ ice cream parlor ⁹⁹ beam ¹²⁹ cafe ¹⁶²²	Tytsjerksteradiel → Wyns ²⁸
roerfront1939-1945.nl	N.V.	The village of Melick is an important part of the history described.	Specialized History → Military History ⁵⁰⁷ Specialized History → World War II ¹¹³⁴	military service ¹¹ world war ii ¹⁵³ travel ⁷²¹⁰ history ⁷²⁸⁶ collection ⁷⁵⁶⁶	Noordoostpolder → Emmeloord ¹⁶⁴⁹
kerstmarktvreeland.nl	Kerstmarkt Vreeland	New participants on the market are also village residents.	Christmas → Christmas Markets ¹⁶⁴ Local Events → Fairs ⁷⁰⁷	christmas market ¹⁶³ instagram ¹²¹⁶ participant ¹⁹³⁴ sponsors ²⁶⁴² event ⁴⁵¹⁹⁹
gitedulion.nl	Gîte du Lion	The property is located near authentic French villages.	Europe → France ¹⁰⁴¹ Context ¹⁶¹³⁹⁴	cottage ²⁹⁹ pool ¹⁵³² park ¹⁸⁶³ parking ¹⁹²⁸ terrace ⁴⁸⁴⁷	Netherlands → Utrecht ⁴⁸⁹⁰¹
watikjezeggenwil.nl	watikjezeggenwil.nl	The stories come from various villages in the area, highlighting the local focus.	Personal → Biography ¹⁰⁰³ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	life story ¹⁷⁶ seniors ⁹⁰⁴ youth ³¹²⁶	Epe → Vaassen ⁴⁷⁷
zogroningenbeginthier.nl	zogroningenbeginthier.nl	The website mentions the existence of charming villages and the opportunity to buy local regional products.	Local History → North Groningen ¹⁰³ Hiking → Trails ³⁵⁶	nature area ⁴⁹⁷ hiking ⁸⁴¹ cycle ¹⁹⁰⁶ holiday ²²⁹⁵ route ³⁴²⁵	Groningen → East-> Lewenborg ⁷⁹
henkjalving.nl	N.V.	The author describes his travels through villages and surrounding areas in Twente, the Achterhoek, and Drenthe.	Skating → Inline Skating ⁵⁸ Europe → Germany ⁶⁵⁴	bike tour ⁹⁷ marathon ¹⁹² football ¹³⁴⁷ travel ⁷²¹⁰	Zwolle → Wijthmen ³⁶
lekkerwegnaarfrankrijk.nl	Newspaper Lekker weg naar Frankrijk	The Luberon is dotted with charming villages.	Hiking → Trails ³⁵⁶ Europe → France ¹⁰⁴¹	city ¹⁸⁷⁵ landscape ²⁶⁰⁹ route ³⁴²⁵ region ⁵⁴¹²
bedandbreakfastkyllot.nl	B&B Kyllot	The surrounding area offers access to various holiday villages such as Appelscha and Dwingeloo.	Hotels → Country Houses ¹⁷² Holidays → Agricultural Holidays ¹³	holiday house ⁴⁰² nature area ⁴⁹⁷ stable ⁷⁶⁸ terrace ⁴⁸⁴⁷	Ooststellingwerf → Appelscha ³³¹
derodeloperavond.nl	Modehuis Dekker	The Rodeloperavond takes place in the charming village of Zuidwolde.	Travel → Tourism ³⁷⁵⁴ Lifestyle → Events ³²⁴⁷⁵	atmosphere ⁵⁵⁹¹ shop ⁶⁴⁸³ clothing ⁹⁴⁴³ event ⁴⁵¹⁹⁹	Het Hogeland → Zuidwolde ³⁵⁹
fictile4friends.nl	Fictile 4 Friends	The website includes an image of a fictional village in Provence, which serves as inspiration for the mural in the studio.	Museums & Collections → Archaeology ²⁹¹ Crafts → Ceramics ¹¹⁵⁶	ceramics ¹²⁷¹ studio ⁵⁴⁶⁵ artist ⁵⁷⁴⁵	Utrecht → Houten ¹⁶⁷⁷
himalaya-resources.nl	Himalaya Resources	Women's groups from dozens of villages work with partners on the projects.	Social Issues → Humanitarian Aid ⁶²¹ Nature Conservation → Water Management ¹¹³⁸	water filters ³⁹ rainwater ⁹⁹ partner ⁴²⁷²
groenehartkloppendhart.nl	groenehartkloppendhart.nl	The Green Heart of Netherlands has many surprising villages.	Travel Guides → Regional Travel Guides ⁸⁵	green heart ³⁹ walk ²¹⁶¹ environment ⁴⁸⁷³ travel ⁷²¹⁰ nature ⁹⁰⁹⁴	Almere → Almere City ⁹³⁴
bbdescherpenhof.nl	B&BdeScherpenhof	The Scherpenhof is located in the idyllic village of Leur.	Landscape → Polders ²¹² AccommodationTypes → Rural Travel ¹⁷	jacuzzi ²⁷⁰ view ¹⁰⁴⁵ b&b ¹⁰⁶⁰ cycle ¹⁹⁰⁶ walk ²¹⁶¹	West-Maas en Waal → Appeltern ¹¹³
sjans-texel.nl	Café-Restaurant Sjans	The cafe-restaurant is located in the heart of the charming village of De Koog.	Bars & Pubs → Bars ¹⁹³⁸ Brasseries & Bistros → Bistro ⁵⁹⁴	nightlife ¹¹² cafe ¹⁶²² terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Texel → De Koog ¹⁴⁷
wartenterp12.nl	Kuperus Heeringa Makelaardij	The house is located in a quiet village, Abbega, surrounded by fields.	Accommodation → Bungalows ¹⁰⁰⁸ Context ¹⁶¹³⁹⁴	shed ⁶³⁰ bedroom ²⁰⁵¹ kitchen ⁶⁴⁴³ house ⁸¹²¹ garden ¹³¹²⁹	Friesland → Southwest-Friesland ⁴¹⁹⁴
cpo-hollandsehout.nl	CPO Hollandse Hout	The park has a friendly village atmosphere and a car-free character, contributing to the livability.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Nature → Forest ³⁸⁷	seniors ⁹⁰⁴ lifestyle ²⁹¹⁸ architecture ³²²³ house ⁸¹²¹ nature ⁹⁰⁹⁴
rct-rivierenland.nl	N/A	The website covers news about various villages, such as Dwingeloo and Erica, which are part of the region.	Content Creation → Online Money Making ³¹ Context ¹⁶¹³⁹⁴	freelance ¹⁶⁹ exam ²¹²⁰ finance ⁵³⁴¹ insurance ⁶³⁵⁹	Emmen → Erica ¹²³
realux.nl	Realux Vakantiehuizen	The holiday homes are near the daily market.	Europe → France ¹⁰⁴¹ Vacations → Island Vacations ²⁴³	island ⁷⁸⁰ wifi ¹³⁷² holiday home ²⁷⁵³ beach ³²¹⁰
cdadrimmelen.nl	CDA Drimmelen	The website encourages residents to become active for their village.	Local Politics → Parties ⁶²² Local Politics → Municipal Council ⁴⁸⁴	cda ²⁷ election ⁴⁰⁴ politics ¹²⁵⁹ municipality ⁶⁸³⁷	North-Brabant → Drimmelen ⁹⁴⁰
mountainbike-drenthe.nl	Olde Horst	The routes are often structured around different villages in Drenthe.	Cycling → Mountain Biking ²⁷⁵ AccommodationTypes → Accommodation ¹²¹³⁰	mountain biking ¹⁰⁴ landscape ²⁶⁰⁹ arrangement ³¹⁰⁴ route ³⁴²⁵	De Wolden → Ruinen ¹⁸⁸
schotlandvakantieinfo.nl	schotlandvakantieinfo.nl	The website describes various villages, such as Moffat and Crianlarich, each with its own charm.	United Kingdom → Scotland ³³ SpecificDestinations → Destinations ¹¹⁰⁵	scotland ⁴⁸ travel guides ⁸¹ city ¹⁸⁷⁵ nature ⁹⁰⁹⁴	Westerkwartier → Zuidhorn ²⁸⁶
winssensekermiskoers.nl	Winssense Kermiskoers Organisatie	Winssen, the village where the kermis and race are held, is located on the border of the Nijmegen region and the Maas and Waal region.	Cycling → Cycling Races ²⁰⁶ Travel → Tourism ³⁷⁵⁴	kermis ⁵² race ¹⁰⁴³ event ⁴⁵¹⁹⁹	Beuningen → Winssen ⁹²
chaletsvakantie.nl	Chaletsvakantie.nl	The homes are located in the vicinity of charming villages.	Vacations → Nature Vacations ²⁶⁹ Winter Sports → Skiing ⁵⁹⁶	chalet ¹²⁶⁴ forest ¹⁴¹⁸ holiday home ²⁷⁵³ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Ede → Kernhem ²³⁹
mensenmobiliteit.nl	Mobiliteitscentrum MeMo	The accessibility of small villages is considered essential for good mobility.	Local Politics → Parties ⁶²² Mobility Solutions → Mobility ⁶⁸³	changes ³²⁶ mobility ¹²⁶⁴ sustainability ¹⁸⁴⁵¹	Ooststellingwerf → Oosterwolde ⁴¹⁷
chocoladeliefhebber.nl	Chocoladeliefhebber	The production location is in the village of Zuidwolde, located in Drenthe.	Chocolate & Sweets → Chocolate ⁵⁸⁷	chocolate ⁹¹¹ bar ¹²¹⁶ production ⁴⁵⁸²	Het Hogeland → Zuidwolde ³⁵⁹
wijnbergappartementen.nl	Wijnberg Appartementen	The apartments are located in the village of Hollum on Ameland.	Hotels → Hotels in Netherlands ¹⁰ Accommodation → Apartment Rentals ²¹	playground ¹⁰⁸⁸ apartment ⁵⁰⁸⁸	Ameland → Hollum ⁷⁸
hetmooistevanfriesland.nl	Het Mooiste van Friesland	Oranjewoud is presented as a picturesque village, which emphasizes local communities.	Landscape → Nature Areas ⁵⁸ Nature → Nature Reserves ¹⁰³²	town ¹²⁶ nature area ⁴⁹⁷ tradition ⁷³⁶ holiday home ²⁷⁵³ history ⁷²⁸⁶	Southwest-Friesland → Hindeloopen ¹²⁷
leukeropuit.nl	leukeropuit.nl	Giethoorn is described as a charming village.	Activities → Excursions ²⁵⁷ SpecificDestinations → Destinations ¹¹⁰⁵	windmill ²⁴⁹ country ⁵³⁰ outing ⁹⁸² destination ²⁵⁸⁰ event ⁴⁵¹⁹⁹	Molenlanden → Kinderdijk ¹⁵⁸
ikbennognooitinzeelandgeweest.nl	ikbennognooitinzeelandgeweest.nl	The small communities that the traveler visits, often without much tourism.	Travel Guides → Regional Travel Guides ⁸⁵ Stories → Travel Stories ⁴⁶²	traveler ¹⁸⁰ netherlands ¹³⁷⁶ trip ²⁰³²	Berg en Dal → Groesbeek ⁶⁵³
huelva.nl	Huelva.nl	The Sierra de Aracena y Picos de Aroche is characterized by small, white villages.	Spain → Andalusia ²⁴² Nature → National Parks ⁸⁹⁸	coast ¹⁹⁹ province ⁵¹⁸ bird ⁹²² park ¹⁸⁶³ landscape ²⁶⁰⁹
dewijdewereld.nl	The Wijde Wereld Reisblog	Stories about picturesque villages such as Saint-Cirq-Lapopie are told.	Hiking → Europe ⁵¹ Stories → Travel Blogs ¹⁰¹⁶	castle ⁴⁹⁴ hiking ⁸⁴¹ city ¹⁸⁷⁵ cycle ¹⁹⁰⁶	Voorne aan Zee → Brielle ⁶¹³
gofreelancer.nl	GoFreelancer.nl	The article about Oud Zuilen describes a charming village on the Vecht River with a rich history.	Cycling → Electric Bikes ⁴⁴⁵ Context ¹⁶¹³⁹⁴	ad ⁵⁸ bike ¹⁵⁴¹ tax ²¹⁰⁰ house ⁸¹²¹ furniture ⁸⁷⁵¹	North-Holland → Amsterdam ⁴¹²⁵³
hulpfilipijnen.nl	HulpFilipijnen	The foundation specifically works in the villages of Balagtas and Kawayan on Leyte Island.	Humanitarian Organizations → International Organizations ⁷³⁴ Charities → International Aid ⁸⁵⁸	aid ⁴²⁷ home ⁷⁹⁷⁶ education ¹³⁴⁷¹
stationspoor.nl	STATION SPOOR D’IMÉCOURT	The house serves as a temporary overnight stop for visitors en route.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Vacations → Nature Vacations ²⁶⁹	ardennes ⁹⁸ countryside ⁹⁹ brocante ¹⁸⁸ holiday home ²⁷⁵³
vakantielandkroatie.nl	VakantielandKroatie.nl	The website describes charming villages along the Croatian coast as ideal places for relaxation.	Vacations → European Vacations ⁵⁸ Europe → Croatia ⁹²	croatia ⁴⁵ beach ³²¹⁰ culture ³⁹²² vacation ⁴²³⁴ nature ⁹⁰⁹⁴
welzijnusquert.nl	Welzijn Usquert – Zorgzaam dorp	The village of Usquert is central to the activities of Welzijn Usquert, which focuses on maintaining a social network.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Pediatric & Child Health → Community Care ¹⁴¹	attention ⁵⁷⁰ network ¹¹¹²³ care ¹²³³⁸	Het Hogeland → Usquert ⁶⁹
chaletsonnenheimpiesendorf.nl	Chalet Sonnenheim	The chalet is located just above the authentic village of Piesendorf.	Vacations → Beach Vacations ⁸⁶⁶ Europe → Austria ²⁴⁹	ski area ¹⁷⁶ mountain ²⁰⁰ chalet ¹²⁶⁴ wellness ¹⁵⁶¹
maisondelespoir.nl	Brenda and Gerrit	The website provides tips and advice about charming villages with traditional houses in the area.	AccommodationTypes → Rural Travel ¹⁷ Context ¹⁶¹³⁹⁴	auvergne ²³ bed & breakfast ³¹⁹ room ³⁴¹¹ house ⁸¹²¹ nature ⁹⁰⁹⁴
heiloo-stem-wijs.nl	CDA Heiloo	The CDA Heiloo emphasizes that Heiloo remains an independent cycling village.	Political Parties → CDA ³⁶ Local Politics → Municipal Elections ⁸⁸	election program ⁸⁵ candidate ¹⁸⁹⁶ campaign ³⁴²⁸ theme ⁴⁰¹⁵ news ¹⁵²⁹³
mijnspaarndam.nl	Mijn Spaarndam	Mijn Spaarndam is an initiative focused on the community of Spaarndam, Haarlemmerliede and Spaarnwoude.	Communication → WhatsApp ²⁵ Village Focus → Village Initiatives ¹³⁷	incident ³³⁵ whatsapp ³⁸² list ⁵⁷⁵ facebook ⁸⁵⁰ registration ⁴³⁶⁶	Haarlemmermeer → Spaarndam ²⁰⁷
westterschellingappartement.nl	Het Pastoryhuys West-Terschelling	Het Pastoryhuys is located in the 'arrival village' of Terschelling.	Vacations → Island Vacations ²⁴³ Context ¹⁶¹³⁹⁴	beach ³²¹⁰ vacation ⁴²³⁴ apartment ⁵⁰⁸⁸	Terschelling → West-Terschelling ¹¹⁴
canadotravel.nl	CANADO travel	The charming villages in Canada and the USA are mentioned as part of the winter vacation.	Winter Activity → Winter Sports ¹⁸²⁷	piste ⁴² winter sports ¹⁹⁶ travel ⁷²¹⁰
vakantiehuisinflims.nl	Chalet Darblauna	Flims is a charming village with a long history as a Kurort.	Skiing → Ski Resorts ²⁰⁶ Europe → Switzerland ⁸⁴	ski area ¹⁷⁶ mountain ²⁰⁰ summer ⁴⁸³ chalet ¹²⁶⁴ apartment ⁵⁰⁸⁸	Southwest-Friesland → Zurich ¹³⁸
sportbelangenheino.nl	Stichting Sportbelangen Heino	Heino is a village with a wide range of sports clubs and facilities.	Village Focus → Village Organizations ⁶⁸³ Sport Organization → Municipal Sports Organizations ²⁹	policy ²¹⁴⁹ sport ⁴²²⁸ newsletter ⁶⁵⁰⁴ foundation ⁶⁶⁷⁸	Raalte → Heino ²⁸⁶
nathaliebaartman.nl	Nathalie Baartman	Baartman describes her worldview as a longing for a smaller, simpler environment.	Theater → Cabaret ³⁵⁸	cabaret ²²² column ⁵⁴³ performance ⁷⁵⁸⁶ story ⁸²⁸⁵
brundtland.nl	Coöperatie Brundtland	Coöperatie Brundtland strives to create a sustainable ecovillage in the area around Breda.	Sustainable Living → New Developments ²⁰⁰ Sustainability → Cooperatives ⁹⁷⁰	board ³⁴³⁸ network ¹¹¹²³	North-Brabant → Breda ⁹⁰⁰³
wonenindael.nl	N/A	DAEL is located in an authentic Vechtdorp.	Property Sales → Off-Market Sales ¹⁴ Water → Rivers ¹⁸⁰	river ³¹² living ⁵⁷⁸ villa ¹³⁵¹ nature ⁹⁰⁹⁴	Stichtse Vecht → Maarssen ¹⁰⁵¹
kaagjesland40.nl	Van Rhijn Makelaars	The house is located in the picturesque Reeuwijk-Dorp.	Houses → Semi-Detached Houses ⁷⁵¹ Vacations → City Breaks ⁵³⁶	city ¹⁸⁷⁵ landscape ²⁶⁰⁹ room ³⁴¹¹ house ⁸¹²¹ garden ¹³¹²⁹	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.