Businesses, Clubs, and Local Services

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳field ⁵²⁵	Businesses, Clubs, and Local Services	This compilation features a diverse range of organizations, including sports clubs, professional services, and recreational facilities throughout the country. Many entries focus on local businesses offering specialized services such as translation, dog walking, legal assistance, and interior design.

525 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
molder.nl	Mölder sportveldberegening	Mölder specializes in irrigating various sports fields, including soccer fields, hockey fields and golf courses.	Gardening → Lawn ⁴⁷ Sport Facility → Sports Fields ¹⁵²	irrigation ²¹⁵ grass ²³⁸ installation ¹³⁷⁴²	Helmond → Helmond-North ²⁴
4grass.nl	4Grass	The website offers a calculator that allows users to generate a field recommendation based on the field needs of their club.	Sport Facility → Sports Fields ¹⁵²	calculator ⁴⁷⁵
paulhager.nl	Paul Hager	The concept of ‘field’ is central, being described as the source of observation and the structure that drives development.	Physics → Theoretical Physics ²⁸ Philosophy → Phenomenology ¹²	matter ⁵⁸ evolution ⁶⁵ consciousness ²³⁸
fieldinabox.nl	Field in a box	Field in a box™ is a container with a sports field, designed to support development projects.	Social Issues → Development Cooperation ⁶² Sport Facility → Sports Fields ¹⁵²	sports field ⁷⁵ partnership ¹⁴⁰⁷ community ⁷⁹³¹
fieldwatch.nl	FieldWatch BV	FieldWatch offers advanced technologies to extend the lifespan of sports fields and optimize park usage.	Sport Facility → Sports Fields ¹⁵² Business → Technology ⁵⁷⁵⁰³	data ⁵⁸⁷² technology ⁶⁸¹⁶ collaboration ¹⁶⁰³⁶ sustainability ¹⁸⁴⁵¹
de-grasexpert.nl	De Grasexpert - Gerard Schoenaker	The services of De Grasexpert include advice and support for different types of fields, including golf courses, sports fields and playgrounds.	Sport Facility → Sports Fields ¹⁵²	grass ²³⁸ training ²⁸¹³³
sportparkdehorst.nl	Stichting Exploitatie Sportvoorzieningen de Horst	Sportpark De Horst includes a variety of sports fields for different sports, such as football, hockey, and boules.	Primary Education → Christian Education ⁴⁴⁶ Sport Facility → Sports Parks ⁵⁷	stichting ⁴⁸¹ rental ⁷²⁵⁷ association ⁸⁵⁶²	Flevoland → Zeewolde ¹²⁴³
dewaaie.nl	Stichting De Waaie	The sports park features a variety of fields for different sports.	Sport Facility → Sports Fields ¹⁵² Sport Facility → Sports Parks ⁵⁷	football field ²¹ sports park ¹⁴⁰ fair ⁵⁸³ association ⁸⁵⁶²	Waadhoeke → St.-Annaparochie ¹⁴⁶
grasmeesters.nl	GrasMeesters	GrasMeesters offers expertise in managing sports fields, specifically natural grass fields.	HR Services → Intermediaries ¹⁴⁰ Youth → Soccer ²⁵⁴	uefa ¹² budget ¹³³⁵ club ⁴²²⁵
stibuni.nl	Stichting Buitensportvoorzieningen Nieuwkoop	The foundation is responsible for the renovation and maintenance of various fields and sports facilities in the municipality of Nieuwkoop.	Sport Facility → Sports Fields ¹⁵² Specialized Works → Sports Facilities ¹⁸	sports fields ⁹⁴ foundation ⁶⁶⁷⁸ municipality ⁶⁸³⁷ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Nieuwkoop → North ¹¹⁷
sportveldbelijningen.nl	Sure-Line Sport Markings	The website describes the products used to mark sports fields and also describes the correct way of using the field.	Livestock → Dairy Farming ⁶⁷¹ Agriculture → Agricultural Machinery & Equipment ⁶³¹	lime ³⁹ mark ⁹³ wagon ¹³³ robot ⁴²³
wegdamevents.nl	Wegdam Events	The field provides a compact and safe playing environment for various sports.	Competitions → Team Competitions ¹⁸ Event Styling & Decoration → Event Equipment ⁷⁷⁵	event ⁴⁵¹⁹⁹	Hof van Twente → Hengevelde ¹¹²
dutchdome.nl	Dutchdome	Dutchdome’s covering system protects football fields from weather conditions, reducing the number of match cancellations.	Sports Activities → Football ⁴¹⁴⁴ Sport Facility → Sports Fields ¹⁵²	cloth ¹¹⁵ grass ²³⁸ match ³⁴⁷¹
marnefoto.nl	marnefoto.nl	The website contains photos of various fields, such as beet fields and wheat fields.	Landscape → Dutch Landscapes ⁴¹ Painting → Digital Art ⁸²⁰	sunset ⁶² wadden sea ¹⁷⁰ tulip ²⁶⁷ photo ⁷⁷⁷⁸	Het Hogeland → Lauwersoog ²⁹⁵
hybrideveld.nl	Hybride Gras	The system can be easily installed on sports fields and is particularly suitable for heavily loaded areas, such as goal zones.	Garden Maintenance → Lawn Maintenance ¹⁶⁶ Sport Facility → Sports Fields ¹⁵²	fiber ¹⁶⁷ grass ²³⁸
fieldmanager.nl	Fieldmanager	The article covers news about the construction of artificial turf fields, such as at VV Smitshoek in Barendrecht, and the renovation of buggy paths.	Sport Facility → Sports Fields ¹⁵²	sports field ⁷⁵ infrastructure ¹⁴⁶⁰ news ¹⁵²⁹³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
hvc10.nl	Hoekse Voetbal Club	The club has four fields, including a lighted grass field and two artificial turf fields.	Football → Amateur Football ⁷⁵⁷ Sports Clubs → Football Clubs ⁴⁶⁷	sponsorship ²⁶⁸⁶ club ⁴²²⁵ member ¹⁰¹⁵⁴
tulpenvliegroute.nl	Tulpenvliegroute BV	The tulip fields are the main purpose and attraction of the tulip flight route.	Air Services → Aviation ⁴⁴⁴ Transportation → Flights ⁶⁷⁵	helicopter ⁶¹ pilot ²⁰⁸ tulip ²⁶⁷ flight ⁸⁶⁴ view ¹⁰⁴⁵	Noordoostpolder → Creil ⁶⁸
sportpark-demors.nl	Sportpark de Mors	The park offers various types of fields, including main fields, artificial turf fields and a pupil field.	Venues → Halls ⁴¹⁹ Sport Facility → Sports Centers ⁴³⁹	sports hall ²⁷⁰ childcare ³⁵¹² space ³⁸⁴⁶	Hof van Twente → Delden ⁴⁴²
plukpracht.nl	Plukpracht	The flowers are directly supplied from the ecological field in Amersfoort.	Flowers → Bouquets ⁹⁸ Gifts & Occasions → Flower Shops ⁷⁷⁶	bouquet ¹¹⁴⁷ flowers ³²⁴⁸ subscription ³²⁸⁷ nature ⁹⁰⁹⁴	Utrecht → Amersfoort ⁸⁰¹¹
inschrijfformulieren.nl	Inschrijfformulieren.nl	Users can add free fields and choose from different field types such as text fields and dropdown menus.	Software Development & Engineering → Web Applications ¹⁰⁰⁵ Tools & Equipment → Business Equipment ²²	form ⁶⁷⁹ dashboard ¹³⁷⁴ payment ¹³⁸⁹ registration ⁴³⁶⁶ data ⁵⁸⁷²
levendveld.nl	Levend Veld	The 'field' is a core concept, an invisible stream of energy and knowledge connecting everything.	Alternative Medicine → Energy Medicine ⁹⁸⁸ Spiritual Practices → Spirituality ⁴³⁹⁹	breath ²⁰⁹ ritual ⁵⁰⁶ vision ¹⁸⁸² movement ²³⁰⁴ body ³⁴⁹⁰
voetballoods.nl	Voetbal Loods	The field is of European top quality, sliding-friendly and technically perfectly playable, making it suitable for both recreational and competitive football.	Cafes → Brown Cafés ⁵⁹⁹ Sports Activities → Football ⁴¹⁴⁴	bar ¹²¹⁶ hall ¹⁷⁸⁶ competition ⁴⁷⁵⁹
lesfourneaux.nl	Les Fourneaux	The campsite has various fields of different sizes, offering guests ample space.	Camping → Campsites Netherlands ⁷⁹² Europe → France ¹⁰⁴¹	sanitary building ¹² bike ride ⁴⁷ campsite ²⁰⁹³ nature ⁹⁰⁹⁴
kennisbanksportenbewegen.nl	Kennisbank Sport en Bewegen	The information is made available to the professional field.	Research & Academia → Educational Studies ¹⁶⁸ Body & Movement → Exercise ¹⁰⁰⁵	publication ²⁰¹⁸ movement ²³⁰⁴ knowledge ³⁵²⁸ sport ⁴²²⁸
ksvvoetbal.nl	KSV Heerhugowaard	The KSV Heerhugowaard sports complex consists of four fields, including one large training field and a new artificial turf field.	Football → Youth Football ²⁰²	club ⁴²²⁵ volunteer ⁸³⁶⁷ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Dijk en Waard → Heerhugowaard ²⁰¹¹
paintball-games.nl	S.A. Paintball Games	The park features four different themed fields simulating various locations.	Conferences & Meetings → Corporate Events ²⁴⁷² Activity → Active Sports ¹⁶	paintball ⁷¹ bachelor party ¹¹³
scsusteren.nl	Sportclub Susteren	The club has multiple fields, including grass fields and an artificial turf field.	Youth Organizations → Scouting ¹⁰⁰⁴ Team Sports → Korfbal ⁴⁰⁶	clubhouse ⁷⁸⁴ youth ³¹²⁶ club ⁴²²⁵	Echt-Susteren → Susteren ²¹⁸
donquishoot.nl	E.S.H.V. Don Quishoot	Don Quishoot has two hockey fields, a water field, and a semi-water field.	Universities → Eindhoven University of Technology ¹¹ Hockey → Hockey Clubs ¹¹⁸	hockey ³⁴⁸ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
veldbloemenonline.nl	Veldbloemen Online	The website sells field flower seeds and provides information about these flowers.	Plants → Flower Seeds ⁶³ Gardening → Seeds ³¹⁹	mix ³⁷⁷ seed ⁵⁹⁹ biodiversity ⁷²⁰ flowers ³²⁴⁸ garden ¹³¹²⁹	Overijssel → Hardenberg ²³⁰⁹
boerenrugby.nl	Boerenrugby Baambrugge	The fields of the tournament are located on a large field next to a farm.	Team Sports → Rugby ¹²⁶ Context ¹⁶¹³⁹⁴	rugby ⁹³ farmer ⁶⁶¹ tournament ²⁴⁷⁶ beer ²⁸⁸⁷ band ²⁹⁷⁷	De Ronde Venen → Baambrugge ⁹¹
elektrostress-gezondheid.nl	Lescrauwaet BV	The text discusses various types of fields, including low-frequency alternating fields and static fields.	Physics → Electromagnetism ²⁵ Hygiene & Environmental Factors → Environmental Health ²⁵	electricity ⁷⁴⁵ health ⁶³⁶⁶ collaboration ¹⁶⁰³⁶
ijsclubschellingwoude.nl	IJsclub Schellingwoude	The field serves as the location for the skating rink and was used for testing and research.	Social Issues → Development Cooperation ⁶² Combat → Badminton ⁷⁰²	skate rink ¹⁰ water pump ⁶³ club ⁴²²⁵	Amsterdam → Schellingwoude ¹⁴³
leds-play.nl	Leds Play	The field is transformed by Leds Play into a spectacular LED experience, with vibrant colors and patterns creating a unique experience for players and spectators.	Football → Competitions ¹⁰⁷² Event Equipment → Light ⁹⁰	club ⁴²²⁵ light ⁵¹⁴⁸ event ⁴⁵¹⁹⁹
vanderkruijsadvocaten.nl	Van der Kruijs Advocaten	The lawyers are registered in the legal field register for specific fields.	Law → Legal Profession ¹³⁹ Legal → Lawyers ⁷⁰⁸	firm ⁴⁴² law ¹³²⁹ lawyer ²⁶⁸³ mediation ²⁷⁸⁷	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
flevogreensupport.nl	Flevo Green Support	Flevo Green Support focuses on the installation and maintenance of various types of fields, including football fields and golf courses.	Gardening → Lawn ⁴⁷ Sport Facility → Sports Fields ¹⁵²	fertilizer ²⁹⁸ lawn ⁴²⁷ golf course ⁵⁰⁷ clubhouse ⁷⁸⁴
darrietmolen.nl	Dorpsaccommodatie Rietmolen	The website provides an overview of available sports fields.	Sport Facility → Sports Fields ¹⁵² AccommodationTypes → Accommodation ¹²¹³⁰	reserve ⁴¹ meeting room ⁶⁸⁵ club ⁴²²⁵ accommodation ⁴⁹²¹ event ⁴⁵¹⁹⁹	Berkelland → Rietmolen ³²
kios45.nl	KIOS '45	The website describes several sports fields, including KIOS '45 1 Field, KIOS '45 2 Field and KIOS '45 A1 Field, which are used for various sports activities.	Venues → Halls ⁴¹⁹	hall ¹⁷⁸⁶ sponsorship ²⁶⁸⁶ membership ¹⁰⁴⁴² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹
weilandreclame.nl	Weilandreclame	The advertising takes place on fields, allowing for environmentally friendly advertising.	Advertising → Outdoor Advertising ²⁵⁴ Advertising → Online Advertising ⁹⁴⁸	highway ⁸⁸ trailer ¹⁶²⁴ cost ¹⁹⁹⁰ message ²²⁶⁰ advertising ²³⁰²
sportparkduivesteyn.nl	Sportpark DuiveSteyn	The sports park has a variety of fields for different sports.	Sport Facility → Sports Fields ¹⁵² Sport Facility → Sports Parks ⁵⁷	sports park ¹⁴⁰ hockey ³⁴⁸ fitness ²²⁵¹ childcare ³⁵¹²	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
tviemenslaglangeveen.nl	TV Iemenslag	The handball and tennis fields were all-weather fields.	Sports Clubs → Dutch Sports Clubs ³³⁷ Sport Facility → Tennis ²⁰⁷⁸	handball ²⁰⁹ tennis ⁸³⁶ rent ⁹⁸¹ club ⁴²²⁵ municipality ⁶⁸³⁷	Tubbergen → Langeveen ⁵⁸
eenlevenbewegen.nl	Stichting Een Leven Bewegen	The complex features six hockey fields, which are essential for the activities of the Hockeyclub Houten.	Sport Facility → Sports Complexes ²⁵	complex ⁵⁶⁸ clubhouse ⁷⁸⁴ club ⁴²²⁵ foundation ⁶⁶⁷⁸	Utrecht → Houten ¹⁶⁷⁷
bubbelvoetbalverhuur.nl	Bubbel Voetbal Verhuur	Bubble soccer can be played both indoors and outdoors on various types of fields, such as grass fields and sports halls.	Youth → Soccer ²⁵⁴ Activity → Active Sports ¹⁶	bubble ⁶⁰ soccer ⁹² pump ⁶²⁵ event ⁴⁵¹⁹⁹
vakwereld.nl	Vakwereld	The platform focuses on professionals within specific fields.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Adult & Continuing Learning → Distance Learning ²⁴	newsletter ⁶⁵⁰⁴ blog ¹³³⁹² news ¹⁵²⁹³
avansplus.nl	Avans+	The programs are divided into various fields, such as accounting and nursing.	Vocational & Training → Post-HBO Programs ²⁶ Vocational Training → MBO ⁶⁹⁰	personalized attention ⁵⁵ instructor ³¹²⁶ student ⁷⁶²³
svdalfsen.nl	SV Dalfsen	The club has multiple sports fields for various teams and competitions.	Team Sports → Korfbal ⁴⁰⁶	sponsor ¹¹⁵⁹ tournament ²⁴⁷⁶ club ⁴²²⁵ member ¹⁰¹⁵⁴ news ¹⁵²⁹³	Dalfsen → Nieuwleusen ³¹⁸
gomos.nl	V.v. GOMOS	The fields are temporarily closed for major maintenance.	Football → Amateur Football ⁷⁵⁷ Team Sports → Korfbal ⁴⁰⁶	season ⁶⁹² football ¹³⁴⁷ trainer ¹⁹⁶⁶ competition ⁴⁷⁵⁹	Tynaarlo → Zeijen ⁴⁸
dorpsgezichtriel.nl	Riel	The agricultural structure of Riel, based on kransakkerdorpen (circumscribed field villages), is a key feature of the village.	Museums → Regional Museums ³⁹⁰ Environment → Agriculture ¹¹¹⁶⁰	drainage ¹³²² farm ²⁶²² history ⁷²⁸⁶	Eindhoven → Stratum ²⁶⁷
greenhearts.nl	Green Hearts	The association is moving to a new baseball field in Linschoten.	Team Sports → Baseball ¹⁰⁹ Team Sports → Softball ⁸³	clubhouse ⁷⁸⁴ sponsors ²⁶⁴² association ⁸⁵⁶² membership ¹⁰⁴⁴²	Montfoort → Linschoten ¹⁶⁹
forensischforum.nl	Forensisch Forum	The organization's goal is to improve processes and collaboration in the forensic field.	Research & Academia → Educational Studies ¹⁶⁸ Legal & Permits → Legal ²¹³⁷	understanding ¹³⁴ knowledge ³⁵²⁸ connection ⁴⁰⁰⁷ network ¹¹¹²³ collaboration ¹⁶⁰³⁶
vertalingen.nl	Vertaalbureau Vertalingen.nl	The website is specialized in various fields, such as legal and technical.	Government & Administration → Government Services ⁴⁴ Language Learning → Language Courses ⁷⁶⁹	translation ¹⁵²³ document ¹⁶⁷⁸ language ²⁰¹⁶ quote ¹²⁸⁶³
paintballspaarnwoude.nl	Paintball Spaarnwoude	The fields are designed to be challenging for exciting paintball matches.	Shooting → Paintball ⁴⁰ Venues → Party Venues ³⁶³	paintball ⁷¹ climbing ¹³⁹ barbecue ¹¹⁷⁵ party ⁵⁹²⁸	Velsen → Velsen-Zuid ¹²¹
t-pion.nl	T-Pion	The vacancy list is divided into various technical fields, such as mechanical engineering and electrical technology.	HR Services → Technical Recruitment ⁴⁷⁴ Adult & Continuing Learning → Professional Training ¹²²⁴	jobseeker ³⁰⁰ work ³¹²² vacancy ⁶⁵⁹⁸ blog ¹³³⁹²
vangervenasperges.nl	Van Gerven Asperges	The company grows and harvests asparagus on a field where visitors can take tours.	Vegetables → Asparagus ⁶²	asparagus ¹⁸⁶ season ⁶⁹² tours ¹⁰⁴⁸	North-Brabant → Oirschot ⁹²⁹
paintballrotterdam.nl	Paintball Rotterdam	The organization has its own paintball field in Rotterdam, where guests can battle in groups and choose from various paint grenade packages.	Shooting → Paintball ⁴⁰ Work → Jobs ¹⁴⁴³	paintball ⁷¹ instructor ³¹²⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
binnenstadadvocaten.nl	Advocatenkantoor de Binnenstad	The lawyers stay up-to-date on the latest developments in their field.	Law → Commercial Law ⁶⁶⁰ Legal → Lawyers ⁷⁰⁸	legal field ³¹¹ legal assistance ⁵³⁷ partnership ¹⁴⁰⁷ lawyer ²⁶⁸³	North-Holland → Amsterdam ⁴¹²⁵³
pluimensports.nl	Pluim and Sports	Pluim and Sports supplies materials and products for furnishing sports fields, including goal nets, corner posts, and penalty areas.	Apparel → Sporting Goods ¹³⁷⁴	furnishing ²⁹² sport ⁴²²⁸
borntorun.nl	Born to Run Hondendagopvang	The large private field at Born to Run Hondendagopvang offers plenty of space for the dogs.	Animals → Dogs ⁵⁸⁷⁹	play area ¹⁷³ pond ⁶⁸⁶ fence ¹⁸¹⁴ dog ⁵⁴⁸³	Peel and Maas → Maasbree ²⁴⁸
hcschiedam.nl	Hockey Combinatie Schiedam	The club has several artificial turf fields.	Hockey → Hockey Clubs ¹¹⁸	hockey ³⁴⁸ clubhouse ⁷⁸⁴ match ³⁴⁷¹ training ²⁸¹³³	South-Holland → Schiedam ²²⁴⁹
stageindonesie.nl	STAGE INDONESIE	The organization offers internships in a wide range of fields, such as marketing and engineering.	Asia → Indonesia ¹¹⁷ Internships & Jobs → Internships ⁵⁵¹	bali ¹⁰⁹ internship ⁶⁹⁴ mediation ²⁷⁸⁷ student ⁷⁶²³
ballsandarrows.nl	Balls and Arrows Lelystad	The diverse fields offer different playing setups and sizes, tailored to the size of the groups coming to play.	Corporate Events → Team Building ¹⁰⁰⁵ Outdoor Activities → Shooting ⁵¹	shooting sport ²³ airsoft ⁶⁷ paintball ⁷¹ team outing ²²¹ workshop ¹⁹³²⁵	Flevoland → Lelystad ³¹⁸⁰
juc.nl	JUC Netwerk	The networks are categorized into different fields, including employment law, ESG, and EU law.	Networking → Business Networks ³⁵⁸ Professional Education → Legal Education ¹⁰²	leader ²⁶⁶ legal ⁹³⁷ member ¹⁰¹⁵⁴ network ¹¹¹²³ event ⁴⁵¹⁹⁹
zee-ezel.nl	ZEE-EZELIAANSE BIJDRAGEN	The website describes various field names, likely in a geographical context.	Ornithology → Birdwatching ²⁷¹ Science → Linguistics ¹⁷¹	mill ⁴⁸⁷ bird ⁹²²	The Hague → Scheveningen ¹⁶²⁵
bolsterturf.nl	Willem Annen (Bolsterturf)	The text refers to open fields and their natural properties.	Municipalities → Policy ⁶⁰⁷	natural management ¹² forest ¹⁴¹⁸ nature ⁹⁰⁹⁴
deblikken.nl	Family Camping De Blikken	The campsite consists of 4 fields with different views.	Camping → Campsites Netherlands ⁷⁹² Sustainable Practices → Farming ¹³⁸	pitch ³³² campsite ²⁰⁹³ facility ²⁶¹⁶ beach ³²¹⁰	Sluis → Groede ¹⁰⁸
oosterdel.nl	Stichting Veldzorg Oosterdel	The area consists of approximately 251 fields, which form an important part of the landscape.	Internet → Forums & Communities ¹⁵⁹⁹	foundation ⁶⁶⁷⁸ news ¹⁵²⁹³	Dijk en Waard → Broek op Langedijk ²⁴³
ledsvoetbal.nl	Leds Voetbal	The game is played on a football field, both grass and artificial turf.	Sports Activities → Football ⁴¹⁴⁴ Team Sports → Rugby ¹²⁶	dark ¹¹ jersey ⁵⁵ lead ¹¹⁹⁵ football ¹³⁴⁷ game ²⁸⁰⁷	Vlissingen → Lammerenburg ³⁸
hetroepenvandeziel.nl	The Roeping of the Soul	Participants learn to connect with the greater field, where answers and insights arise.	Systemic Approaches → Systemic Work ²⁸⁹ Spirituality → Soul ¹⁶	constellation ¹⁷³ soul ³⁵⁵ therapist ¹⁸⁹⁰ body ³⁴⁹⁰ training ²⁸¹³³
vacatures-in-het-mbo.nl	MeesterBaan	The vacancies are divided into different fields of study, such as electrical technology and care and welfare.	Vocational Training → Secondary Vocational Education ¹⁸⁴	mbo ¹⁶⁹ teacher ²⁸⁹⁰ region ⁵⁴¹² vacancy ⁶⁵⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
mijnloopbaaninvastgoedonderhoud.nl	OnderhoudNL	Users can determine their career goals and map out a route to improve in their current field or explore a new field.	Education & Training → Career ¹⁷⁶⁵ Career & Guidance → Career Planning ³⁷⁵	function ²²¹ career ²⁵¹³ route ³⁴²⁵ employee ⁴⁴²⁹ maintenance ²⁰⁰⁹³
werkenbijhemubogroep.nl	Hemubo Group	The Hemubo Group operates in various fields, including renovation, installation and glass.	Job Postings → Regional Job Postings ³⁴ Online Services → Job Boards ¹⁰³⁶	employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	South-Holland → Delft ⁵³⁰⁹
korbis.nl	WKV Korbis	The website provides information about the different playing locations, both fields and halls.	Team Sports → Korfbal ⁴⁰⁶ Sport Facility → Sports Parks ⁵⁷	korfball ⁷⁵ membership ¹⁰⁴⁴² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹
bitcoincollege.nl	BitcoinCollege	The courses help course participants to understand the impact of Bitcoin on their own field.	Cryptocurrency → Bitcoin ⁸⁵ Online Courses → Financial Education ¹⁶²	bitcoin ³⁵⁹ technology ⁶⁸¹⁶ student ⁷⁶²³ course ¹⁴⁷²⁸
beachcenterzuidhorn.nl	Stichting Beachcenter Zuidhorn	The beach fields of Beach Center Zuidhorn are available for various beach sports, including volleyball, tennis and soccer.	Beach Sports → Beach Volleyball ¹¹⁶ Sport Facility → Sports Fields ¹⁵²	beach volleyball ⁷⁴ sponsorship ²⁶⁸⁶ reservation ³³⁷³ club ⁴²²⁵	Westerkwartier → Zuidhorn ²⁸⁶
techers.nl	Techers	The website offers assignments within specific fields such as electrical engineering and installation technology.	HR Services → IT Recruitment ⁴⁴⁷	contact person ²⁴³ freelancer ⁸⁷⁷ assignment ¹¹²¹	South-Holland → Gorinchem ¹⁹⁴⁷
drenthslandgoed.nl	Niels Tieland	The former football fields have been transformed into part of the garden, where guests can relax.	Football → Amateur Football ⁷⁵⁷ Sports Clubs → Football Clubs ⁴⁶⁷	football club ⁶⁰³ horse ⁴³³⁷ apartment ⁵⁰⁸⁸ garden ¹³¹²⁹	Drenthe → Aa en Hunze ¹⁰³⁷
hondenuitlaatvelden.nl	Honden Uitlaat Velden	The text describes a fenced field where dogs can play and exercise, which is the central element of the service.	Dog Care → Dog Walking Service ³⁵⁶ Outdoor Adventures → Walking ¹²⁶⁰	movement ²³⁰⁴ dog ⁵⁴⁸³	Venlo → Lomm ⁶⁶
sintmartinusboxtel.nl	Hippische Sportvereniging Sint Martinus	The association offers a large outdoor field with a grass field and a riding track.	Equestrian → Riding Clubs ²⁴⁵	riding hall ²⁵ canteen ²¹⁰ accommodation ⁴⁹²¹ association ⁸⁵⁶²	North-Brabant → Boxtel ¹¹⁵⁴
cirkelout.nl	Cirkel Out	The website emphasizes the value of experimenting in various fields to find the right passion and qualities.	Specific Institutions → Universities ⁸⁷⁷ Social Issues → Participation ¹⁰²³	mistake ²⁰ ambition ⁵⁷⁶ participant ¹⁹³⁴ idea ²³⁶⁷ student ⁷⁶²³
diplomaregistersquare.nl	Stichting sQuare	The courses are developed in collaboration with field and/or educational partners.	Professional Development → Training Programs ¹²⁹ Business & Management → Certification ³⁶⁴	methodology ³³² examination ⁴²⁹ skills ¹¹⁰⁵ training ²⁸¹³³
lichiq.nl	LiChiq Staff	LiChiq Staff works in diverse fields such as finance, accounting, and ICT.	HR Services → Specialized Recruitment ²⁰⁹	candidate ¹⁸⁹⁶ employer ²³⁸³ relationship ⁴²⁰⁵ vacancy ⁶⁵⁹⁸	Netherlands → Gelderland ⁶⁷⁰¹⁵
schutterijhaelen.nl	Schutterij Sint Agatha Haelen	The shooting field is the location where the association practices and where the event space, the Loerejong, is located.	Outdoor Activity → Shooting ⁸⁸² Activity → Active Sports ¹⁶	cooperation ⁴³³ shoot ⁷¹³ space ³⁸⁴⁶ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Leudal → Haelen ¹³¹
agnesmertens.nl	Clarity Call Liminal Art	The ‘field’ is described as the underlying area that breathes energy and meaning and where transformation takes place.	Spirituality → Consciousness ¹⁹³ Mindfulness → Awareness ⁶¹⁴	frequency ⁷³
continu.nl	Continu Professionals	The vacancies are organized by specific fields, such as civil engineering and civil technology.	HR Services → Executive Search ⁷³⁷ HR Services → Technical Recruitment ⁴⁷⁴	staffing solutions ¹² ambition ⁵⁷⁶ vacancy ⁶⁵⁹⁸ video ⁶⁷¹⁴	Haarlemmermeer → Schiphol ²¹⁶³
projects-abroad.nl	Projects Abroad	Volunteers and interns can further develop their skills in diverse fields.	Volunteering → International Volunteering ¹⁷ Internships → International Internships ²⁹	internship ⁶⁹⁴ travel ⁷²¹⁰ community ⁷⁹³¹ volunteer ⁸³⁶⁷	Amsterdam → Southeast ⁸¹⁵
limburgvac.nl	Limburgvac	Jobs are categorized into different fields, such as IT, automation, and healthcare.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	jobseeker ³⁰⁰ employer ²³⁸³ job ²⁷⁹⁵ region ⁵⁴¹²	Limburg → Roermond ²⁶⁰²
zkvdemeervogels.nl	Korfbalvereniging Meervogels	The website provides detailed information about the various fields used by the korfbal association, including their names and locations.	Team Sports → Korfbal ⁴⁰⁶	sponsorship ²⁶⁸⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹
indischgoud.nl	Coöperatie Indisch Goud	The events take place around the Netherlands Indies field, referring to a specific geographical and cultural environment.	Cryptocurrency → Bitcoin ⁸⁵ Painting → Individual Artists ⁶⁶⁸	collective ²⁵⁶ culture ³⁹²² workshop ¹⁹³²⁵ coach ²⁵⁸¹⁰ event ⁴⁵¹⁹⁹	The Hague → Haagse Hout ³⁴⁷
werkenbijporsche.nl	Porsche Netherlands	The vacancies encompass a wide range of fields, from automotive technology to sales and marketing.	Job Postings → Regional Job Postings ³⁴ Industry → Automotive ²⁹¹	porsche ¹⁵⁷ job ²⁷⁹⁵ vacancy ⁶⁵⁹⁸	Maasgouw → Heel ¹⁷³
kratosbeach.nl	Kratos Beach	The website contains information about the availability of the fields.	Beach Sports → Beach Volleyball ¹¹⁶	beach volleyball ⁷⁴ mini ¹⁰¹ season ⁶⁹² registration ⁴³⁶⁶ training ²⁸¹³³	South-Holland → Delft ⁵³⁰⁹
fixjejob.nl	FixJeJob B.V.	Jobs are automatically shown to professionals based on their field.	E-Commerce → Marketplaces ¹⁰⁵³ Software Development & Engineering → App Development ¹⁰⁸⁴	fee ⁶⁴⁰ profile ¹⁹⁶⁵ job ²⁷⁹⁵ reviews ³¹⁷² app ⁴⁵⁹⁵
doq.nl	Vind mijn vakgebied	The website provides an overview of different medical fields, ranging from Anesthesiology to Urology.	Medical Care & Services → Specialty Medicine ³⁶⁵⁷ Research & Academia → Medical Education ¹⁸³	e-learning ⁵⁸⁰ medication ¹¹⁶⁴ diagnosis ¹⁴⁹⁰ image ²⁶⁰⁵
languagelab.nl	The Language Lab	The agency is specialized in translations for various fields.	Communication & Content → Translation ¹⁰⁵³	term ²⁵¹ translation ¹⁵²³ language ²⁰¹⁶
vvheiligerlee.nl	vv Heiligerlee	The website provides updates on maintenance work and renovations of the football fields.	Sports Clubs → Football Clubs ⁴⁶⁷ Sports Activities → Football ⁴¹⁴⁴	football club ⁶⁰³ season ⁶⁹² board ³⁴³⁸	Oldambt → Heiligerlee ⁵⁴
haagsebowls.nl	Haagse Bowls	A field at Sportpark Klein Zwitserland serves as a location for playing bowls, where players enjoy themselves outdoors.	Team Sports → Boules ¹⁵⁹	sportpark ⁷⁵ bowl ⁴⁸² player ⁶⁷⁸ member ¹⁰¹⁵⁴	South-Holland → The Hague ¹⁹⁸⁹⁸
ubboemmius.nl	Ubbo Emmius	Education is provided within various fields such as Technology, Care & Welfare and Economics.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹ Higher Learning → Educational Institutions ¹⁰⁴⁹	school ⁷⁸⁵⁶ education ¹³⁴⁷¹ news ¹⁵²⁹³	Stadskanaal → Onstwedde ¹⁰³
natuurgebiedinbeeld.nl	Natuurbescherming Nederland	The website describes several fields in both Drenthe and Friesland, such as Doldersummerveld and Wapserveld.	Nature → Natural Areas ²⁵⁷	bog ¹¹ natural area ²⁰⁸ lake ³⁵² dune ⁶¹¹ forest ¹⁴¹⁸	Westerveld → Doldersum ¹⁶⁴
ddwkorfbal.nl	DDW korfbalvereniging	The club has opened a brand new artificial turf field, enabling matches in various weather conditions.	Sports Clubs → Dutch Sports Clubs ³³⁷ Team Sports → Korfbal ⁴⁰⁶	korfbal ¹⁸² tournament ²⁴⁷⁶ competition ⁴⁷⁵⁹ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Reusel-De Mierden → High Mierde ⁶³
fsvu.nl	FSVU	The FSVU organizes activities to connect students with the tax field.	Specific Institutions → Universities ⁸⁷⁷ Vocational Training → MBO ⁶⁹⁰	business world ¹² master ²¹⁹ sponsors ²⁶⁴² association ⁸⁵⁶²	North-Holland → Amsterdam ⁴¹²⁵³
bedrijfsbodemwaterplan.nl	NMI & ZLTO	Users select their individual agricultural field.	Fertilizers & Soil Health → Soil Management ²² Nature Conservation → Water Management ¹¹³⁸	score ¹¹⁹ measures ¹⁹² soil ⁹³⁰ water ²⁵⁰¹
depubliekepartner.nl	Public Partner	The website showcases assignments within specific fields such as ICT, Legal and Infrastructure.	Customer Service → Outsourcing ⁵¹¹ Government & Administration → Public Sector ³¹⁹	detachering ¹⁸ zzp ¹²¹ assignment ¹¹²¹ contract ²⁴¹⁵ region ⁵⁴¹²	Gelderland → Doetinchem ²⁷⁰⁶
labelterreinheerenveen.nl	Scouting van Maasdijk	Visitors can camp on three large grass fields.	Youth Organizations → Scouting ¹⁰⁰⁴ Accommodation → Cabins ²³¹	site ⁴²² forest ¹⁴¹⁸ camp ²⁴⁶⁶ facility ²⁶¹⁶	Heerenveen → Oranjewoud ⁶⁴
vertaalexperts.nl	VertaalExperts	VertaalExperts has specialists for various fields, such as technical and veterinary texts.	Communication & Content → Translation ¹⁰⁵³	translator ¹⁶⁹ translation ¹⁵²³	South-Holland → Leiden ⁷⁰⁸⁹
volkshuisdeventer.nl	Volkshuis Deventer	Volkshuis Deventer cultivates vegetables and herbs on its field, the Volksakker, to enhance the quality of its dishes.	Venues & Rentals → Venues ²⁰⁴⁴ Neighborhood Focus → Community Centers ⁹⁴¹	gardener ²⁹⁹ hall ¹⁷⁸⁶	Voorst → Twello ⁴⁶⁹
drc.nl	sv DRC	The club describes the location of the fields as a peaceful environment with views of fields and dike houses.	Football → Youth Football ²⁰²	rules ⁵⁹³ instagram ¹²¹⁶ football ¹³⁴⁷ club ⁴²²⁵ newsletter ⁶⁵⁰⁴	Amsterdam → Durgerdam ⁴⁹
fsvfysiek.nl	FSV Fysiek	The association aims to help students deepen their knowledge of the field.	Specific Institutions → Universities ⁸⁷⁷	physiotherapy ⁴⁶⁸⁸ student ⁷⁶²³ membership ¹⁰⁴⁴² network ¹¹¹²³
vannesenplaisier.nl	van nes + plaisier	Van nes + plaisier is specialized in a wide range of fields, including production, logistics, and technology.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	vacature ¹¹ agency ⁹⁴⁴ job ²⁷⁹⁵ staff ³⁴⁰⁵	South-Holland → Waddinxveen ¹⁰⁴⁶
boekeentolk.nl	Boekeentolk.nl	The interpreters specialize in specific fields to provide the necessary expertise.	Communication → Interpreting ²⁶⁵ Business Services → Other Business Services ¹²⁹	interpreter ²¹⁷ scheduling ²⁶¹ meeting ²³⁸¹ communication ¹⁰¹⁶²
stichtingbenoe.nl	Stichting Benoe	The foundation actively seeks contact with the field.	International Aid → Development Aid ⁴⁰¹ Social Services → Person-Centered Care ²⁸	requests ¹⁹⁷ initiative ¹²⁹⁷ care ¹²³³⁸
ipd-leo.nl	IPD en LEO Opleidingen	IPD’s training encompasses various fields, including real estate, interior design, ecology, and accounting & bookkeeping.	Professional Development → Training Programs ¹²⁹ Training → Management Training ¹⁰²⁵	skills ¹¹⁰⁵ workshop ¹⁹³²⁵ training ²⁸¹³³
falcons.nl	Falcons	The club's field is located on Beginweg.	Team Sports → Baseball ¹⁰⁹ Team Sports → Softball ⁸³	canteen ²¹⁰ season ⁶⁹² club ⁴²²⁵	Flevoland → Lelystad ³¹⁸⁰
flexacademy.nl	Flex Academy	The website offers the ability to filter by field, allowing users to quickly find the right course.	Professional Education → Legal Education ¹⁰²	course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰ training ²⁸¹³³
jogg-roosendaal.nl	Jogg Roosendaal	The game is played on a field with a field of 22 yards and 20 meters.	Clubs → Dutch Clubs ²⁰⁰ Team → Cricket ⁵⁹	cricket ⁴¹ blog ¹³³⁹²
lva-service.nl	LVA Service	The recruitment agency is specialized in various fields such as production and logistics.	Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	candidate ¹⁸⁹⁶ employer ²³⁸³ employee ⁴⁴²⁹ administration ⁶⁵⁸⁷
vacature-plek.nl	Vacatureplek	The website provides specialized tips for different fields, tailored to the specific needs of job seekers.	Job Postings → Regional Job Postings ³⁴	application ³³⁷⁷ partner ⁴²⁷² vacancy ⁶⁵⁹⁸
hbs-triskelion.nl	Handboogschietvereniging Triskelion	The club’s shooting field has undergone an upgrade, with old targets replaced with new ones.	Shooting → Archery ²⁵⁹	target ⁷⁷ bow ⁸⁸ rules ⁵⁹³ competition ⁴⁷⁵⁹	Meppel → Nijeveen ¹⁵³
manegewinsum.nl	Manege Winsum	Field rental is also offered to practice sports.	Venues & Rentals → Venues ²⁰⁴⁴ Sports → Sport Facility ⁴⁸⁶⁷	manege ⁴³ arrangement ³¹⁰⁴ space ³⁸⁴⁶	Het Hogeland → Winsum ³⁶⁹
noorderpijl.nl	Noorder Pijl Archery Association	Field training takes place in Roden and at various distances with different targets.	Associations → Sports Associations ¹⁰⁸² Shooting → Archery ²⁵⁹	archery ¹³⁷ tournament ²⁴⁷⁶ association ⁸⁵⁶² training ²⁸¹³³	Westerkwartier → Leek ⁶⁴²
lijnvast.nl	Lijnvast B.V.	The company specifically focuses on marking sports fields.	Sustainable Construction → Materials ¹⁰⁴³ Specialized Works → Sports Facilities ¹⁸	mark ⁹³ shop ⁶⁴⁸³	Voorst → Twello ⁴⁶⁹
pr-bootcamp.nl	Pow Comms	The goal of the bootcamp is to familiarize participants with the PR field.	Internships & Jobs → Internships ⁵⁵¹ Communication → PR ⁸⁷⁹	pr ¹⁸⁹ journalist ²²⁶ story ⁸²⁸⁵ training ²⁸¹³³	North-Holland → Amsterdam ⁴¹²⁵³
gedenkbosdespinder.nl	Gedenkbos De Spinder	Visitors can choose a spot next to a tree or shrub on a shared field.	Nature → Forest ³⁸⁷	remembrance ¹⁶⁵ privacy ¹²⁸⁶ forest ¹⁴¹⁸ tree ¹⁸⁷⁹	North-Brabant → Central and West-Brabant ¹⁹⁶
vvechteld.nl	V.V. Echteld	The association has two fields, a training field and a canteen with facilities.	Football → Amateur Football ⁷⁵⁷ Local Communities → Villages ¹⁰⁰⁵	football association ¹²⁹ sponsors ²⁶⁴² news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Neder-Betuwe → Echteld ⁶⁶³
bloodboundsadventures.nl	Blood Bounds Adventures	Blood Bounds Adventures' field is a large, dynamic battleground with various obstacles.	Internet → Forums & Communities ¹⁵⁹⁹ Shooting → Airsoft ⁵⁹	rules ⁵⁹³ mission ¹⁰⁰⁰ participant ¹⁹³⁴ safety ⁵⁸¹⁹
fernandoricksen.nl	Voetbal International	On the football field, Fernando Ricksen showed his fighting spirit and was not afraid to engage in duels.	Sports Activities → Football ⁴¹⁴⁴ Personal → Biography ¹⁰⁰³	fighter ²³ footballer ⁵³ addiction ³⁵³ biography ⁶⁹⁷ life ²⁶⁷³	Limburg → Heerlen ²⁷⁵⁵
swampdragon.nl	Swamp Dragon	The tournament takes place on the grass field.	Team Sports → Frisbee ¹² Golf → Tournaments ⁴⁵⁴	frisbee ²⁶ spirit ²⁸³ tournament ²⁴⁷⁶
nves.nl	Dutch Association of Extended Scope Specialists	The extended scope field is a new and developing field within physiotherapy.	Organizations → Professional Associations ¹⁰⁰⁴ Driver & Vehicle → Continuing Education ⁴⁵⁴	professional association ³¹ healthcare ²³¹⁶
hargenultimate.nl	Hargen	The text explicitly lists the fields where teams will compete.	Golf → Tournaments ⁴⁵⁴ Beach Activity → Beach Sports ¹²⁷	division ¹¹⁴ tournament ²⁴⁷⁶ schedule ²⁶²⁴
korfbalvddo.nl	Korfbal VDDO	The association has several fields in various locations, including Oosterwolde and Donkerbroek.	Sports Clubs → Dutch Sports Clubs ³³⁷ Team Sports → Korfbal ⁴⁰⁶	korfbal association ¹¹ hall ¹⁷⁸⁶ sponsors ²⁶⁴² event ⁴⁵¹⁹⁹	Ooststellingwerf → Haulerwijk ¹⁰³
peterfransdegraaf.nl	Peter Frans de Graaf	The painting ‘Field’ is a prominent part of the portfolio.	Painting → Contemporary Painting ⁴⁵² Painting → Individual Artists ⁶⁶⁸	technique ²¹⁵⁷ paintings ³⁹⁰⁷ photo ⁷⁷⁷⁸
vertaalbureau-aabee.nl	Vertaalbureau AABEE	The bureau specializes in a wide range of fields such as law, insurance and marketing.	Language Learning → Language ¹⁶⁸⁹ Communication & Content → Translation ¹⁰⁵³	translator ¹⁶⁹ translation ¹⁵²³ document ¹⁶⁷⁸ language ²⁰¹⁶
taalvos.nl	Taalvos	Taalvos has experience with a wide range of fields, including law, medicine, and marketing.	Legal → Sworn Translators ¹² Communication & Content → Translation ¹⁰⁵³	revision ¹⁶³ translation ¹⁵²³
advocaatarnhembv.nl	Advocatenkantoor Bosman	The website provides information about different legal fields.	Law → Criminal Law ¹⁸⁰³ Legal → Lawyers ⁷⁰⁸	government ⁸²⁷ law ¹³²⁹ lawyer ²⁶⁸³	Gelderland → Arnhem ⁸⁶⁸⁰
raamvallei.nl	Agrarische Natuur Vereniging Raamvallei	The association works on the conservation and restoration of fields by, for example, creating field margins.	Green Spaces → Landscape Management ³⁸¹ Blogs & Publications → Regional ²⁷²	landscape ²⁶⁰⁹ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Land van Cuijk → Langenboom ⁸¹
vergadereninleiden.nl	N.V.	The Field is a location suitable for larger meeting groups, near the station.	Livestock → Dairy Farming ⁶⁷¹ Venues → Halls ⁴¹⁹	meeting location ¹⁰⁹ studio ⁵⁴⁶⁵ workshop ¹⁹³²⁵	South-Holland → Leiden ⁷⁰⁸⁹
formulierenmaker.nl	Formulierenmaker	There are 19 different types of fields available to customize forms.	Web Design & Development → Web Services ⁴¹³ Programming Languages → PHP ⁴⁰⁰	encryption ⁵⁰ form ⁶⁷⁹ subscription ³²⁸⁷ theme ⁴⁰¹⁵
hondenuitlaatservicenikki.nl	Hondenuitlaatservice Nikki	Dogs are walked on a specific enclosed field, providing a safe and controlled environment.	Dog Care → Dog Walking Service ³⁵⁶	walking service ⁴⁵ pack ¹⁸⁵ exercise ⁷⁰⁶ dog ⁵⁴⁸³ communication ¹⁰¹⁶²	The Hague → Haagse Hout ³⁴⁷
4feetforfun.nl	4 Feet for Fun	The fully enclosed field provides a safe environment for the training.	Dog Training → Dog School ⁹³	agility ¹⁷⁰ instructor ³¹²⁶ webshop ⁸⁶⁴⁸	North-Brabant → Vught ¹²³⁰
cooldogsarena.nl	Cool Dogs Arena	A large 840 square meter (20x42 meters) field is available for training and competitions.	Dog Sports → Agility ¹⁷ Sport Facility → Sports Centers ⁴³⁹	arena ¹²⁴ agility ¹⁷⁰ equipment ⁴¹⁴³ training ²⁸¹³³
fcwageningen.nl	Gemeente Wageningen	The main field of the stadium is in top condition and suitable for professional football tournaments.	Clubs → Dutch Clubs ²⁰⁰ Architecture & Sites → Historical Sites ¹⁹⁵¹	stadium ¹²⁹ supporter ¹³⁹ history ⁷²⁸⁶ volunteer ⁸³⁶⁷	Gelderland → Wageningen ¹⁹⁴⁹
uxcarriere.nl	UXcarriere	UXcarriere focuses on specific fields and specializations, enabling users to leverage their talents in the right context.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	sector ¹³³² article ⁶⁰⁰⁰ vacancy ⁶⁵⁹⁸
mijntechcarriere.nl	MijnTechCarriere	Users can specifically search for vacancies within different fields.	Industrial Equipment & Services → Machine Building ⁶⁶⁵ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	machine building ²⁷⁹ industry ¹⁷⁸⁰ job ²⁷⁹⁵ vacancy ⁶⁵⁹⁸ technology ⁶⁸¹⁶
hondenopvangdewi.nl	Dewi Hondenopvang	Dogs can safely play on fenced fields, guaranteeing the safety and well-being of the dogs.	Logistics → Transportation ¹¹⁰² Animals → Animal Care ¹⁸⁴⁹	owner ⁵¹⁵ board ³⁴³⁸ dog ⁵⁴⁸³	South-Holland → The Hague ¹⁹⁸⁹⁸
degroenet.nl	Stichting De Groene T van Noord	The football field recently received a new centerline and was repaired in August 2023.	Parks → Urban Parks ²⁹ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	lawn ⁴²⁷ park ¹⁸⁶³ resident ³²⁴⁵ foundation ⁶⁶⁷⁸	Rotterdam → North ³³²
zand-artshop.nl	Zand Art Shop	The ‘The Fields’ series depicts an image of a field with indefinable plant species.	Painting → Contemporary Art ⁸⁰⁵ Painting → Digital Art ⁸²⁰	visual language ⁵⁴ transparency ⁴⁴² composition ⁶³⁹ ai ²¹⁸¹ flowers ³²⁴⁸	South-Holland → Gouda ³⁵²¹
dugoutvoetbal.nl	Dugoutvoetbal.nl	Dugouts are placed along sports fields.	Commerce → Sporting Goods ¹⁰ Sport Facility → Sports Fields ¹⁵²	bench ¹⁸⁹ size ⁸⁰⁰
vacature-westland.nl	Vacature Westland	Users can easily search for vacancies by specific field.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	opportunity ⁵⁸¹ job ²⁷⁹⁵ vacancy ⁶⁵⁹⁸
asoniaandijk.nl	ToekomstGroep en Woningstichting Het Grootslag	The new residential area comes up on the former Asonia sports field in Andijk.	Internships & Jobs → Internships ⁵⁵¹ Local Communities → Villages ¹⁰⁰⁵	planning ¹⁹⁶⁹ housing ⁴³⁷⁸ municipality ⁶⁸³⁷ energy ⁹⁰⁷⁵	Dijk en Waard → Heerhugowaard ²⁰¹¹
jbvlepionnier.nl	JBV Le Pionnier	JBV Le Pionnier has two playing fields, which became available after hard work.	Team Sports → Boules ¹⁵⁹	jeu de boules ¹¹⁷ tournament ²⁴⁷⁶ club ⁴²²⁵	Gelderland → Brummen ⁷⁸⁹
clubbrothers.nl	Club Brothers	CB has four artificial turf fields.	Sports Clubs → Dutch Sports Clubs ³³⁷	clubhouse ⁷⁸⁴ tournament ²⁴⁷⁶ match ³⁴⁷¹ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Groningen → Hoogkerk ¹⁰⁰
niedorpsportcentrum.nl	Niedorp Sportcentrum	Plans include various types of fields, including soccer, tennis and beach sports.	Sport Facility → Sports Centers ⁴³⁹ Sport Facility → Sports Complexes ²⁵	steering committee ¹² sport center ⁶⁹ sports park ¹⁴⁰	Hollands Kroon → Wieringerwaard ⁷⁸
connected2talent.nl	Connected2Talent	Candidates can find vacancies within their personal field.	Online Services → Job Boards ¹⁰³⁶	electrical engineering ⁸¹⁷ it ¹⁵³⁹ job ²⁷⁹⁵ finance ⁵³⁴¹ vacancy ⁶⁵⁹⁸	Rotterdam → Botlek ⁶²
priveopstelling.nl	Prive Opstelling	The field in a private setup serves as a space where emotions and dynamics become visible and can be processed.	Systemic Approaches → Systemic Work ²⁸⁹ Mindfulness → Awareness ⁶¹⁴	dynamics ¹⁷⁷ setup ³³⁰ emotion ²¹⁶⁹ question ²²⁶¹
expertbase.nl	Expertbase	The website focuses on experts from a wide range of fields.	Writing → Columnists ¹⁰⁸ News & Journalism → Diversity ²³	editorial ¹⁶² knowledge ³⁵²⁸ story ⁸²⁸⁵
linked-group.nl	Linked Group	Linked Group specializes in specific fields, such as construction and ICT.	HR Services → IT Recruitment ⁴⁴⁷ HR Services → Specialized Recruitment ²⁰⁹	candidate ¹⁸⁹⁶ recruitment ²⁰¹⁵ network ¹¹¹²³
samenwerkingskunde.nl	Human Development Consulting	Samenwerkingskunde is an eclectic field that is focused on developing collaboration skills.	Anthropology & Sociology → Organizational Studies ⁷¹	instrumentarium ³⁷ consulting ³⁶³⁹ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶
beachpark-emmen.nl	Beachpark Emmen	Visitors can book beach fields via the website.	Sport Facility → Sports Parks ⁵⁷ Beach Life → Beach ⁵³²	volleyball ⁶¹⁷ map ⁸⁰¹ tournament ²⁴⁷⁶ sport ⁴²²⁸	Drenthe → Emmen ³³⁴⁸
nxt-hero.nl	NXT Hero	NXT Hero is active in various fields, such as IT and Engineering.	Employment & Labor → Employers ⁶⁰⁸ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	career coaching ⁴⁸⁰ candidate ¹⁸⁹⁶ recruitment ²⁰¹⁵ staff ³⁴⁰⁵ brand ¹⁷⁷³⁷	North-Holland → Amsterdam ⁴¹²⁵³
vacaturesinweert.nl	Get.Noticed	The website offers vacancies organized by specific fields such as ICT or Sales.	Online Services → Job Boards ¹⁰³⁶ Context ¹⁶¹³⁹⁴	jobalert ⁴⁷ mbo ¹⁶⁹ employer ²³⁸³ vacancy ⁶⁵⁹⁸	Limburg → Weert ²⁰³⁰
deelstof.nl	Deelstof	The app provides content specifically related to the organization's field of work.	Mobile Apps → Business Apps ¹¹ Communication → Internal Communication ⁶⁷	employee ⁴⁴²⁹ app ⁴⁵⁹⁵
123vertalen.nl	123vertalen.nl	The translation agency has experience in various fields, such as commercial, technical, and legal, and applies this expertise to the translations.	Websites → Professional Websites ¹⁷ Translation → Translation Agencies ¹⁰	translation ¹⁵²³ language ²⁰¹⁶ message ²²⁶⁰ software ⁸²⁹¹
bayle-machines.nl	Bayle machines	New research on sports fields and the nitrogen cycle is an important focus.	Agriculture → Agricultural Machinery & Equipment ⁶³¹ Economy → Local Economy & Development ⁷²¹	weed control ⁴³ tractor ⁷⁸⁹ machine ³⁷²⁷ tool ³⁹⁰⁷	Steenwijkerland → Kallenkote ³⁷
degeneugten.nl	Camperplaats De Geneugten	The grounds of the camper site border fields, providing visitors with a peaceful environment with views of the countryside.	Camping → Minicamping ²⁴⁶ Camping → Campsites Netherlands ⁷⁹²	camper site ¹²⁶ cow ⁵⁹⁶ electricity ⁷⁴⁵ wifi ¹³⁷² event ⁴⁵¹⁹⁹	Meierijstad → Schijndel ⁹⁰⁸
paintballlimburg.nl	All in Echt	The paintball field is 3000 square meters and is divided into trenches and obstacles, making the experience dynamic.	Shooting → Paintball ⁴⁰ Corporate Events → Team Building ¹⁰⁰⁵	paintball ⁷¹ team outing ²²¹ package ⁶¹¹²	Netherlands → Limburg ³¹⁹⁰⁹
peoplespotential.nl	Peoples Potential	The website categorizes vacancies by various fields such as HR and IT.	Employment & Labor → Employers ⁶⁰⁸	personnel ¹⁰⁸⁴ employer ²³⁸³ vacancy ⁶⁵⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
radboudruiters.nl	Rijvereniging de Radboudruiters	The association has its own field with an outdoor arena.	Equestrian → Riding Clubs ²⁴⁵ Outdoor → Horse Riding ⁹⁴¹	horse ⁴³³⁷ competition ⁴⁷⁵⁹ lesson ⁵¹⁵⁴ member ¹⁰¹⁵⁴	Smallingerland → Drachten ²⁰⁵²
roodbontekoe.nl	Koemunicatie	The cows spend time on fields next to the horses and flowers.	Food & Dining → Hiking Routes ³⁹ Nature → National Parks ⁸⁹⁸	picnic basket ³³ cow ⁵⁹⁶ tour ²³¹⁵ farm ²⁶²²	Ede → Kernhem ²³⁹
vriendenvanwaf.nl	Stichting Vrienden van WAF	The training field is spacious and safe, with a fence 1.80 meters high and an area of 5000 m2.	Dogs → Dog Activities ⁶⁰ Dogs → Dog Training ⁸⁸¹	dog ⁵⁴⁸³ volunteer ⁸³⁶⁷ course ¹⁴⁷²⁸ training ²⁸¹³³	Rotterdam → Rozenburg ¹⁹⁹
weteringcivieletechniek.nl	Wetering Civile Techniek B.V.	The website showcases the various fields where Wetering Civile Techniek has expertise, such as roads, light rail and systems engineering.	Consulting → Technical Consulting ³⁸² Engineering → Industrial Engineering ²⁷⁰	system engineering ²⁶ project leader ¹⁹¹ advisor ¹⁰⁵⁵ infrastructure ¹⁴⁶⁰	Voorst → Nijbroek ⁴⁵
nectarbloemen.nl	Nectar Bloemen	The flowers are primarily grown on their own field, which emphasizes the company's sustainability.	Flowers → Florists ¹⁴¹⁰ Living → Sustainable Living ⁸¹⁷	pickup location ³³ season ⁶⁹² size ⁸⁰⁰ flowers ³²⁴⁸ subscription ³²⁸⁷	Eindhoven → Center ¹⁰⁸
vanleeuwen-es.nl	Van Leeuwen Executive Search	The company has success in filling vacancies within the fields of big data & analytics, risk & actuarial, finance & control, and consulting.	HR Services → Executive Search ⁷³⁷ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	degree ³¹ position ⁸⁷⁵ candidate ¹⁸⁹⁶
duoinstallatiezuid.nl	Duo Installatie Zuid	The school strongly emphasizes learning through direct experience in the field, enabling students to quickly build practical skills.	Vocational Training → MBO ⁶⁹⁰ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	diploma ⁷⁹⁵ teacher ²⁸⁹⁰ student ⁷⁶²³ training ²⁸¹³³	Limburg → South-Limburg ¹²²⁵
mollemantsje.nl	Sape-jan Rozema	The moth catcher works on freeing fields from mole damage.	Nature → Insects ²²⁸ Agriculture → Livestock ²⁴¹³	mole ⁶¹ friesland ⁶⁹² garden ¹³¹²⁹	De Fryske Marren → Terkaple ²⁴
voetbalboarding.nl	Voetbalboarding	The website offers rental of various field types with variable dimensions.	Online Services → Job Boards ¹⁰³⁶ Sport Facility → Sports Fields ¹⁵²	rental ⁷²⁵⁷	South-Holland → Rotterdam ²⁵⁰⁴⁸
honkbalhandschoen.nl	Pak de Overwinning	The website offers information on gloves suitable for use on the field during baseball play.	Team Sports → Baseball ¹⁰⁹ Youth → Soccer ²⁵⁴	gloves ²⁹² player ⁶⁷⁸
depikeurtjes.nl	Rijvereniging en Ponyclub de Pikeurtjes	The association's field offers facilities for riding and training.	Equestrian → Riding Clubs ²⁴⁵ Outdoor → Horse Riding ⁹⁴¹	association ⁸⁵⁶² membership ¹⁰⁴⁴² course ¹⁴⁷²⁸	Heeze-Leende → Sterksel ⁸⁰
dekweldam.nl	Bed and Breakfast De Kweldam Winssen	Within the view from the terrace is a field with chickens and miniature goats.	Accommodation → Country Estates ⁷³⁸ Vacations → Rural Vacations ¹³	dike ¹⁴⁸ bed and breakfast ³⁰⁵ terrace ⁴⁸⁴⁷ accommodation ⁴⁹²¹ kitchen ⁶⁴⁴³	Beuningen → Winssen ⁹²
hitecs.woodselect.nl	HiTecs	HiTecs supports clients in a wide range of technical fields, such as installation and electrical technology.	Staffing & Recruitment → Technical Staffing ³⁹⁵ Business → Industry ³⁶⁹⁷⁷	technician ⁸¹⁵ agency ⁹⁴⁴ professionals ¹⁹⁶⁶
buitenplaatsureterp.nl	Buitenplaats Ureterp	The fields stretch out peacefully before the guests, creating a sense of space and tranquility.	Landscape → Dutch Landscapes ⁴¹ Camping → Campsites Netherlands ⁷⁹²	camper pitch ⁷⁹ pool ¹⁵³² hospitality ³⁴⁹¹ apartment ⁵⁰⁸⁸ nature ⁹⁰⁹⁴
vacatures-sittard.werk-t.nl	werk-t.nl	Users can find vacancies based on their chosen field.	Jobs → Vacancies ¹⁰⁹⁹ Social Issues → Participation ¹⁰²³	form ⁶⁷⁹ employer ²³⁸³ region ⁵⁴¹² vacancy ⁶⁵⁹⁸	Sittard-Geleen → Geleen ⁹⁷⁸
titustranslations.nl	Titus Translations	The translator has expertise in various fields, such as film, architecture, art history, and media.	Communication & Content → Translation ¹⁰⁵³	native speaker ¹⁴ translation ¹⁵²³ text ²⁴⁶⁷ price ⁸³²⁸	Rotterdam → Center ³⁸²
euroforum.nl	Euroforum B.V.	The website outlines an overview of various relevant fields.	Economy & Finance → Economics ¹¹¹⁵ Adult & Continuing Learning → Professional Training ¹²²⁴	conference ⁷⁶³ professionals ¹⁹⁶⁶ knowledge ³⁵²⁸ training ²⁸¹³³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
sn.nl	Schouten & Nelissen	Fields represent the diverse industries and disciplines in which Schouten & Nelissen offers training and courses.	Training → Management Training ¹⁰²⁵ Business & Management → Educational Consulting ⁵⁶¹	master ²¹⁹ education ¹³⁴⁷¹ coach ²⁵⁸¹⁰ training ²⁸¹³³
capabel.nl	Capabel Onderwijs	The website features a wide range of fields of study for students to choose from.	Personal Development → Guidance ⁷⁸¹ Higher Learning → Higher Vocational Education ⁸⁴	placement ²²¹ diploma ⁷⁹⁵ session ¹⁷⁹¹ blog ¹³³⁹²
cme-online.nl	CME-Online	Users can choose courses based on their field.	Business & Management → Professional Education ⁴⁰² Driver & Vehicle → Continuing Education ⁴⁵⁴	healthcare professional ¹⁹⁹ learning environment ²²¹ teacher ²⁸⁹⁰ subscription ³²⁸⁷ course ¹⁴⁷²⁸
opleiding.nl	Opleiding.nl	The page is divided into different fields of study for a targeted search.	Vocational Training → MBO ⁶⁹⁰	retraining ³⁷ level ⁴⁹⁴ deal ⁷⁷³ course ¹⁴⁷²⁸
indicator.nl	Tips & Advies	The content is grouped by relevant fields.	Finance & Insurance → Tax Systems ⁸³³ Human Resources → Payroll ⁵¹⁵	subscriber ⁶⁷ handbook ¹⁹⁴ publication ²⁰¹⁸
koeindekost.nl	Koe in de Kost	Guests stay in the fields, surrounded by cows and nature.	Accommodation → Country Estates ⁷³⁸ Vacations → Farm Vacations ¹⁷	family vacation ²² cow ⁵⁹⁶ farm ²⁶²²	Netherlands → Overijssel ³⁹⁶⁴⁹
translations.nl	Translations Vertaalbureau	Translations Vertaalbureau specializes in financial, legal, technical, and medical translations.	Translation → Language Translation ²⁸⁸ Legal → Legal Translation ⁵⁹	translation ¹⁵²³ language ²⁰¹⁶ network ¹¹¹²³
pe-academy.nl	PE-Academy	As a professional, you determine yourself which courses you want to pursue, from whom you take extra knowledge and deepening, and at what time you want to learn about a new and current topic.	Finance → Taxation ¹⁵⁶⁷ Driver & Vehicle → Continuing Education ⁴⁵⁴	pe points ¹¹ continuing education ²⁰¹ course ¹⁴⁷²⁸
herenbos.nl	Herenbos	The website provides opportunities to search by specific fields.	Work → Jobs ¹⁴⁴³ Employment & Labor → Employers ⁶⁰⁸	green sector ¹⁶ region ⁵⁴¹² vacancy ⁶⁵⁹⁸ training ²⁸¹³³ event ⁴⁵¹⁹⁹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
werkenbijomrin.nl	Omrin	The website describes the different fields in which employees can work.	Jobs → Vacancies ¹⁰⁹⁹ Environment → Waste Management ²⁶⁸⁰	waste ¹³¹² employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	Gelderland → Harderwijk ²²⁴⁰
zakelijkplatform.nl	ZakelijkPlatform.nl	Professionals are categorized based on their specific field of expertise, making it easy to find the right specialist.	Government & Administration → Public Sector ³¹⁹	community ⁷⁹³¹
laudius.nl	Laudius	A field defines a specific domain or branch within education.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Adult & Continuing Learning → Distance Learning ²⁴	course ¹⁴⁷²⁸ training ²⁸¹³³
sbo.nl	Study Center for Business and Government	The website provides information about various areas such as legal, environmental, government...	Training → Corporate Training ¹³³¹ Community → Government & Administration ¹⁰⁵⁶⁷	in-company ²⁶ conference ⁷⁶³ training ²⁸¹³³
poh-ggz.nl	The National Association of POH-GGZ	The newsletters are geared towards keeping members up-to-date in their field.	Organizations → Professional Associations ¹⁰⁰⁴ Research & Academia → Medical Education ¹⁸³	webinar ⁸⁷⁰ newsletter ⁶⁵⁰⁴ research ⁸⁹⁶⁷ membership ¹⁰⁴⁴²
academicpositions.nl	Academic Positions	The website offers jobs per specific field of study.	Student Life → Students ³⁵² Career & Guidance → Career Planning ³⁷⁵	country ⁵³⁰ university ⁵⁹³ job ²⁷⁹⁵ research ⁸⁹⁶⁷
regiomaasdelta.nl	Scoutingregio Maasdelta	The region operates with various fields of work focusing on specific target groups and activities within the region.	Youth Organizations → Scouting ¹⁰⁰⁴ Associations → Regional Associations ²⁹²	depot ⁶⁰ scouting ⁸⁶⁰ member ¹⁰¹⁵⁴ training ²⁸¹³³	Voorne aan Zee → Brielle ⁶¹³
mvc-cumulus.nl	MVC-Cumulus Kampen	The club's field is located at Schansdijk in Kampen.	Model Aviation → Model Flying Clubs ⁴⁷ Media → News & Journalism ¹⁰⁸²⁷	model aviation ¹⁷ club ⁴²²⁵ event ⁴⁵¹⁹⁹	Overijssel → Kampen ²¹⁶¹
partnerofchoice.nl	Leendert van	The supplier directories are categorized by field, reflecting a focus on specialized procurement.	Construction & Maintenance → Procurement ⁵⁶⁷	preference ⁶⁶ procurement ⁴⁹³ partnership ¹⁴⁰⁷ supplier ¹⁷²⁵ research ⁸⁹⁶⁷
mettaal.nl	Mettaal	Mettaal operates in a broad spectrum of fields, including legal, financial, and technical.	Translation → Translation Agencies ¹⁰ Translation → Language Translation ²⁸⁸	interpreting ⁵⁶ project manager ¹²³ copywriting ⁵⁸¹ editing ¹³³⁸ translation ¹⁵²³	South-Holland → Rotterdam ²⁵⁰⁴⁸
rwflevoland.nl	Rottweiler Werkgroep Flevoland	The working group has two large training fields.	Breed → Rottweiler ¹⁸ Associations → Animal Associations ¹⁶	rottweiler ²⁸ instructor ³¹²⁶ association ⁸⁵⁶² training ²⁸¹³³ event ⁴⁵¹⁹⁹
lostminute.nl	Lost Minute / LM	Freelancers are deployed in their specific field.	HR Services → IT Recruitment ⁴⁴⁷ Marketing & Branding → Entrepreneurs ⁵⁶²	freelancer ⁸⁷⁷ assignment ¹¹²¹ certification ³³⁸⁰ technology ⁶⁸¹⁶	Gelderland → Arnhem ⁸⁶⁸⁰
somaworks.nl	SOMA Works	The company has expertise in a wide range of technical fields.	Staffing & Recruitment → Technical Staffing ³⁹⁵ Adult & Continuing Learning → Professional Training ¹²²⁴	job ²⁷⁹⁵ staff ³⁴⁰⁵ vacancy ⁶⁵⁹⁸ training ²⁸¹³³	Maasdriel → Hedel ¹⁹⁰
vogelvrijondernemen.nl	Vogelvrij Ondernemen	The website focuses on helping entrepreneurs in their specific field to become a well-known name.	Mindfulness → Awareness ⁶¹⁴ HR Services → Technical Recruitment ⁴⁷⁴	session ¹⁷⁹¹ growth ⁴⁰⁵⁴ coach ²⁵⁸¹⁰
dggk.nl	stichting Boer & Data	The calendar takes into account the soil quality of individual fields to adjust the plans.	Industrial Solutions → Agricultural Software ¹⁰ Livestock → Dairy Farming ⁶⁷¹	analysis ¹⁶¹⁵ registration ⁴³⁶⁶ data ⁵⁸⁷²
cc-denhelder.nl	Cricket Club Den Helder	The club has secured its own field, 'De Linie', for hosting home games.	Team → Cricket ⁵⁹	cricket ⁴¹ clinic ¹⁰⁷⁹ match ³⁴⁷¹ club ⁴²²⁵ member ¹⁰¹⁵⁴	North-Holland → Schagen ²¹⁸²
centalis.nl	Centalis	Centalis works from enjoyment in their field.	Corporate Events → Team Building ¹⁰⁰⁵	results ³⁹⁵⁴ coach ²⁵⁸¹⁰ training ²⁸¹³³	North-Holland → Amsterdam ⁴¹²⁵³
vanderaagroep.nl	Van der Aa Groep	The company operates in various fields, each with its own division.	Technology → Telecom ³³ Technology → ICT ⁴⁸⁶	telecom ¹⁵⁵ ict ¹⁰⁴⁹ energy ⁹⁰⁷⁵	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
venv.nl	c.k.v. Vlug en Vaardig	The club has sports fields in Garyp and accommodation in Burgum.	Team Sports → Field Sports ²¹ Team Sports → Korfbal ⁴⁰⁶	korfbal ¹⁸² sponsor ¹¹⁵⁹ results ³⁹⁵⁴ accommodation ⁴⁹²¹	Tytsjerksteradiel → Burgum ³⁷¹
zuydprofessional.nl	Zuyd Professional	Zuyd Professional provides courses in various fields, including healthcare, ICT, and arts.	Adult & Continuing Learning → Professional Training ¹²²⁴ Higher Learning → Higher Vocational Education ⁸⁴	career ²⁵¹³ newsletter ⁶⁵⁰⁴ course ¹⁴⁷²⁸ training ²⁸¹³³
amhcwesterpark.nl	AMHC Westerpark	AMHC Westerpark has five beautiful hockey fields.	Universities → Eindhoven University of Technology ¹¹ Hockey → Hockey Clubs ¹¹⁸	hockey ³⁴⁸ club ⁴²²⁵ app ⁴⁵⁹⁵ membership ¹⁰⁴⁴²	North-Holland → Amsterdam ⁴¹²⁵³
oliveo.nl	Oliveo	Field 3 is being completely renovated to improve the quality.	Sports Clubs → Football Clubs ⁴⁶⁷ Associations → Sports Associations ¹⁰⁸²	football ¹³⁴⁷ association ⁸⁵⁶² news ¹⁵²⁹³	South-Holland → Pijnacker-Nootdorp ¹⁴³³
rksvnuenen.nl	RKSV Nuenen	A significant portion of the website is dedicated to the maintenance and organization of the sports fields, including major maintenance and the scheduling of matches.	Sports Clubs → Football Clubs ⁴⁶⁷ Sports Clubs → Dutch Sports Clubs ³³⁷	football ¹³⁴⁷ trainer ¹⁹⁶⁶ volunteer ⁸³⁶⁷ member ¹⁰¹⁵⁴	North-Brabant → Nuenen ca ⁹⁰⁶
zcfc.nl	ZCFC	The website addresses the inspection of club fields by the KNVB, suggesting the club relies on a good infrastructural base.	Football → Amateur Football ⁷⁵⁷ Equestrian → Riding Clubs ²⁴⁵	membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹
mhct.nl	MHC Teteringen	Members and teams can reserve fields via the website.	Hockey → Hockey Clubs ¹¹⁸	hockeyclub ⁶⁵ clubhouse ⁷⁸⁴ match ³⁴⁷¹ membership ¹⁰⁴⁴²	Breda → Teteringen ²¹⁷
eminentboys.nl	Eminent Boys	Eminent Boys is investing in the development of the field.	Football → Amateur Football ⁷⁵⁷ Associations → Sports Associations ¹⁰⁸²	football club ⁶⁰³ commission ⁶⁰⁹ clubhouse ⁷⁸⁴	Netherlands → Utrecht ⁴⁸⁹⁰¹
vvfarmsum.nl	V.V. Farmsum	Recent improvements have been made to the main field, including widening the tile path and the major change to the main entrance.	Football → Amateur Football ⁷⁵⁷ Sports Clubs → Football Clubs ⁴⁶⁷	youth team ¹⁰² football club ⁶⁰³ sponsors ²⁶⁴²	Eemsdelta → Delfzijl ⁶¹⁵
hondenclubderoedel.nl	Hondenclub De Roedel	The club has an exercise field where the dogs can practice the skills they have learned.	Dogs → Dog Training ⁸⁸¹ Animal Care → Dog Care ¹³⁹⁸	puppy ¹³⁶⁷ trainer ¹⁹⁶⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸
rkvveli.nl	RKVV E.L.I.	The website mentions that major maintenance is being carried out on the fields and the sports park is closed.	Hockey → Hockey Clubs ¹¹⁸ Team → Cricket ⁵⁹	sponsorship ²⁶⁸⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Laarbeek → Lieshout ¹⁶⁵
schoevers.nl	Schoevers	The training offerings are divided into different fields, such as event management and HRM.	Vocational Training → MBO ⁶⁹⁰	employer ²³⁸³ course ¹⁴⁷²⁸ training ²⁸¹³³
vertaalbureau.nl	Vertaalbureau.nl	Vertaalbureau.nl delivers in dozens of fields.	Translation → Translation Agencies ¹⁰ Translation → Language Translation ²⁸⁸	translation ¹⁵²³ language ²⁰¹⁶ technology ⁶⁸¹⁶ brand ¹⁷⁷³⁷
hondenschoolrinusbiemans.nl	Hondenschool Rinus & Ilona Biemans	The dog school has fully enclosed and illuminated training fields.	Dogs → Dog Training ⁸⁸¹ Animal Care → Dog Care ¹³⁹⁸	pup ⁶⁵ dog school ¹¹⁴ instructor ³¹²⁶ course ¹⁴⁷²⁸
medicamerkus.nl	Lustig & Merkus	MedicaMerkus offers translations for a wide range of (para)medical fields.	Culture → Science ⁵²⁶¹ Health → Medical Care & Services ²⁹⁴⁶¹	translator ¹⁶⁹ budget ¹³³⁵ translation ¹⁵²³
touchofmatrix.nl	Samaya	The field is described as the place where body, emotions, and consciousness come together and where the method works, through attunement to this energy.	Buddhism → Practices ⁶⁴ Alternative Medicine → Energy Medicine ⁹⁸⁸	method ¹⁵⁰⁵ therapist ¹⁸⁹⁰ training ²⁸¹³³
bekerhofgroepsaccommodatie.nl	Bekerhof Groepsaccommodatie	There are two large sports fields available for guests.	Accommodation → Group Accommodation ⁸⁴⁴ Animals → Exotic Animals ¹⁴	wifi ¹³⁷² farm ²⁶²² accommodation ⁴⁹²¹	Leudal → Hunsel ⁴⁰
gemeentebanen.nl	Gemeentebanen.nl	Users can filter job postings by specific fields.	Government & Administration → Public Sector ³¹⁹	keyword ²⁸⁰ government ⁸²⁷ region ⁵⁴¹² vacancy ⁶⁵⁹⁸ municipality ⁶⁸³⁷	Westland → Naaldwijk ⁹⁰³
auteurscollege.nl	Auteurscollege	Writing a book can increase an entrepreneur's authority within their field.	Writing → Writing Coaching ⁵⁸	methodology ³³² marketing ⁷¹⁰⁷ book ¹¹³⁹⁶
alnn.nl	Agrarisch Laboratorium Noord-Nederland B.V.	ALNN has a program to map and sample field boundaries via the RVO.	Livestock → Dairy Farming ⁶⁷¹	manure ²¹¹ sample ⁴¹⁸ soil ⁹³⁰ analysis ¹⁶¹⁵
graangeluk.nl	GraanGeluk	The website describes the restoration and revitalization of farmland, aiming to improve the soil and nature.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷ Environment → Agriculture ¹¹¹⁶⁰	grain ¹⁹² bread ¹⁶²² beer ²⁸⁸⁷ nature ⁹⁰⁹⁴
asvarsenal.nl	A.S.V. Arsenal	The club has 2 artificial turf fields.	Sports Clubs → Football Clubs ⁴⁶⁷	football club ⁶⁰³ youth ³¹²⁶ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
vlechterij.nl	De Vlechterij	De Vlechterij sources part of its willow from its own willow fields, which it processes itself.	Crafts → Weaving ⁹⁵ Garden → Fences ⁸²⁴	willow ²⁵ custom-made ¹⁷⁶ basket ²⁷⁵ screen ¹⁴³⁸
btsrotterdam.nl	Vertaalbureau BTS Rotterdam	The services are tailored to specific fields.	Communication → Interpreting ²⁶⁵ International → International Communication ²⁴	interpretation ⁹⁵ translation ¹⁵²³ text ²⁴⁶⁷ certification ³³⁸⁰ communication ¹⁰¹⁶²
resultaatgroep.nl	ResultaatGroep	The website highlights the various IT fields in which ResultaatGroep specializes.	Online Services → Job Boards ¹⁰³⁶ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	thread ¹⁰⁷ assignment ¹¹²¹ candidate ¹⁸⁹⁶ result ¹⁹⁰²
mvcwoerden.nl	Model Flying Association Woerden	The club has a flying field with a specific size and optimal conditions for model flying.	Hobbies → Model Building ¹⁰⁰⁷ Shooting → Archery ²⁵⁹	brevet ¹⁰ friendship ⁴³¹ instructor ³¹²⁶ model ³⁵⁴⁶ event ⁴⁵¹⁹⁹	Utrecht → Woerden ²⁶⁴²
acker-lodges.nl	Acker Lodges	The lodges are located in the Drenthe countryside, offering a peaceful and idyllic setting.	Europe → France ¹⁰⁴¹ Outdoor & Recreation → Group Activities ⁵⁰⁹	overnight ⁷⁰ lodge ³⁴⁰ holiday house ⁴⁰² nature ⁹⁰⁹⁴	Netherlands → Drenthe ²⁰⁰⁶²
renovatieprofs.nl	Inspired Media	Renovatieprofs provides information about diverse fields within the renovation industry.	Online Services → Job Boards ¹⁰³⁶ Building & Construction → Sustainable Building ¹⁰⁰⁴	architect ⁶⁰⁹ theme ⁴⁰¹⁵ blog ¹³³⁹² renovation ¹³⁸⁴⁹
doggiedog.nl	DOGGIEDOG	DOGGIEDOG organizes play areas on large, enclosed fields for the dogs.	Animal Care → Dog Care ¹³⁹⁸	pack ¹⁸⁵ daycare ¹³⁶⁵ forest ¹⁴¹⁸ walk ²¹⁶¹ dog ⁵⁴⁸³	North-Holland → Amsterdam ⁴¹²⁵³
wesstar.nl	Korfbalvereniging Wesstar	The club has its own field in Westervoort where training and matches take place.	Sports Clubs → Local Clubs ²⁴ Team Sports → Korfbal ⁴⁰⁶	korfbalvereniging ¹³ member ¹⁰¹⁵⁴	Gelderland → Westervoort ⁴⁰⁴
blokhutbergenbos.nl	Scoutinggroep SWIII/LBP	A field next to the hut where scout groups can set up their tents and camp.	Youth Organizations → Scouting ¹⁰⁰⁴ Accommodation → Cabins ²³¹	hut ¹¹⁷ scouting ⁸⁶⁰ forest ¹⁴¹⁸ camp ²⁴⁶⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
twentefruit.nl	TwenteFruit	Visitors can pick fruit directly in the fields.	Fruit & Orchard Management → Fruit Production ¹⁹ Events & Activities → Agricultural Activities ²⁵	raspberry ³¹ strawberries ¹⁷² fruit ¹¹⁶⁶ arrangement ³¹⁰⁴	Dinkelland → Denekamp ³⁷⁵
wilkens.nl	Vertaalbureau Wilkens	Vertaalbureau Wilkens understands the client's field well and can provide an optimal translation service.	Translation → Language Translation ²⁸⁸ Legal → Legal Aid ⁴²⁰	interpreter ²¹⁷ writing ¹⁵⁰⁴ translation ¹⁵²³ document ¹⁶⁷⁸
modelvliegclub.nl	Modelvliegclub The Flying Dutchman	The club has a large field of 1 hectare in Bruchem, with an artificial turf landing strip.	Model Aviation → Model Flying Clubs ⁴⁷	model flying ²² clubhouse ⁷⁸⁴ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Zaltbommel → Poederoijen ⁵⁶
paintballcentrumdeunit.nl	Paintballcentrum De Unit	The area where paintballing takes place is divided into 6-7 fields based on popular computer games such as King of the Hill.	Shooting → Paintball ⁴⁰ Family Activities → Day Trips ⁴¹⁹	paintball ⁷¹ arrangement ³¹⁰⁴ equipment ⁴¹⁴³	Zevenaar → Babberich ¹³⁵
fransevertalingen.nl	FranseVertalingen	The translation agency works with native speakers specialized in various fields.	Translation → Language Translation ²⁸⁸	word ⁵⁶⁷ target audience ¹¹⁰⁸ translation ¹⁵²³ document ¹⁶⁷⁸ order ⁶⁹¹²
gonnieleguijt.nl	Gonnie Leguijt	The website consistently refers to ‘fields’, indicating the concept of energetic fields and potential connections with ancestors and wisdom.	Spirituality → Eastern Spirituality ⁶³	oracle ⁹⁷ council ⁴²⁶ ritual ⁵⁰⁶ code ⁵⁰⁹ transformation ¹⁰⁸¹
erfemissiescan.nl	Broos	The Perceelemissiescan analyzes field properties, such as soil structure and slope, to locate emission sources.	Environmental Services → Environmental Monitoring ⁴² Agriculture → Agricultural Technology & Innovation ⁷⁴³	emission ¹³⁰ scan ⁷⁹⁰ soil ⁹³⁰ farm ²⁶²²
boerderijvanrijn.nl	Boerderij van Rijn	The fresh products come from its own fields in Woubrugge, where the farm grows with care.	Agricultural Tourism → Agricultural Recreation ¹⁰⁵ Food → Local & Regional Products ⁹³⁰	regional products ³⁹¹ fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶ opening hours ²⁹⁵³ history ⁷²⁸⁶	Kaag en Braassem → Woubrugge ¹²⁴
bresadvocaten.nl	Bres Advocaten	Bres Advocaten is specialized in various legal fields, such as labor law and real estate law.	Civil Law → Litigation ¹³⁸ Law → Commercial Law ⁶⁶⁰	case ¹¹⁵³ lawyer ²⁶⁸³
raccourci.nl	Raccourci	The translation services are divided into various fields, such as legal, medical, and technical.	Legal → Sworn Translators ¹²	interpretation ⁹⁵ translation ¹⁵²³ brochure ¹⁶⁴²
werkenbijwshd.nl	Hollandse Delta Waterboard	The Hollandse Delta Waterboard operates in various fields of expertise, such as building management and environmental advice.	Nature Conservation → Water Management ¹¹³⁸	waterboard ¹⁸ work ³¹²² employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸
select.nl	Select	Select has expertise in diverse fields such as construction, metal, transportation and cleaning.	Jobs → Vacancies ¹⁰⁹⁹ Customer Service → Outsourcing ⁵¹¹	temporary worker ⁶³ vacancy ⁶⁵⁹⁸ training ²⁸¹³³
dtafortius.nl	a.s.v. DTA Fortius	The club has 3 fields, 2 of which are artificial turf.	Sports Clubs → Dutch Sports Clubs ³³⁷	referee ⁷⁹ youth ³¹²⁶ club ⁴²²⁵	North-Holland → Amsterdam ⁴¹²⁵³
hcm-montfort.nl	Hippisch Centrum Montfort	From the field of the center, an adventurous riding route can be followed.	Equestrian → Riding ¹³⁶	equestrian ¹³⁸ rider ⁵⁹⁴ training ²⁸¹³³ event ⁴⁵¹⁹⁹	Roerdalen → Montfort ⁸⁶
johndewolfsportfoundation.nl	John de Wolf Sportfoundation	Recently, the foundation opened a new field in Maarssen, with support from the National Sports Fund.	Social Organization → Child Welfare ¹¹⁴⁷ Youth → Youth Sports ⁸³	donation ⁵¹¹⁰ child ¹¹⁵⁶⁶ workshop ¹⁹³²⁵	Stichtse Vecht → Maarssen ¹⁰⁵¹
zwsrecruitment.nl	ZWS Recruitment	ZWS Recruitment specializes in various fields, including Finance, IT, and Legal.	HR Services → Technical Recruitment ⁴⁷⁴ HR Services → Specialized Recruitment ²⁰⁹	position ⁸⁷⁵ employer ²³⁸³ match ³⁴⁷¹ talent ³⁹⁸⁷ network ¹¹¹²³	Flevoland → Almere ⁷⁷⁶⁵
brendakapiteijn.nl	Brenda Kapiteijn	The website specifies various fields where she has experience, such as business and law.	Communication → Interpreting ²⁶⁵ Collaboration & Networking → International Business ¹⁶⁰	interpretation ⁹⁵ translator ¹⁶⁹ document ¹⁶⁷⁸ text ²⁴⁶⁷ network ¹¹¹²³
easydog.nl	Easydog Dog Walking Service	The company has a fenced private field where dogs can play and exercise extensively.	Dog Care → Dog Walking Service ³⁵⁶	the hague ³¹² walk ²¹⁶¹ dog ⁵⁴⁸³	Delft → Buitenhof ¹³
caravanstalling-noordwolde.nl	Noordegraaf Caravan- and Camper Stalling	The field has an area of 750 m² and serves for temporary storage and parking.	Caravans → Caravan Storage ¹⁴⁵	caravan ¹³⁹⁴ camper ¹⁵⁹⁶ facility ²⁶¹⁶	Het Hogeland → Noordwolde ¹⁵²
buitenbeachvolleybal.nl	Buiten! Beachvolleybal	Volleyball fields and stages are rented.	Beach Sports → Beach Volleyball ¹¹⁶	sponsor ¹¹⁵⁹ tournament ²⁴⁷⁶ beach ³²¹⁰ results ³⁹⁵⁴ newsletter ⁶⁵⁰⁴	Oldambt → Blauwestad ⁷⁷
campingzierikzee.nl	Camping Zierikzee	The campsite has large, green fields suitable for campers.	Camping → Campsites Netherlands ⁷⁹² Accommodation → Bungalow Rental ¹⁸	bungalow ⁶⁸⁷ campsite ²⁰⁹³ accommodation ⁴⁹²¹ family ⁶⁴⁶² volunteer ⁸³⁶⁷	Zeeland → Schouwen-Duiveland ²⁰¹⁰
hesko.nl	Hesko	Assignments are classified based on the freelancer's specific field.	HR Services → IT Recruitment ⁴⁴⁷ HR Services → Intermediaries ¹⁴⁰	freelancer ⁸⁷⁷ assignment ¹¹²¹ construction ⁷⁴²¹ network ¹¹¹²³	South-Holland → Rotterdam ²⁵⁰⁴⁸
solyne.nl	Solyne	Solyne connects professionals with fields such as civil engineering and environmental science.	HR Services → Technical Recruitment ⁴⁷⁴ Sport Facility → Sports Fields ¹⁵²	job ²⁷⁹⁵ network ¹¹¹²³
hofilpenstein.nl	Hof Ilpenstein	The extensive fields surrounding Hof Ilpenstein offer a beautiful view and a peaceful environment.	Accommodation → Holiday Homes ⁷²⁷ Accommodation → Country Estates ⁷³⁸	orchard ²⁴⁰ castle ⁴⁹⁴ farmhouse ⁸⁷⁸ event ⁴⁵¹⁹⁹	Waterland → Ilpendam ⁷⁸
dennedune.nl	Anja & Richard van der Veen	The campsite consists of two fields, each with its own character.	Campsites → Campsites in The Netherlands ¹⁹	farmstead ⁷³ dune ⁶¹¹ campsite ²⁰⁹³	Friesland → Terschelling ¹⁰³⁴
vvvdelta.nl	VVV Delta	The association has new beach volleyball fields where clinics and workshops are held.	Team Sports → Volleyball ⁸⁴²	beach volleyball ⁷⁴ announcement ¹¹⁵ volleyball ⁶¹⁷ membership ¹⁰⁴⁴² training ²⁸¹³³	Texel → Den Hoorn ³³³
pharosregistry.nl	PharosRegistry.nl	A magnetic field is an invisible zone around a magnet where magnetic forces are active.	Physics → Electromagnetism ²⁵ Technology → Electronics & Components ¹¹²⁶¹	force ²⁰ magnetism ²⁵ magnet ¹²⁷ technology ⁶⁸¹⁶
themeetinn.nl	The Meetinn	The stunning views of the fields offer a tranquil and inspiring setting.	Accommodation → Country Estates ⁷³⁸ Conferences & Meetings → Meeting Venues ⁷²⁹	guest room ¹¹² barn ²⁸² heat pump ²⁵⁴¹ solar panels ⁴⁷⁰¹	De Ronde Venen → Waverveen ⁵⁸
dozend.nl	Dozend	Dozend focuses on finding professionals with expertise in diverse fields, such as mathematics and geography.	HR Services → Technical Recruitment ⁴⁷⁴ Business & Management → Educational Consulting ⁵⁶¹	detachment ²⁶⁶ candidate ¹⁸⁹⁶ professionals ¹⁹⁶⁶ staff ³⁴⁰⁵ education ¹³⁴⁷¹	Overijssel → Zwolle ⁷³⁹⁵
spinners.nl	Spinners	The website mentions specific fields within the financial services industry, such as banks, insurance companies, and housing corporations.	Career → Career Development ¹⁰⁷⁰ HR Services → Technical Recruitment ⁴⁷⁴	ambition ⁵⁷⁶ assignment ¹¹²¹ career ²⁵¹³ growth ⁴⁰⁵⁴
vurich.nl	Vurich	Through Vurich, I have been able to look at my own field with entirely different eyes.	Legal → Lawyers ⁷⁰⁸ Governance → Law ¹⁴¹³³	justice ¹²³ legislation ⁵⁹³ lawyer ²⁶⁸³
carriereinbrabant.nl	Carriere in Brabant	Users can find vacancies in their specific field, such as ICT or hospitality.	Jobs → Vacancies ¹⁰⁹⁹ Online Services → Job Boards ¹⁰³⁶	jobalert ⁴⁷ industry ¹⁷⁸⁰ employer ²³⁸³ career ²⁵¹³ vacancy ⁶⁵⁹⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
airsoftbrothers.nl	Airsoft Brothers	The website emphasizes that Airsoft Brothers has an attractive airsoft field.	Shooting → Paintball ⁴⁰ Shooting → Airsoft ⁵⁹	airsoft ⁶⁷ outing ⁹⁸² membership ¹⁰⁴⁴²	Netherlands → Limburg ³¹⁹⁰⁹
aviabanen.nl	Aviabanen	The jobs are sorted by specific fields, such as marketing, communication, engineering, and travel agent.	Online Services → Job Boards ¹⁰³⁶ Air Services → Aviation ⁴⁴⁴	job board ⁶³ candidate ¹⁸⁹⁶ job ²⁷⁹⁵	Haarlemmermeer → Schiphol ²¹⁶³
csg-bv.nl	Central Services Geldermalsen	The various fields in which CSG operates include cleaning, security, and waste processing.	Construction & Maintenance → Procurement ⁵⁶⁷ Legal → Legal Issues ⁵⁶	contract management ²¹⁰ consulting ³⁶³⁹ collaboration ¹⁶⁰³⁶
insideoisterwijk.nl	Oisterwijk Nieuws	The many football fields in the area offer the opportunity to try out new nets.	Combat → Badminton ⁷⁰² Sport Facility → Sports Fields ¹⁵²	footballer ⁵³ net ¹⁰⁷ shop ⁶⁴⁸³	North-Brabant → Oisterwijk ¹⁴²²
ghadvocaten.nl	GH Advocaten	GH Advocaten offers legal assistance in various legal fields, highlighting the breadth of their expertise.	Law → Legal Profession ¹³⁹ Legal → Lawyers ⁷⁰⁸	case ¹¹⁵³ lawyer ²⁶⁸³ collaboration ¹⁶⁰³⁶	Land van Cuijk → Boxmeer ⁸⁶¹
mbuma.nl	Dutch Mbuma Mission Foundation	The Mbuma mission supports the development of various fields in Zimbabwe.	Nonprofits → International Development ⁴²⁰ Religion → Christian ²⁶	mission ¹⁰⁰⁰ magazine ²¹⁸² foundation ⁶⁶⁷⁸ school ⁷⁸⁵⁶ community ⁷⁹³¹	West-Betuwe → Haaften ⁸⁵
hetwijdeland.nl	Het Wijdeland B&B	The B&B is situated between fields, allowing guests to fully enjoy nature.	Accommodation → Holiday Homes ⁷²⁷ Accommodation → Country Estates ⁷³⁸	hot tub ²⁶⁰ farmhouse ⁸⁷⁸ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Zwartewaterland → Hasselt ⁴⁹⁰
vdpi.nl	VDPI	The VDPI has a proactive stance and is actively involved in the field of DJI.	Organizations → Professional Associations ¹⁰⁰⁴ Government & Administration → Justice ⁵¹	dji ¹⁷ advocacy ³⁵⁷ director ⁷¹⁶ member ¹⁰¹⁵⁴
bcbumpers.nl	BC Bumpers	The club emphasizes that passion and fun are important both on and off the field.	Team Sports → Basketball ²⁴⁴ Combat → Badminton ⁷⁰²	sponsorkliks ⁵³ basketball ¹⁷⁵ training ²⁸¹³³
modelvliegclubicarus.nl	Modelvliegclub Icarus	For outdoor flying, there is a large field on Kaapstadweg.	Hobbies → Model Building ¹⁰⁰⁷ Outdoor Activity → Model Aviation ⁷⁷	flying club ¹⁴ gym hall ⁴⁷ fly ¹⁴³ building ³²⁰⁴ model ³⁵⁴⁶	North-Holland → Amsterdam ⁴¹²⁵³
basiscursusoncologie.nl	NVvO Basiscursus Oncologie	The course focuses on various fields within oncology, from biomedical to psychosocial.	Medicine → Oncology ²³⁰ Adult & Continuing Learning → Medical Training ⁶⁷	congress ⁵⁰⁰ registration ⁴³⁶⁶ newsletter ⁶⁵⁰⁴ course ¹⁴⁷²⁸	North-Brabant → Vught ¹²³⁰
scopesamenopleiden.nl	Scope	Collaboration with the field is a key pillar of Scope's approach.	Relationships → Partnerships ⁴⁸¹ Primary Education → Christian Education ⁴⁴⁶	academy ⁵⁹³ partnership ¹⁴⁰⁷ teacher ²⁸⁹⁰ education ¹³⁴⁷¹ training ²⁸¹³³	Overijssel → Zwolle ⁷³⁹⁵
pauljanse-vertaling-en-tekstdiensten.nl	Paul Janse Translation and Text Services	The translator describes various fields in which he has expertise, such as science, travel, and art.	Services → Translators ²⁷ Communication & Content → Translation ¹⁰⁵³	editing ¹³³⁸ translation ¹⁵²³ text ²⁴⁶⁷ portfolio ⁶⁸⁵⁴
zorgboerderijdemaashof.nl	Zorgboerderij de Maashof	There is a sports field present at the facility, giving residents opportunities for exercise.	Social Issues & Welfare → Disability Services ⁹⁴⁹ Food → Local & Regional Products ⁹³⁰	label ⁸¹⁹ facility ²⁶¹⁶ care ¹²³³⁸ garden ¹³¹²⁹	West-Maas en Waal → Maasbommel ⁶¹
hsvdedoordouwers.nl	De Doordouwers	Training sessions take place on a large grass field of approximately 1 hectare.	Dogs → Dog Clubs ²⁰ Dogs → Dog Activities ⁶⁰	method ¹⁵⁰⁵ club ⁴²²⁵ dog ⁵⁴⁸³ training ²⁸¹³³	Opsterland → Tijnje ⁴⁶
barefootpaarden.nl	Vereniging Barefootpaarden	Horses reside in a field with various routes and terrains.	Horses → Horse Care ⁴⁸⁸	arena ¹²⁴ movement ²³⁰⁴ facility ²⁶¹⁶ horse ⁴³³⁷ association ⁸⁵⁶²	Kaag en Braassem → Woubrugge ¹²⁴
corrydejong.nl	Corry	She invites people to expand their energy fields with her.	Buddhism → Practices ⁶⁴ Spirituality → Spiritual Guidance ²²⁶	frequencies ⁴⁸ transformation ¹⁰⁸¹ healing ¹¹⁴⁸ energy ⁹⁰⁷⁵ coach ²⁵⁸¹⁰
hoog-zuthem.nl	Fedelta Media	The campsite has several camping fields, suitable for caravans, campers and tents.	Camping → Campsites Netherlands ⁷⁹² Accommodation → Bungalow Rental ¹⁸	bike route ⁷⁸ event location ¹¹⁰ bungalow ⁶⁸⁷ camp ²⁴⁶⁶	Overijssel → Zwolle ⁷³⁹⁵
footy.nl	Footy	Users can rent fields for their matches.	Sports Activities → Football ⁴¹⁴⁴	league ⁹⁹ football ¹³⁴⁷ result ¹⁹⁰²	Leidsche Rijn → Leidsche Rijn-South ²⁹
baanindereiswereld.nl	Reiswerk	The website describes the different fields available within the travel industry.	Online Services → Job Boards ¹⁰³⁶ Planning → Travel Industry ¹⁹	career ²⁵¹³ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸
zuidschalkwijkerweg14.nl	Boonstra	The plot also includes a field.	Houses → Semi-Detached Houses ⁷⁵¹ Garden → Fences ⁸²⁴	shed ⁶³⁰ plot ¹⁰⁵¹ house ⁸¹²¹	North-Holland → Haarlem ⁸⁶⁷⁴
tikitakaleague.nl	Tiki Taka League	The matches take place on the fields of Rigtersbleek in Enschede.	Competitions → Team Competitions ¹⁸	results ³⁹⁵⁴ competition ⁴⁷⁵⁹ blog ¹³³⁹²	Overijssel → Twente ²⁵⁷⁸
ballenkar.nl	Ballenkar.nl	The ball cart makes it possible to easily take the balls to the field.	Apparel → Sporting Goods ¹³⁷⁴	aluminum ¹¹⁹⁷ club ⁴²²⁵ assortment ⁷⁷⁹⁹
debiequickvoetbaldagen.nl	De Bie Quick	Participants practice technical skills on the large inflatable field.	Sports Activities → Football ⁴¹⁴⁴	quiz ⁷¹⁰ football ¹³⁴⁷ trainer ¹⁹⁶⁶ registration ⁴³⁶⁶	Netherlands → Zeeland ¹⁵⁴⁹³
drenthebeach.nl	Beach Volleybal Vereniging Drenthe Beach	The association has six professional volleyball fields.	Beach Sports → Beach Volleyball ¹¹⁶ Beach Life → Beach ⁵³²	volleyball ⁶¹⁷ trainer ¹⁹⁶⁶ terrace ⁴⁸⁴⁷ member ¹⁰¹⁵⁴	Westerveld → Dwingeloo ³⁹²
echtsnel.nl	Echt Snel	The website offers jobs within various fields, allowing job seekers to determine their ideal career path.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	jobseeker ³⁰⁰ job ²⁷⁹⁵ employee ⁴⁴²⁹
vandenboschmediation.nl	Van den Bosch Mediation	The website describes various fields where mediation services are offered, including workplace conflicts and environmental law.	Humanistic Approaches → Relationships ¹⁸⁷⁷ Mediation → Conflict Resolution ⁶⁹⁹	interest ⁹¹¹ conflict ¹²⁹⁰ result ¹⁹⁰² party ⁵⁹²⁸ communication ¹⁰¹⁶²	Overijssel → Zwolle ⁷³⁹⁵
mauricevanderwiltvoetbalacademie.nl	Maurice van der Wilt Football Academy	The training and parties take place on sports fields in the Hilversum, Baarn and Eemnes region.	Football → Youth Football ²⁰²	football ¹³⁴⁷ youth ³¹²⁶ training ²⁸¹³³	Utrecht → Eemnes ⁷²⁹
obsdeharpoen.nl	OBS De Harpoen	The school has a view of the Wormer and Jisper fields.	Primary Education → Christian Education ⁴⁴⁶ Primary Education → Catholic Primary Education ³⁸⁰	trust ¹¹⁴⁷ municipality ⁶⁸³⁷ student ⁷⁶²³ school ⁷⁸⁵⁶ collaboration ¹⁶⁰³⁶	Wormerland → Jisp ⁴²
evcdirect.nl	EVC Direct	The EVC pathways are focused on specific fields such as youth care or social care.	Higher Learning → Higher Vocational Education ⁸⁴	evc ³⁵ pathway ⁴⁴⁷ diploma ⁷⁹⁵ portfolio ⁶⁸⁵⁴
animalcarealmere.nl	Animal Care Almere Hondenschool	There are three separate fields, each under the supervision of the staff, to provide the dogs with enough space and attention.	Dogs → Dog Activities ⁶⁰ Animal Care → Dog Care ¹³⁹⁸	playground ¹⁰⁸⁸ dog ⁵⁴⁸³ photography ⁹⁵⁰³	Flevoland → Almere ⁷⁷⁶⁵
hondenschoolfunfor2.nl	Hondenschool Fun for 2	The dog school has two fields of 276m² and ± 600m² for outdoor training.	Dogs → Dog Training ⁸⁸¹	hall ¹⁷⁸⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸ training ²⁸¹³³	Overijssel → Hardenberg ²³⁰⁹
justes4dogs.nl	Just Es 4Dogs	The description of the large, natural field where dogs are walked is an important part of the website.	Dog Care → Dog Walking Service ³⁵⁶ Dogs → Dog Training ⁸⁸¹	dog walking service ¹⁷⁰ puppy ¹³⁶⁷ walk ²¹⁶¹ dog ⁵⁴⁸³ training ²⁸¹³³	Amsterdam → South ¹⁴⁸⁸
slaraek.nl	Kaatsvereniging Sla Raek	The website mentions the location of the kaats field in Broeksterwoude.	Dog Care → Dog Walking Service ³⁵⁶	kaats ³⁰ senior ¹¹⁵ youth ³¹²⁶ club ⁴²²⁵ event ⁴⁵¹⁹⁹	Dantumadiel → Broeksterwâld ³¹
jeroenscholten.nl	Boomkwekerij Jeroen Scholten b.v.	Additionally, the nursery has a container field of 25,000 m².	Plants → Shrubs ¹⁴¹ Plants → Nurseries ¹⁰¹²	term ²⁵¹ greenhouse ⁷⁴⁰ plant ⁴⁵⁰⁹	Dinkelland → Deurningen ¹²¹
onlinecoachonthejob.nl	Online coach on the job	The Online Work Field provides an extensive collection of relevant topics.	Jobs → Vacancies ¹⁰⁹⁹	manager ³⁰² balance ⁴⁵⁸²
beeveestrand.nl	BeeVeeStrand	BeeVeeStrand has 10 professionally equipped and illuminated courts.	Beach Sports → Beach Volleyball ¹¹⁶ Sports → Sport Facility ⁴⁸⁶⁷	beach volleyball ⁷⁴ tournament ²⁴⁷⁶ community ⁷⁹³¹ membership ¹⁰⁴⁴² training ²⁸¹³³	Amsterdam → Nieuw-West ⁸⁴⁴
dehoogepolder.nl	B&B De Hooge Polder	Guests can view the fields through the large window and hear the bird songs.	Water Sports → Water Recreation ⁵⁹⁹ Nature → National Parks ⁸⁹⁸	canoe ²⁶⁹ comfort ¹⁴⁷³ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴	Drimmelen → Biesbosch ³¹³
ivy-pro.nl	IVY Pro	IVY Pro offers recruitment within diverse fields such as Finance, Legal, and Technology.	Networking & Collaboration → Regional Businesses ⁴¹ HR Services → Intermediaries ¹⁴⁰	position ⁸⁷⁵ professionals ¹⁹⁶⁶ culture ³⁹²² network ¹¹¹²³
pompoenplukdagengroningen.nl	Company	Visitors pick the pumpkins from the picking field.	Family Fun → Family Activities ¹⁴⁹³ Sports & Auto → Agricultural Events ¹¹⁸	pumpkin ⁶³ regional products ³⁹¹ market ²⁷⁷² child ¹¹⁵⁶⁶
klaasloopt.nl	Klaasloopt	It describes the possibility of camping on a field behind a pub.	Cafes → Brown Cafés ⁵⁹⁹ Venues → Party Venues ³⁶³	bartender ³² pub ¹⁸⁵ question ²²⁶¹
hondenherder.nl	The Hondenherder	Activities take place on a large, fenced field.	Dog Care → Dog Walking Service ³⁵⁶	walk ²¹⁶¹ meeting ²³⁸¹ food ³⁸⁷² dog ⁵⁴⁸³	Tynaarlo → Vries ¹⁶⁸
brouwersdambeach.nl	brouwersdambeach.nl	The field measures 8 by 16 meters.	Team Sports → Volleyball ⁸⁴²	rule ⁶¹ beach volleyball ⁷⁴ ball ²⁸⁶	Schouwen-Duiveland → Scharendijke ¹⁰³
winterwaterpolotoernooi.nl	PSV Winterwaterpolo Tournament Dorke	Six fields will be used for the matches.	Sports Clubs → Water Polo ²¹⁹	date ¹¹¹² tournament ²⁴⁷⁶ match ³⁴⁷¹ registration ⁴³⁶⁶ association ⁸⁵⁶²	North-Brabant → Eindhoven ¹¹⁸⁴⁵
boomkwekerijverbro.nl	Boomkwekerij Verbro	On a 2.5 hectare container field they produce more than 400,000 potted plants.	Plants → Shrubs ¹⁴¹ Plants → Trees ³⁰⁴	shrubs ¹⁴⁸ nursery ⁹²⁶ container ¹⁷⁰⁹ assortment ⁷⁷⁹⁹	Zundert → Rijsbergen ²³⁸
marnicwerkt.nl	Marnic Werkt	The website presents an overview of various fields of expertise where Marnic Werkt offers jobs, such as construction and cleaning.	Online Services → Job Boards ¹⁰³⁶ Economy → Employment & Labor ⁶⁰⁵⁹	job satisfaction ¹⁷² recruitment agency ²⁵⁸ person ⁴⁴⁸ candidate ¹⁸⁹⁶ job ²⁷⁹⁵	Dijk en Waard → Heerhugowaard ²⁰¹¹
kunstgolf.nl	kunstgolf	The event is held on a large outdoor field.	Accommodation → Country Estates ⁷³⁸ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	boerderij ¹⁵ tent ¹³²⁸ lunch ¹⁵³⁴ artist ⁵⁷⁴⁵	Schouwen-Duiveland → Burgh-Haamstede ⁴⁰¹
deecoo.nl	DEECOO	The website presents the various technical fields in which DEECOO is active.	HR Services → Technical Recruitment ⁴⁷⁴	job openings ¹¹⁰ placement ²²¹	Meierijstad → Veghel ¹²⁸⁸
onlytalent.nl	Only Talent	The website describes various fields in which Only Talent focuses, such as Banking & Insurance and IT.	HR Services → Technical Recruitment ⁴⁷⁴ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	salary ⁵¹³ assignment ¹¹²¹ talent ³⁹⁸⁷	North-Holland → Amsterdam ⁴¹²⁵³
kvelburg.nl	KV Elburg	The website lists multiple korfbal fields, each named and designated for specific teams.	Team Sports → Korfbal ⁴⁰⁶ Combat → Badminton ⁷⁰²	korfbal ¹⁸² hall ¹⁷⁸⁶ board ³⁴³⁸ match ³⁴⁷¹ membership ¹⁰⁴⁴²	Gelderland → Elburg ⁸⁴⁶
alpacasindewolligeweide.nl	Alpacaboerderij De Wollige Weide	The picnic and high tea take place in the field alongside the alpacas.	Animals → Exotic Animals ¹⁴ Food → Local & Regional Products ⁹³⁰	picnic ⁷⁹ alpaca ¹¹³ high tea ⁵⁸⁵ animal ²⁹⁰⁸	Koggenland → Avenhorn ¹¹³
veltlineinterieurbouw.nl	Veltline interieurbouw	Veltline interieurbouw has more than 25 years of experience in the interior construction field.	Relationships → Partnerships ⁴⁸¹	kitchen ⁶⁴⁴³ interior ⁸⁰⁹³ appointment ¹³⁵¹⁰	Utrecht → Veenendaal ²⁶⁴¹
advocatenkantoorvanderheiden.nl	Advocatenkantoor mr. dr. A.J.J. van der Heiden	The firm is registered for various legal fields, such as criminal law and psychiatric law.	Legal → Lawyers ⁷⁰⁸ Legal → Legal Aid ⁴²⁰	firm ⁴⁴² case ¹¹⁵³ law ¹³²⁹ lawyer ²⁶⁸³	North-Holland → Den Helder ¹⁸⁸⁶
rassports.nl	Ras Sports Equipments	The company offers materials and equipment for the layout and maintenance of sports fields.	Metals & Fabrication → Aluminum Manufacturing ²⁵ Apparel → Sporting Goods ¹³⁷⁴	sports equipment ¹⁶⁴ factory ⁵²⁶ aluminum ¹¹⁹⁷
boothuysvalkenswaard.nl	Boothuys Valkenswaard	The large event field provides ample space for various activities and groups.	Venues → Party Venues ³⁶³ Parks & Gardens → Parks ¹⁰⁴³	nature reserve ³³⁹ space ³⁸⁴⁶ event ⁴⁵¹⁹⁹	North-Brabant → Valkenswaard ¹¹⁷⁹
erikpost.nl	Erik Post Vertalingen	Erik Post has experience in a wide range of fields, including electrical engineering and private law.	Language Learning → Language Courses ⁷⁶⁹ Communication & Content → Translation ¹⁰⁵³	interpreter ²¹⁷ translation ¹⁵²³ text ²⁴⁶⁷ course ¹⁴⁷²⁸
crisisconnect.nl	V&R	The app is specifically developed for various fields, including the national government and municipalities.	Communication → PR ⁸⁷⁹ Security & Surveillance → Security ³²⁵¹	crisis ³⁵⁸ documentation ⁴⁵² app ⁴⁵⁹⁵	Eindhoven → Center ¹⁰⁸
sapcarriere.nl	SAPcarriere	The website offers information about various fields and specializations within the SAP world, such as Finance and Technology.	Business Software → ERP Systems ¹⁰⁰⁷ HR Services → IT Recruitment ⁴⁴⁷	job board ⁶³ sap ¹²⁰ newsletter ⁶⁵⁰⁴ vacancy ⁶⁵⁹⁸
starthaak.nl	De Starthaak	The club field in Heeze is located at the end of Huisvenseweg and provides ideal conditions for thermic gliding due to the surrounding nature.	Hobbies → Model Building ¹⁰⁰⁷ Blogs & Publications → Regional ²⁷²	glider ³² competition ⁴⁷⁵⁹	Heeze-Leende → Heeze ⁴⁶³
bgvertalingen.nl	BG Vertalingen	BGVertalingen is specialized in medical, legal, economic, and tax fields.	Communication & Content → Translation ¹⁰⁵³ Business Services → Legal ⁶⁹¹³	translation ¹⁵²³ text ²⁴⁶⁷ quote ¹²⁸⁶³
hvblauwwit.nl	Handbalvereniging Blauw-Wit 's-Hertogenbosch	The website provides information about the different fields where the teams play.	Associations → Sports Associations ¹⁰⁸² Team Sports → Handball ²⁴²	world cup ⁴² handball ²⁰⁹ hall ¹⁷⁸⁶ association ⁸⁵⁶²	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
hondenuitlaatservicebarbera.nl	Hondenuitlaatservice Barbera	Dogs have access to a safe and enclosed field, intended for playing and relaxation.	Dog Care → Dog Walking Service ³⁵⁶	dog walking service ¹⁷⁰ pack ¹⁸⁵ puppy ¹³⁶⁷ dog ⁵⁴⁸³	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
sports4fun.nl	Sports4Fun	The installation of a soccer field is seen as an important element in the sports development of associations.	Stories → Travel Blogs ¹⁰¹⁶	padel ⁶⁰² football ¹³⁴⁷ equipment ⁴¹⁴³ sport ⁴²²⁸ article ⁶⁰⁰⁰
louisearnoldbik.nl	Louise Arnold Bik	Louise Arnold Bik uses the concept of a field of forces to analyze and position organizations.	Systemic Approaches → Systemic Work ²⁸⁹ Corporate Events → Team Building ¹⁰⁰⁵	dynamics ¹⁷⁷ boundaries ⁵⁴⁶ goal ⁴⁹⁷⁴ coach ²⁵⁸¹⁰
kveymerick.nl	KV Eymerick Heeze	The association has its own playing and training field.	Team Sports → Field Sports ²¹ Team Sports → Korfbal ⁴⁰⁶	sportpark ⁷⁵ korfbal ¹⁸² hall ¹⁷⁸⁶	Heeze-Leende → Heeze ⁴⁶³
todo.nl	Todo Talenservice	The company is active in diverse fields, from technical to legal, applying this expertise to translation assignments.	Communication → Interpreting ²⁶⁵ Communication & Content → Translation ¹⁰⁵³	interpreter ²¹⁷ word ⁵⁶⁷ translation ¹⁵²³	North-Brabant → Waalwijk ¹⁷⁴⁴
hondenuitlaatservicekellyriezeweide.nl	Kelly Riezeweide	The service has a fenced field where dogs can safely play and run.	Dog Care → Dog Walking Service ³⁵⁶	dog walking service ¹⁷⁰ dog ⁵⁴⁸³	Haarlemmermeer → Hoofddorp ²⁷³⁹
esro80-volleybal.nl	ESRO’80 Volleybalvereniging	Beach volleyball training takes place on the field of sv CHC at Fuik 10.	Team Sports → Volleyball ⁸⁴² Sports → Sport Facility ⁴⁸⁶⁷	beach volleyball ⁷⁴ cafeteria ¹⁶⁹ volleyball ⁶¹⁷ match ³⁴⁷¹ training ²⁸¹³³	's-Hertogenbosch → Engelen ⁹⁴
kaatsclubgoutum.nl	Keatsclub Goutum	Keatsclub Goutum has two fields, one traditional and one more modern, for the practice of the sport.	Associations → Sports Associations ¹⁰⁸² Competitive Activity → Competitive Sports ⁸³	sponsors ²⁶⁴² member ¹⁰¹⁵⁴	Leeuwarden → Goutum ⁷⁶
gracecoaching.nl	Grace Coaching	The location, an expansive field, is the basis for horse coaching sessions and provides a quiet and green setting.	Outdoor → Horse Riding ⁹⁴¹ Horses → Horse Care ⁴⁸⁸	session ¹⁷⁹¹ horse ⁴³³⁷	Ede → Lunteren ⁷³⁰
dogwolluk.nl	DogWolluk	DogWolluk has an enclosed field where dogs can play and romp.	Dog Care → Dog Walking Service ³⁵⁶	fun ²⁴¹ interaction ²⁴⁵ pet ¹⁶¹⁷ walk ²¹⁶¹ dog ⁵⁴⁸³	North-Brabant → Dongen ⁸⁵¹
emvcnieuwkerk.nl	EMVC Nieuwkerk	The club’s own field on the Aalsedijk provides space for the flying adventures of its members.	Air Services → Aviation ⁴⁴⁴	model aircraft ¹² membership ¹⁰⁴⁴²	North-Brabant → Goirle ⁶⁸¹
boerderijopdehaar.nl	BOERDERIJ OP DE HAAR	The modern meeting room offers views of the quiet fields surrounding the farmhouse.	Accommodation → Country Estates ⁷³⁸ Conferences & Meetings → Meeting Venues ⁷²⁹	meeting room ⁶⁸⁵ farmhouse ⁸⁷⁸ monument ¹¹⁶⁸	Netherlands → Groningen ²³⁷³⁴
zuidplasruiters.nl	Paardensportvereniging De Zuidplasruiters	An outdoor field is also offered to members.	Fuel & Energy → Gas Stations ²⁴⁹ Apparel → Equestrian ²³¹⁹	arena ¹²⁴ gas station ²⁵² competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴²	Zuidplas → Moordrecht ³³²
burgsolar.nl	WordPress	The function allows for retrieval of individual fields within a bookmark record.	Programming Languages → PHP ⁴⁰⁰	bookmark ¹⁴ output ²⁰ cache ³⁵ database ¹¹⁵³
mvcsunflyers.nl	MVC Sunflyers	MVC Sunflyers has a flying field with a grass runway and facilities for members.	Hobbies → Model Building ¹⁰⁰⁷ Outdoor Activity → Model Aviation ⁷⁷	model flying ²² clubhouse ⁷⁸⁴ model ³⁵⁴⁶ club ⁴²²⁵
uitlaatservicekrimpenerwaard.nl	Hondenuitlaatservice Krimpenerwaard	Dogs are picked up and can run and play on a fully enclosed field.	Dog Care → Dog Walking Service ³⁵⁶ Family → Pet Services ⁵⁴	game ²⁸⁰⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Bergambacht ³⁰³
vdh-kringgroepbolsward.nl	Kringgroep Bolsward e.o.	Training takes place on fields belonging to local farmers.	Dogs → Dog Training ⁸⁸¹ Competitive Activity → Dog Sports ²²⁵	igp ²⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸ training ²⁸¹³³	Southwest-Friesland → Bolsward ⁵⁶⁶
theeventacademy.nl	The Event Academy	Participants gain a good understanding of the (future) field through the chosen courses.	Technical Services → Technical ⁹⁵⁷ Event Resources → Event Industry ¹⁷	event industry ¹⁷ flexibility ⁹⁹⁶ training ²⁸¹³³
kringgroepassen.nl	Kringgroep Assen e.o.	Members train their dogs on a large, dry, and flat field in Assen.	Dogs → Dog Training ⁸⁸¹ Competitive Activity → Dog Sports ²²⁵	german shepherd dog ¹⁴ igp ²⁶ association ⁸⁵⁶²	Drenthe → Assen ³⁵¹⁶
bretonadvocaten.nl	Breton Advocaten	Each lawyer within the office has a specific legal field, allowing them to offer the right expertise.	Law → Family ²⁹⁰⁹ Law → Commercial Law ⁶⁶⁰	law ¹³²⁹ lawyer ²⁶⁸³ appointment ¹³⁵¹⁰
borghselect.nl	Borghselect	Job vacancies are categorized by different fields, such as construction and electrical engineering.	Internships & Jobs → Internships ⁵⁵¹	candidate ¹⁸⁹⁶ recruitment ²⁰¹⁵ employer ²³⁸³ vacancy ⁶⁵⁹⁸	Overijssel → Zwolle ⁷³⁹⁵
wolderf.nl	Jet, Annet, Clarine and Ron	The location provides space for adventurous gatherings in fields.	Accommodation → Country Estates ⁷³⁸ Venues & Rentals → Venues ²⁰⁴⁴	barn ²⁸² dream ⁸⁸³ garden ¹³¹²⁹ event ⁴⁵¹⁹⁹	Noordenveld → Peize ²²⁷
varkenshandeltroost.nl	Varkenshandel Troost	The company takes into account developments in the pig trading field.	Animal Husbandry → Swine Farming ²⁷ Supply Chain & Logistics → Trade ²¹⁴¹	pig ¹⁷³ yield ²⁹² trade ⁵⁵³ knowledge ³⁵²⁸	Gelderland → Ede ⁵¹⁰⁴
beedigdvertalerfrans.nl	Vermet Vertalingen Frans & Nederlands	The translator offers services in various fields such as legal and medical translation.	Services → Translators ²⁷ Legal → Legal Translation ⁵⁹	sworn ²⁹ translator ¹⁶⁹ diploma ⁷⁹⁵
lhpvloeren.nl	LHP Vloeren Over Tegelzetter Amstelveen	With extensive experience in the field, the company can provide expert advice on the best flooring for a specific situation.	Interior → Flooring ²⁷⁹¹	laminate ⁶⁴⁰ tile ²⁸⁶⁹ floor ⁴⁷⁸¹	North-Holland → Amstelveen ³¹⁸⁰
bijdebocht.nl	Hondenschool Bij de Bocht	The training field is spacious and located in a rural area.	Outdoor → Horse Riding ⁹⁴¹ Events & Activities → Outdoor Activities ¹⁰⁴³	pony ⁴⁰⁹ dog ⁵⁴⁸³ course ¹⁴⁷²⁸ training ²⁸¹³³	Hoogeveen → Stuifzand ²⁵
bijzonderbio.nl	Stichting Bijzonderbio	The project focuses on sowing fields with the aim of increasing biodiversity.	Volunteering → Food Banks ¹⁸⁴ Insects → Bees ¹¹⁶	bees ³⁷³ donation ⁵¹¹⁰ foundation ⁶⁶⁷⁸
campingdeknotwilg.nl	SVR Camping 'De Knotwilg'	The camping is located between fields, creating a serene environment.	Camping → Minicamping ²⁴⁶ Camping → Campsites Netherlands ⁷⁹²	woods ⁷⁵ cycle ¹⁹⁰⁶ camp ²⁴⁶⁶ event ⁴⁵¹⁹⁹	Hoogeveen → Elim ⁸⁸
carriereinutrecht.nl	Carrière in Utrecht	Job vacancies are grouped by a specific field, such as Front-end development or ICT.	Job Postings → Regional Job Postings ³⁴	jobalert ⁴⁷ industry ¹⁷⁸⁰ employer ²³⁸³ career ²⁵¹³ vacancy ⁶⁵⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
christacoaching.nl	Christa Coaching	Christa Coaching offers services in various fields, allowing expertise to be applied in diverse organizations and companies.	Networking → Business Networks ³⁵⁸	leadership ³⁷²⁴ network ¹¹¹²³ coach ²⁵⁸¹⁰	North-Holland → Amsterdam ⁴¹²⁵³
dierenenzo-zuidplas.nl	Dieren-enzo	The pet care center features a large field where dogs can play and release energy.	Dogs → Dog Activities ⁶⁰ Animal Welfare → Animal Shelters ³²⁶	kennel ⁵¹³ cat ¹⁵⁷⁸ board ³⁴³⁸ dog ⁵⁴⁸³ school ⁷⁸⁵⁶	Zuidplas → Moordrecht ³³²
faesvertalingen.nl	Tolk- & Vertaalbureau Natalija Faes	The bureau specializes in interpreting and translation assignments in various fields, such as medical, legal, and commercial.	Communication → Interpreting ²⁶⁵ Legal → Legal Translation ⁵⁹	russian ²¹ sworn ²⁹ interpreter ²¹⁷ translation ¹⁵²³
gocveghel.nl	GOC Veghel	The club provides a space for entrepreneurs to share their passions and expertise within their field.	Business Events → Networking Events ²³⁵ Associations & Groups → Business Associations ¹⁰¹⁸	reception ²⁹¹ networking ⁸⁴² membership ¹⁰⁴⁴²
grenslandmenners.nl	De Grenslandmenners	The association practices on a large field in Groesbeek with facilities such as a water trough.	Equestrian → Riding ¹³⁶	helmet ²³⁶ man ⁴⁵³ rider ⁵⁹⁴	Berg en Dal → Groesbeek ⁶⁵³
henkarendse.nl	Infor	The work as a software engineer remains fascinating for Henk Arendse.	Personal Websites → About Me ²³ Computer Science → Software Engineering ⁴⁰⁴	erp system ⁸⁵ software ⁸²⁹¹ book ¹¹³⁹⁶
hondenschool-amthos.nl	Hondenschool Amthos	The school has a fenced field for most training sessions.	Dog Care → Dog Walking Service ³⁵⁶ Dog Training → Dog School ⁹³	bond ³⁴⁸ trainer ¹⁹⁶⁶ registration ⁴³⁶⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸
hondenuitlaatservicenicolette.nl	Hondenuitlaatservice Nicolette	The service has a fenced field and a large meadow where dogs can play freely.	Dog Care → Dog Walking Service ³⁵⁶	dog walking service ¹⁷⁰ walk ²¹⁶¹ dog ⁵⁴⁸³ nature ⁹⁰⁹⁴	Westerkwartier → Zevenhuizen ⁴⁶⁰
ideemeesters.nl	Ideemeesters	Ideemeesters combines knowledge from various fields to create innovative solutions.	Consulting → Innovation Consulting ¹⁷⁷ Architecture & Design → Creative Industries ¹¹⁵⁷	problem ²²¹⁴ idea ²³⁶⁷
jpfjuristen.nl	JPF Juristen	JPF Juristen specializes in various legal fields, such as contract law and employment law.	Legal → Lawyers ⁷⁰⁸ Legal → Legal Issues ⁵⁶	situation ⁶⁵⁵ form ⁶⁷⁹ legal ⁹³⁷ approach ⁹⁷¹
linkguru.nl	LinkGuru	The online marketing field is described as attractive due to its dynamic nature.	Jobs → Vacancies ¹⁰⁹⁹ Current Affairs → International News ⁶⁵	topic ¹²³⁸ article ⁶⁰⁰⁰ vacancy ⁶⁵⁹⁸ news ¹⁵²⁹³	Gelderland → Apeldoorn ⁶⁹⁹⁶
mbovoetbalcollege.nl	MBO Voetbal College	Most practical lessons take place on and around the football field, offering a hands-on learning experience.	Vocational Training → MBO ⁶⁹⁰	football ¹³⁴⁷ club ⁴²²⁵ student ⁷⁶²³ education ¹³⁴⁷¹	Katwijk → Katwijk aan Zee ⁶¹⁶
minicamping-onder-de-es.nl	Minicamping Onder de Es	The campsite is surrounded by trees and offers a field for smaller tents and camping.	Camping → Campsites Netherlands ⁷⁹² Family Fun → Children’s Activities ¹⁹⁰⁶	folding caravan ²² play area ¹⁷³ recreation ⁷⁹⁹ swimming pool ¹⁶⁶⁴ campsite ²⁰⁹³	Friesland → Weststellingwerf ⁸²⁹
pantext.nl	Pan Text	The translation agency specializes in various fields such as finance and law.	Freight & Shipments → Customs ¹²⁸ Communication & Content → Translation ¹⁰⁵³	translation ¹⁵²³ communication ¹⁰¹⁶²	Nieuwkoop → Zevenhoven ⁹²
pijlenboogbattle.nl	Pijl en Boog Battle	The game is played on a specific field set up by the organizers.	Shooting → Archery ²⁵⁹ Activity → Active Sports ¹⁶	targets ²⁵ bow ⁸⁸ competition ⁴⁷⁵⁹	Gelderland → Barneveld ²⁷⁸¹
pretparkvoorhonden.nl	Pretpark voor Honden	Dogs play and relax on a spacious and safe enclosed field of 2200 m2.	Dog Care → Dog Walking Service ³⁵⁶ Nature & Outdoors → Outdoor ⁴⁰³¹	walking service ⁴⁵ freedom ⁸⁴⁸ dog ⁵⁴⁸³
promidrone.nl	Promidrone	For the agricultural sector, Promidrone offers support in mapping and visualizing farmland fields.	Air Services → Aviation ⁴⁴⁴	drone ⁹³⁶ video ⁶⁷¹⁴
run-fun.nl	Run & Fun	The company has its own, fully enclosed field where dogs can play and relax.	Dog Care → Dog Walking Service ³⁵⁶	bus ⁸⁹⁴ walk ²¹⁶¹ dog ⁵⁴⁸³	Zoeterwoude → Zoeterwoude-Rijndijk ³⁹
selinashondenresort.nl	Selina's Honden Resort	The 240m2 large field offers dogs the opportunity to dig, roll, and run.	Dogs → Dog Daycare ²²	play equipment ¹⁷³ workflow ⁴⁰⁷ dog ⁵⁴⁸³ photo ⁷⁷⁷⁸
tophockeytoernooi.nl	WMHC	The tournament is organized on the fields of the Bongerd in Wageningen.	Football → Youth Football ²⁰² Golf → Tournaments ⁴⁵⁴	prize ⁶²¹ pool ¹⁵³² tournament ²⁴⁷⁶ match ³⁴⁷¹	Gelderland → Wageningen ¹⁹⁴⁹
valleytechconnect.nl	Valley Tech Connect	Students can search for internships within specific technical fields, such as electrical engineering, installation technology, and metal technology.	Internships & Jobs → Internships ⁵⁵¹ Vocational Training → Technical Education ²¹⁵	internship ⁶⁹⁴ school ⁷⁸⁵⁶	Utrecht Hill Ridge → Maarsbergen ¹⁵⁵
hondenschoolbrok.nl	Hondenschool Brok	The large, fenced field provides ample space for training and exercises.	Dogs → Dog Training ⁸⁸¹ Competitive Activity → Dog Sports ²²⁵	agenda ⁴³⁷⁴ dog ⁵⁴⁸³ course ¹⁴⁷²⁸	Noordenveld → Alteveer ⁷⁴
pensionstalhellevoetsluis.nl	Pensionstal Hellevoetsluis / Match	The field of the stables is equipped with a walking treadmill and a drained pasture, providing the horses with a pleasant environment.	Horses → Horse Care ⁴⁸⁸	stall ¹⁹³ stables ²¹² stay ⁷⁰² horse ⁴³³⁷ accommodation ⁴⁹²¹	Voorne aan Zee → Hellevoetsluis ⁹⁷²
xcellent-professionals.nl	Xcellent Professionals	The freelancers are selected based on their expertise in the field.	Employment & Labor → Employers ⁶⁰⁸	assignment ¹¹²¹ match ³⁴⁷¹
bruisend75.nl	Bruisend75	The report describes the use of fields for camping and football.	Livestock → Dairy Farming ⁶⁷¹	cow ⁵⁹⁶ young people ¹⁰⁴⁵ campsite ²⁰⁹³ vacation ⁴²³⁴
vhvc.nl	Vereniging HVC vooruit	Lighting has already been installed on the fields.	Sports Clubs → Dutch Sports Clubs ³³⁷ Sport Facility → Sports Parks ⁵⁷	canteen ²¹⁰ sponsors ²⁶⁴² association ⁸⁵⁶²
psvdes.nl	PSV DES	PSV DES has its own field in Rijsbergen where they train, and in winter a indoor location.	Equestrian → Riding Clubs ²⁴⁵ Outdoor → Horse Riding ⁹⁴¹	pony ⁴⁰⁹ horse ⁴³³⁷ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Zundert → Rijsbergen ²³⁸
apeldoornvergaderen.nl	The Buiteling	There are three large fields and a sports field with various sporting opportunities on the grounds.	Conferences & Meetings → Meeting Venues ⁷²⁹ Nature → Forest ³⁸⁷	meeting room ⁶⁸⁵ team building ⁷²⁰ room ³⁴¹¹ nature ⁹⁰⁹⁴	Gelderland → Veluwe ¹⁸¹⁵
sniekers-ingb.nl	Sniekers Ingenieursbureau	The bureau’s specialization lies in mechanical engineering fields, including cleanrooms, breweries and industrial applications.	Installation & Repair → Installation Consulting ⁵⁷	utility ⁷⁷ installation ¹³⁷⁴²
pleinvoetbal.nl	Pleinvoetbal	This year, 11 fields will be used at the Purmerplein to host the event.	Sports Activities → Football ⁴¹⁴⁴ Context ¹⁶¹³⁹⁴	prize ⁶²¹ football ¹³⁴⁷ tournament ²⁴⁷⁶ youth ³¹²⁶ registration ⁴³⁶⁶	Amsterdam → Zunderdorp ⁷³¹
levensdans.nl	Levensdans	The ‘knowing field’ refers to a system of origins where participants are part of.	Mindfulness → Awareness ⁶¹⁴ Arts & Culture → Dance ²⁶⁸⁷	haptics ¹⁶ music ¹³¹⁷⁰ workshop ¹⁹³²⁵
werkenbij.zaanstad.nl	Gemeente Zaanstad	The website organizes available roles by field, such as spatial planning, social, and security, enabling users to find targeted information.	Online Services → Job Boards ¹⁰³⁶	colleague ³⁷⁸ salary ⁵¹³ city ¹⁸⁷⁵ vacancy ⁶⁵⁹⁸	North-Holland → Zaanstad ⁴⁵⁴¹
vacatures-maastricht.werk-t.nl	werk-t.nl	The website offers job openings in various fields, including vmbo, mbo, hbo and wo.	Jobs → Vacancies ¹⁰⁹⁹	employer ²³⁸³ vacancy ⁶⁵⁹⁸	Sittard-Geleen → Sittard ¹⁹⁹⁷
werkenbij.tbi.nl	TBI	The website presents the diverse fields within TBI, including execution building and infrastructure, execution technology, and project development.	Job Postings → Regional Job Postings ³⁴ Online Services → Job Boards ¹⁰³⁶	vacancy ⁶⁵⁹⁸ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	Netherlands → North-Brabant ⁷³³⁴¹
vacatures-roermond.werk-t.nl	werk-t.nl	The vacancies are sorted by specific field.	Online Services → Job Boards ¹⁰³⁶ Work → Jobs ¹⁴⁴³	cluster ⁸¹ employer ²³⁸³ region ⁵⁴¹² vacancy ⁶⁵⁹⁸ education ¹³⁴⁷¹	Sittard-Geleen → Sittard ¹⁹⁹⁷
hth.utwente.nl	H.S.V. High Tech Hitters	Training sessions take place at the baseball field on campus.	Universities → University of Twente ³⁰ Team Sports → Baseball ¹⁰⁹	softball ⁶⁹ baseball ⁸⁵ member ¹⁰¹⁵⁴ training ²⁸¹³³	Enschede → Calslaan ⁵²
bumaruiters.nl	PSV Bumaruiters Nieuw-Amsterdam	Bumaruiters has a large field, which is a pleasant place to relax and enjoy the surroundings.	Apparel → Equestrian ²³¹⁹ Sports → Sport Facility ⁴⁸⁶⁷	track ⁴¹⁶ stable ⁷⁶⁸ cafe ¹⁶²² lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴²	Emmen → Nieuw-Amsterdam ¹⁴⁹
gildefeesten.nl	Stichting Gildefeesten	The event takes place on an open field, where many activities take place.	Sport Facility → Sports Parks ⁵⁷	music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Utrecht → Soest ²⁰²⁷
gasberaad.nl	Groninger Gasberaad	The website provides information about the Groningen gas field.	Economy & Finance → Economics ¹¹¹⁵ Blogs & Publications → Regional ²⁷²	earthquake ⁴⁴ report ⁴⁵⁵¹ news ¹⁵²⁹³	Netherlands → Groningen ²³⁷³⁴
organisatiesysteem.nl	Organisatiesysteem	Organisatiesysteem has a wide range of fields of expertise, making it suitable for various industries.	Livestock → Dairy Farming ⁶⁷¹ Business & Management → Certification ³⁶⁴	management system ¹¹⁸ trajectory ⁵⁵⁶ certification ³³⁸⁰
natuurkunde-uitleg.nl	Natuurkunde-uitleg	The website deals with electromagnetic and magnetic fields.	Science → Physics ³²⁹ Vocational Training → MBO ⁶⁹⁰	force ²⁰ formula ²⁸⁷ energy ⁹⁰⁷⁵
asc62.nl	Voetbalvereniging ASC'62	The website informs about the construction of new artificial turf fields, which are available for training and matches.	Football → Amateur Football ⁷⁵⁷ Sports Clubs → Football Clubs ⁴⁶⁷	poll ⁴⁷ football association ¹²⁹ merger ³²³ news ¹⁵²⁹³	Overijssel → Dalfsen ¹⁰⁹⁹
jhs.nl	Juridische Hogeschool	The website describes the opportunities to work in the field after completing the program.	Study Programs → Bachelor ¹⁶ Adult & Continuing Learning → Professional Training ¹²²⁴	minor ¹⁹ study ⁷²⁰ lawyer ²⁶⁸³
travelhome.nl	Travelhome	Travelhome considers itself experts in the field of camper rental.	Camping → Camper Rental ³⁵⁹ Planning → Travel Planning ⁷¹⁶	camper trip ¹⁹ camper ¹⁵⁹⁶ destination ²⁵⁸⁰ travel ⁷²¹⁰
cobypronk.nl	Coby Pronk	The website describes Magnetic Field therapy as a supportive technique.	Naturopathy → Natural Therapies ⁴⁷ Mindfulness → Awareness ⁶¹⁴	enneagram ⁵⁹ emotion ²¹⁶⁹ therapy ⁷⁴⁴⁸ energy ⁹⁰⁷⁵
karenromme.nl	Karen Romme	The website asks experts for suggestions for the book based on their field.	Personal Development → Motivation ⁴³⁴ Literature → Non-Fiction ⁵¹⁹	choice ⁸²⁷ challenge ¹⁶⁹⁷ book ¹¹³⁹⁶
udi-enschede.nl	vv UDI	The website mentions the various fields where the club plays.	Internet → Forums & Communities ¹⁵⁹⁹	sponsors ²⁶⁴² history ⁷²⁸⁶ event ⁴⁵¹⁹⁹
bcs76.nl	Badminton Club Scharnegoutum '76	The ‘War Dy’ hall has three badminton fields.	Team Sports → Volleyball ⁸⁴² Combat → Badminton ⁷⁰²	warm-up ¹⁶ badminton ⁴⁵³ participation ¹⁴³⁰ club ⁴²²⁵ membership ¹⁰⁴⁴²	Southwest-Friesland → Scharnegoutum ⁴⁵
verenigingdemoeflon.nl	Vereniging De Moeflon	Moeflons primarily inhabit open fields in the Netherlands.	Foundations → Environmental Organizations ¹⁸⁵ Animals → Wildlife ⁵⁸	population ¹⁰² protection ⁷²⁸ nature ⁹⁰⁹⁴ collaboration ¹⁶⁰³⁶	Ede → Otterlo ³⁷¹
svmulier.nl	SV Mulier	The website describes the possibilities of renting the artificial turf field.	Local Communities → Villages ¹⁰⁰⁵ Sports Activities → Football ⁴¹⁴⁴	youth ³¹²⁶ board ³⁴³⁸ match ³⁴⁷¹ membership ¹⁰⁴⁴²	Southwest-Friesland → Witmarsum ⁶³
vvduno.nl	VV Duno	Members can grow and develop on the football field.	Clubs → Dutch Clubs ²⁰⁰	sportsmanship ²⁰ football club ⁶⁰³ membership ¹⁰⁴⁴²	Berg en Dal → Groesbeek ⁶⁵³
dosl.nl	DOSL	The website mentions information about the use of sports fields, including maintenance and rules.	Sports Clubs → Student Clubs ¹⁶ Sports Activities → Football ⁴¹⁴⁴	sponsorship ²⁶⁸⁶ youth ³¹²⁶ association ⁸⁵⁶² news ¹⁵²⁹³
codebeez.nl	Codebeez	The company focuses on its Python field and the quality of its work.	Technology → ICT ⁴⁸⁶ Painting → Digital Art ⁸²⁰	pleasure ⁹⁵ python ¹⁶⁷ employee ⁴⁴²⁹ collaboration ¹⁶⁰³⁶
hogebergtexel.nl	hogebergtexel.nl	The fields of the Hoge Berg contain a rich history, which becomes visible through QR codes.	Hotels → Boutique Hotels ⁹¹⁴ Livestock → Dairy Farming ⁶⁷¹	panorama ⁸⁴ sheep ²⁷⁴ regional products ³⁹¹	North-Holland → Texel ²²⁰⁸
flinter.nl	Flinter	The website focuses on connecting professionals to various fields.	HR Services → Intermediaries ¹⁴⁰ Technology → IT ³³³⁷	broker ⁹⁰² professionals ¹⁹⁶⁶ network ¹¹¹²³
brabantboom.nl	Baltussen Boomverzorging	Frans Baltussen has over 30 years of experience in his field, the tree trimming of trees.	Garden Maintenance → Tree Care ⁶⁶⁰	trim ²²¹ tree ¹⁸⁷⁹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cruyffstreetleague.nl	Cruyff Street League	Participants play in teams on various fields in Amsterdam.	Sports Activities → Football ⁴¹⁴⁴ Outdoor Activity → Shooting ⁸⁸²	final ⁷⁹ district ³⁷¹ tournament ²⁴⁷⁶ news ¹⁵²⁹³	Amsterdam → Nieuw-West ⁸⁴⁴
tentamenbank.nl	JoHo Tentamenbank	The summaries function as refreshers and onboarding materials for students after their studies, specifically geared toward their field.	Vocational & Training → Study Materials ²¹ Testing → Exams ¹⁰⁸	summary ⁶⁸ textbook ⁷³ student ⁷⁶²³
trainmee.nl	DHC Drienerlo	Members can train and play matches on the field.	Sports Clubs → Student Clubs ¹⁶	hockey ³⁴⁸ training ²⁸¹³³
stadsakkerseindhoven.nl	Stadsakkers Eindhoven	Stadsakkers Eindhoven manages two fields in Eindhoven where vegetables are grown.	Volunteering → Food Banks ¹⁸⁴ Economy → Local Economy & Development ⁷²¹	harvest ²⁷⁵ vegetables ¹⁴¹⁶ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷	North-Brabant → Eindhoven ¹¹⁸⁴⁵
bomech.nl	Bomech B.V.	The spreader is designed to avoid crop residues and move over the field.	Agriculture → Agricultural Technology & Innovation ⁷⁴³ Agriculture → Agricultural Machinery & Equipment ⁶³¹	manure ²¹¹ fertilizer ²⁹⁸
bakkerijfleuren.nl	Bakkerij Fleuren	The wheat field in Velden is important for the supply of fresh wheat to the bakery.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷ Bakery & Food Production → Bread ⁷⁶⁵	wheat ³³ waffle ²¹⁸ mill ⁴⁸⁷ bakery ⁷¹⁸ bread ¹⁶²²	Gulpen-Wittem → Mechelen ²¹⁴
oppadmetgps.nl	Op Pad Met Gps	The hiking routes lead through diverse fields, such as the Veluwe and the Asselse heath.	Nature → National Parks ⁸⁹⁸ Nature → Natural Areas ²⁵⁷	hiking route ¹⁵⁵ gps ²⁵⁵ route ³⁴²⁵	Netherlands → North-Holland ⁹²⁹⁵⁶
werkenbijgroningen.nl	Municipality of Groningen	The website offers an overview of the diverse fields in which employment is possible within the Municipality of Groningen.	Technical Services → Technical ⁹⁵⁷ Context ¹⁶¹³⁹⁴	resident ³²⁴⁵ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸ municipality ⁶⁸³⁷ sustainability ¹⁸⁴⁵¹	Netherlands → Groningen ²³⁷³⁴
zachockey.nl	zachockey.nl	Participants will run across the field in the sun.	Golf → Tournaments ⁴⁵⁴ Outdoor & Recreation → Group Activities ⁵⁰⁹	polo ⁶⁸ hockey ³⁴⁸ tournament ²⁴⁷⁶ party ⁵⁹²⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
hbvstaddijk.nl	HBV Staddijk	The club has a field in Staddijk-Zuid where members can practice archery.	Shooting → Archery ²⁵⁹ Combat → Badminton ⁷⁰²	archery ¹³⁷ club ⁴²²⁵ competition ⁴⁷⁵⁹ training ²⁸¹³³	Gelderland → Nijmegen ⁹³⁸⁴
rcbigbulls.nl	RC The Big Bulls	There is a place for everyone on the field, suited to your unique characteristics.	Sports Clubs → Student Clubs ¹⁶ Team Sports → Rugby ¹²⁶	rugby ⁹³	Overijssel → Almelo ²⁶⁹⁶
uzn.nl	UZN	The website describes the various fields in which UZN operates, such as logistics and healthcare.	Jobs → Vacancies ¹⁰⁹⁹ Online Services → Job Boards ¹⁰³⁶	employer ²³⁸³ job ²⁷⁹⁵ vacancy ⁶⁵⁹⁸	North-Brabant → Helmond ³⁰⁵⁸
toerklub.nl	Toerklub Overloon	Mountain bikers also ride through the fields in the area around Overloon.	Cycling → Cycling Clubs ⁵²² Cycling → Mountain Biking ²⁷⁵	ride ¹⁰⁷⁵ forest ¹⁴¹⁸ bike ¹⁵⁴¹ tour ²³¹⁵ event ⁴⁵¹⁹⁹	Land van Cuijk → Overloon ¹⁹⁴
trador.nl	Trador	Trador offers translation services for various fields without rush fees.	International → International Communication ²⁴ Communication & Content → Translation ¹⁰⁵³	translation ¹⁵²³ language ²⁰¹⁶ quote ¹²⁸⁶³
muurschilderinglunetten.nl	Muurschildering Lunetten	The field is a symbol of the community and is described as a place for meeting and playing.	Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹ Painting → Murals ¹²⁵	neighborhood festival ¹⁴ mural ³³⁸ community ⁷⁹³¹ story ⁸²⁸⁵	Neder-Betuwe → Echteld ⁶⁶³
iso-point.nl	ISO-point	The website specifically focuses on the field of quality, safety, health, and environment (QHSE).	Internships & Jobs → Internships ⁵⁵¹ Online Services → Job Boards ¹⁰³⁶	jobalert ⁴⁷ candidate ¹⁸⁹⁶ employer ²³⁸³ vacancy ⁶⁵⁹⁸	Tilburg → Old South ⁷²
hcares.nl	Hockeyvereniging HC Ares	HC Ares has five own hockey fields, making the sport accessible to many members.	Hockey → Hockey Clubs ¹¹⁸	hockey ³⁴⁸ schedule ²⁶²⁴ club ⁴²²⁵ member ¹⁰¹⁵⁴	Gelderland → Apeldoorn ⁶⁹⁹⁶
vertaalbureau-noorderlicht.nl	Infobrowse BV	Vertaalbureau Noorderlicht offers expertise in various fields, including marketing, technology and legal translation.	Supply Chain & Logistics → International Trade ¹¹⁵⁶ Business → Industry ³⁶⁹⁷⁷	translation ¹⁵²³ language ²⁰¹⁶ quote ¹²⁸⁶³
wftxperience.nl	WFT Xperience	The courses focus on improving financial knowledge and skills within the specific field.	Online Courses → Financial Education ¹⁶² Legal → Lawyers ⁷⁰⁸	trainer ¹⁹⁶⁶ exam ²¹²⁰ course ¹⁴⁷²⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
protaal.nl	ProTaal	Professionals who have extensive knowledge of their field can have difficulty translating this knowledge into concise texts.	Municipalities → Policy ⁶⁰⁷	e-zine ¹⁰ text ²⁴⁶⁷ training ²⁸¹³³
sportparkdeeendracht.nl	Stichting Sportpark De Eendracht	The park features diverse fields for various sports.	Sport Facility → Sports Parks ⁵⁷	sports park ¹⁴⁰ sport ⁴²²⁸ partner ⁴²⁷² sustainability ¹⁸⁴⁵¹ event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
rusthuisvoorpaarden.nl	Paardenrusthuis Van der Weijden	The large field offers a place for the horses to play and have fun during the off-season.	Accommodation → Horse Stables ⁹⁸ Environment → Agriculture ¹¹¹⁶⁰	paddock ⁶¹ stable ⁷⁶⁸ food ³⁸⁷² horse ⁴³³⁷
voetbalkamp-groningen.nl	Stichting Voetbalkamp Groningen	Young footballers train and play on the fields of Stadion de Esserberg.	Vacations → Children’s Vacations ¹⁰ Youth → Sports Camps ²⁴	football camp ¹³ shirt ⁶⁶⁹ trainer ¹⁹⁶⁶ vacation ⁴²³⁴ training ²⁸¹³³	Groningen → Haren ⁸⁰⁵
effectifs.nl	Effectifs Uitzendbureau B.V.	The teams that Effectifs employs are considered experts in their field.	Staffing & Recruitment → Technical Staffing ³⁹⁵ Technical Services → Technical ⁹⁵⁷	staff ³⁴⁰⁵ collaboration ¹⁶⁰³⁶ maintenance ²⁰⁰⁹³
modelvliegclublosser.nl	R.C. Modelvliegclub Losser	The club has a field where the model pilots organize their competitions and flying sessions.	Outdoor Activity → Model Aviation ⁷⁷ Media → News & Journalism ¹⁰⁸²⁷	bbq ⁹⁰⁸ meeting ²³⁸¹ competition ⁴⁷⁵⁹	Overijssel → Losser ⁷⁴³
elassrouti.nl	El Assrouti Advocaten	The firm strives to be the best in its field.	Law → Civil Law ⁵²¹ Legal → Lawyers ⁷⁰⁸	outcome ⁶³ justice ¹²³ divorce ⁹⁰² lawyer ²⁶⁸³	North-Holland → Amsterdam ⁴¹²⁵³
vliegclub-zuid-ginkel.nl	Vliegclub Zuid Ginkel	The club has a flying field on the Ginkelse Heide.	Model Aviation → Model Flying Clubs ⁴⁷ Media → News & Journalism ¹⁰⁸²⁷	model aviation ¹⁷ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Gelderland → Ede ⁵¹⁰⁴
mijngrafiek.nl	mijngrafiek.nl	The input field requires specific data formats for the graph.	Text & Graphic Processing → Graphic Software ³⁸	graph ¹⁰⁴ image ²⁶⁰⁵ data ⁵⁸⁷²
huttenbouwdorpharen.nl	Stichting Huttenbouwdorp Haren	The 40th edition of Huttenbouwdorp Haren 2025 will be held on a new field, the Geertsemaweg 3, near the Scharlakenhof.	Ornithology → Birdwatching ²⁷¹ Events & Activities → Outdoor Activities ¹⁰⁴³	schedule ²⁶²⁴ photo ⁷⁷⁷⁸	Groningen → Haren ⁸⁰⁵
zomerfeestenepse.nl	Stichting Zomerfeesten Epse	In connection with the setup and dismantling of the Zomerfeesten, the field next to the playground is the ground where the festivals take place.	Local Events → Village Events ⁷⁵	coin ³¹³ foundation ⁶⁶⁷⁸ event ⁴⁵¹⁹⁹	Lochem → Epse ⁸⁰
plantsoenboules.nl	JEU DE BOULES VERENIGING PLANTSOEN BOULES	The association organizes its activities on a field in Abbekerk.	Team Sports → Boules ¹⁵⁹	boules ³⁸ camaraderie ⁵⁸ ball ²⁸⁶ association ⁸⁵⁶² collaboration ¹⁶⁰³⁶	Medemblik → Abbekerk ⁵⁸
demeneer.nl	Demeneer V.O.F.	Veldanalyse offers a solution for collecting and analyzing measurements from sports fields, providing insights for groundsmen and stakeholders.	Construction & Maintenance → Procurement ⁵⁶⁷ Construction → Building & Materials ¹⁹⁴⁴⁹	dissertation ¹²⁶
dekreekvelden.nl	De Kreekvelden	The development is divided over various fields (B, C, D, E, F) and construction of phase 1 and 2 has begun.	Nonprofits → International Development ⁴²⁰	garden plot ¹⁰ community center ⁴⁴² property ⁷⁴⁰⁶ nature ⁹⁰⁹⁴	Flevoland → Almere ⁷⁷⁶⁵
stienzer-keatsdagen.nl	Stienzer Keatsdagen	The shinty field is the main location for shinty competitions and the overall atmosphere of the event.	Competitions → Team Competitions ¹⁸	tent ¹³²⁸ band ²⁹⁷⁷ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Leeuwarden → Stiens ²⁶³
poloclubwassenaar.nl	Polo Club Wassenaar	At the polo fields, visitors can watch the club’s practice chukkas and matches.	Equestrian → Riding Clubs ²⁴⁵	polo ⁶⁸ tournament ²⁴⁷⁶ horse ⁴³³⁷ lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴²	South-Holland → The Hague ¹⁹⁸⁹⁸
deepsesummervibes.nl	Deepse SummerVibes	The volleyball field measures approximately 8 by 16 meters and has a net height of 2.40 meters.	Team Sports → Volleyball ⁸⁴² Beach Sports → Beach Volleyball ¹¹⁶	volleyball ⁶¹⁷ tournament ²⁴⁷⁶ registration ⁴³⁶⁶	Hof van Twente → Diepenheim ²⁰⁰
inno-overheidsadvies.nl	INNO-Overheidsadvies B.V.	The website mentions various fields where advice is provided.	Participation → Citizen Participation ²³⁷ Economy → Local Economy & Development ⁷²¹	strategy ⁹³⁷⁹
wpex.nl	WPEX	Each from their own field.	Employment Law → Sick Leave ¹⁹ Health → Medical Care & Services ²⁹⁴⁶¹	judgment ⁶⁶ decision-making ¹⁵² problem ²²¹⁴ research ⁸⁹⁶⁷
xhap.nl	XHoven Akoestisch Podium XHAP	The name of the podium is based on the nearby fields.	Performance → Live Performances ⁶⁰ Festivals → Local Festivals ¹⁷⁰	band ²⁹⁷⁷ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰
beachparkstadskanaal.nl	Beachpark Stadskanaal	The field is intensively used by the members of VC Tyfoon and can also be reserved for private use.	Beach Sports → Beach Volleyball ¹¹⁶ Sport Facility → Sports Parks ⁵⁷	beach tennis ¹³ park ¹⁸⁶³ tournament ²⁴⁷⁶	Groningen → Stadskanaal ¹⁰⁵⁴
beachvolleybalheusden.nl	Beachvolleybal Heusden	As a result of the move to Drunen, more beach volleyball fields are available.	Beach Sports → Beach Volleyball ¹¹⁶	horeca ¹¹⁵ sand ⁶³⁰ tournament ²⁴⁷⁶	Heusden → Drunen ⁶⁵²
denieuweerven.nl	De Nieuwe Erven	The plots are surrounded by open fields, providing the ideal balance between peace and space.	Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹ Neighborhood Focus → Community Centers ⁹⁴¹	street ²⁸¹ playground ¹⁰⁸⁸ house ⁸¹²¹ garden ¹³¹²⁹	Gilze and Rijen → Molenschot ⁷⁶
goeiescheids.nl	Goeiescheids	Goeiescheids ensures a referee is found, allowing players to enjoy their hockey on the field.	Sports Clubs → Dutch Sports Clubs ³³⁷ Sport Organization → Hockey ⁵⁵⁰	referee ⁷⁹ sunday ²⁰⁸ match ³⁴⁷¹ club ⁴²²⁵	North-Holland → Haarlem ⁸⁶⁷⁴
sportcentrumarcus.nl	Sportcentrum Arcus	The beach season is here again, and visitors can rent the fields.	Sports → Sport Facility ⁴⁸⁶⁷	complex ⁵⁶⁸ fitness ²²⁵¹ club ⁴²²⁵ event ⁴⁵¹⁹⁹	Gelderland → Land van Maas en Waal ²³⁷
kleinemelaar.nl	Klein Emelaar	The campsite is located on a large field in the Veluwe, allowing visitors to easily explore the surroundings.	Camping → Minicamping ²⁴⁶ Accommodation → Holiday Homes ⁷²⁷	calf ¹⁵⁰ surroundings ⁴⁶³ campsite ²⁰⁹³ farm ²⁶²² accommodation ⁴⁹²¹	Gelderland → Veluwe ¹⁸¹⁵
videra.nl	videra	Another type of location where Videra provides security.	Security Systems → Security Technology ³⁹⁹ Security & Surveillance → Security ³²⁵¹	construction site ¹⁴¹ surveillance ¹⁹² security ⁶⁶⁵⁵
rijtvenweg18.nl	Makelaardij van de Laar	The house is located on a large field, perfect for horses.	Accommodation → Country Estates ⁷³⁸	cellar ¹³⁴ stables ²¹² farmhouse ⁸⁷⁸ house ⁸¹²¹ garden ¹³¹²⁹	Laarbeek → Mariahout ¹⁰⁷
addsafetygroup.nl	ADD Safety Group	The Health, Safety & Environment (HSE) field is addressed by ADD Safety Group, with advice and prevention of unsafe situations.	Security & Surveillance → Security ³²⁵¹	certification ³³⁸⁰ security ⁶⁶⁵⁵ event ⁴⁵¹⁹⁹
uitzendbureauwatchout.nl	Uitzendbureau Watch Out	All fields of expertise	HR Services → Technical Recruitment ⁴⁷⁴ Staffing & Recruitment → Temporary Staffing ¹⁰⁰³	staffing solutions ¹² staff ³⁴⁰⁵	South-Holland → Westland ⁴⁰¹⁶
sonrisehuizen.nl	Sonrise Huizen	The activities take place on the fields next to the schools.	Neighborhood Focus → Community Centers ⁹⁴¹ Community & Social → Community Activities ⁵²	sport ⁴²²⁸ community ⁷⁹³¹ volunteer ⁸³⁶⁷	Raalte → Luttenberg ⁵³²
bedenbreakfastdonkersvoort.nl	Bed and Breakfast Donkersvoort	The B&B is located in an area with beautiful fields, offering a relaxing environment.	Vacations → Rural Vacations ¹³	b&b ¹⁰⁶⁰ room ³⁴¹¹ hospitality ³⁴⁹¹ garden ¹³¹²⁹	Laarbeek → Beek and Donk ³⁷³
bullder.nl	Bullder	The company has expertise in various fields within the Physical Environment.	HR Services → Executive Search ⁷³⁷ HR Services → Intermediaries ¹⁴⁰	bureau ¹⁰³ professionals ¹⁹⁶⁶ talent ³⁹⁸⁷ vacancy ⁶⁵⁹⁸
duuvels.nl	De Duuvels	Training and matches are held on the club field.	Team Sports → Volleyball ⁸⁴² Team Sports → Rugby ¹²⁶	rugby ⁹³ sponsor ¹¹⁵⁹ newsletter ⁶⁵⁰⁴ training ²⁸¹³³	Montferland → Didam ⁷⁵⁹
voetballenvoorleven.nl	Pixel for Life	Teams will play part of the matches on the field at FC Horst.	Golf → Tournaments ⁴⁵⁴ Beach Sports → Beach Volleyball ¹¹⁶	sponsor ¹¹⁵⁹ meal ¹⁶³⁸ hall ¹⁷⁸⁶ tournament ²⁴⁷⁶ registration ⁴³⁶⁶	Gelderland → Ermelo ¹²⁰⁷
piusxliempde.nl	Stichting Pius X	Two asphalt fields are available for various sports activities.	Venues → Halls ⁴¹⁹ Neighborhood Focus → Community Centers ⁹⁴¹	gym hall ⁴⁷ sports hall ²⁷⁰ stichting ⁴⁸¹ accommodation ⁴⁹²¹	Boxtel → Liempde ²³²
boxtoboxleague.nl	Box To Box League	Matches are played on a 16-meter adjusted field on natural grass.	Football → Youth Football ²⁰² Football → Competitions ¹⁰⁷²	sponsor ¹¹⁵⁹ football ¹³⁴⁷ competition ⁴⁷⁵⁹	Gelderland → Nijmegen ⁹³⁸⁴
reyck.nl	Reyck	Reyck’s people possess in-depth knowledge and specialized skills in the field of public safety and healthcare.	Sport Facility → Sports Fields ¹⁵² Installation & Repair → Installation Consulting ⁵⁷	relationship ⁴²⁰⁵
kickcompetition.nl	KickCompetition	The matches are played on a half-field with more space and scoring opportunities.	Competitions → Team Competitions ¹⁸	football ¹³⁴⁷ match ³⁴⁷¹ competition ⁴⁷⁵⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
meppers.nl	Meppers Eersel Honkbal Vereniging	The club's sporting activities take place at Sportpark ‘de Dieprijt’ and baseball fields in Eersel and Veldhoven.	Clubs → Dutch Clubs ²⁰⁰ Team Sports → Baseball ¹⁰⁹	baseball ⁸⁵ league ⁹⁹ tournament ²⁴⁷⁶ club ⁴²²⁵ training ²⁸¹³³	North-Brabant → Veldhoven ¹⁴⁸⁵
mulo-baseball.nl	Mulo Honk en Softbal	The club has a sports park at Rivierensingel with a field for baseball and softball.	Sports Clubs → Dutch Sports Clubs ³³⁷ Team Sports → Baseball ¹⁰⁹	sponsorship ²⁶⁸⁶ club ⁴²²⁵ sport ⁴²²⁸	North-Brabant → Helmond ³⁰⁵⁸
beauviltersmemorial.nl	Beau Vilters Memorial	The tournament takes place on the fields of SHH Herten.	Golf → Tournaments ⁴⁵⁴ Beach Sports → Beach Volleyball ¹¹⁶	tournament ²⁴⁷⁶ youth ³¹²⁶ volunteer ⁸³⁶⁷ event ⁴⁵¹⁹⁹	Roermond → Herten ¹³³
frisbeehaarlem.nl	MUG Haarlem	The website invites visitors to experience the atmosphere on the field.	Team Sports → Frisbee ¹² Sports → Sport Facility ⁴⁸⁶⁷	sportpark ⁷⁵ member ¹⁰¹⁵⁴ training ²⁸¹³³	North-Holland → Haarlem ⁸⁶⁷⁴
artzat.nl	DB Art Zat	The author plays and ran around on the 'field', portraying the leisure time of the author and his friends.	Competitive Activity → Competitive Sports ⁸³ Culture → Traditional Practices ³⁷¹	shuffleboard ¹⁶ bend ⁴⁵
romhof33.nl	Groenhout Makelaars	The house has views of fields, ensuring a tranquil and green environment.	Apartment Living → For Sale ¹⁰⁰⁷ Mobile Apps → Business Apps ¹¹	overhang ¹⁸⁵ business park ³⁷² living room ¹³²⁵ bedroom ²⁰⁵¹ house ⁸¹²¹	Smallingerland → Drachten ²⁰⁵²
irprojects.nl	IRP	IRP Training provides extra capacity, teachers for a support field.	Professional Development → Training Programs ¹²⁹ Safety → Industrial Safety ⁷³	certification ³³⁸⁰ safety ⁵⁸¹⁹ training ²⁸¹³³
mvc-tag.nl	Modelvliegclub Touch and Go	The club's activities take place on a field.	Hobbies → Model Building ¹⁰⁰⁷ Outdoor Activity → Model Aviation ⁷⁷	aircraft ²⁶⁹ club ⁴²²⁵ membership ¹⁰⁴⁴²
remoteminded.nl	Remoteminded	The platform focuses on helping professionals to work remotely within their own specialty.	Work → Remote Work ⁹⁴ Career & Guidance → Personal Career ²¹	remote work ¹³³ freedom ⁸⁴⁸ method ¹⁵⁰⁵ career ²⁵¹³
contra-experts.nl	Nassau Poort Taxaties en Expertise BV	The bureau is specialized in a wide range of fields, such as building-related matters and agricultural matters.	Civil Law → Litigation ¹³⁸ Building Inspection & Safety → Construction Inspection ¹⁰	insurance company ²⁵¹ damage ¹⁵⁶²
vakbladkinderopvangenonderwijs.nl	Vakblad Kinderopvang en Onderwijs	The magazine is aimed at updating and informing professionals within the field of childcare and education.	Special Needs & Support → Educational Organizations ³¹⁵ Early Years → Early Childhood Education ¹³⁴⁵	advertisement ¹⁷⁰⁷ subscription ³²⁸⁷ article ⁶⁰⁰⁰ child ¹¹⁵⁶⁶
3x3basketballzondagen.nl	Streetball groep LR	The basketball field in Utrecht serves as the location for outdoor games and activities.	Team Sports → Basketball ²⁴⁴ Commerce → Sporting Goods ¹⁰	basketball ¹⁷⁵ hall ¹⁷⁸⁶ event ⁴⁵¹⁹⁹	Netherlands → Utrecht ⁴⁸⁹⁰¹
annemiekvankessel.nl	Annemiek van Kessel	The field serves as the location for a race that the Hare and the Tortoise want to test each other with.	Personal Development → Motivation ⁴³⁴ Literature → Stories ²⁵⁸	hare ¹⁶ motivation ⁸⁹⁴ race ¹⁰⁴³ story ⁸²⁸⁵
baxconsultancy.nl	Bax Consultancy	The blog highlights the importance of signaling expertise within a professional's field.	Consulting → Innovation Consulting ¹⁷⁷ Software Development & Engineering → Digitalization ²⁷⁶	business model ¹⁴³ digitalization ⁷⁵⁷ strategy ⁹³⁷⁹
hrvernieuwers.nl	HRvernieuwers	The website provides unique content about the pros and cons of the HR field.	HR Services → Intermediaries ¹⁴⁰ Community → Government & Administration ¹⁰⁵⁶⁷	co-creation ¹³⁴ inspiration ⁴⁰⁸¹ network ¹¹¹²³
kynoke.nl	Kynoké	The company has a fenced-in outdoor area in Rolde where the dogs play outside.	Dog Care → Dog Walking Service ³⁵⁶ Transportation Services → Animal Transport ⁷⁵	dog walking service ¹⁷⁰ bus ⁸⁹⁴ dog ⁵⁴⁸³	Aa en Hunze → Rolde ¹⁷⁶
libelles.nl	N.V.	The website teaches users to acquire knowledge in a field and use it to outperform competitors	Living → Sustainable Living ⁸¹⁷ Building & Construction → Sustainable Building ¹⁰⁰⁴	knowledge ³⁵²⁸ competition ⁴⁷⁵⁹ sustainability ¹⁸⁴⁵¹
limael.nl	N.V.	The website requires certain fields to be filled in when requesting collaboration.	Computer Science → Software Engineering ⁴⁰⁴ Painting → Individual Artists ⁶⁶⁸	text ²⁴⁶⁷ portfolio ⁶⁸⁵⁴
particerie.nl	De Particerie	De Particerie works in various fields, particularly within the energy transition and spatial policy.	Participation → Citizen Participation ²³⁷ Energy → Energy Transition ²²⁵	input ³⁵ participation ¹⁴³⁰ plan ²⁵⁶⁶
qpstudio.nl	QPSTUDIO	Athletes wear the custom shin guards during matches and training on the field.	Sports Activities → Football ⁴¹⁴⁴ Retail → Personalized Products ³¹	shin guards ²³ custom design ⁶⁶ identity ¹⁰²⁸ design ²⁷²⁰²
roordink-snijheesters.nl	Maatschap Roordink Snijheesters	The plants are grown in the field on the company's premises.	Agriculture → Horticulture & Floristry ¹⁴⁰⁴	florists ⁴¹ cut flowers ⁴³ machine ³⁷²⁷ plant ⁴⁵⁰⁹
insociorumsalutem.nl	In Sociorum Salutem	The members of ‘In Sociorum Salutem’ discuss news and developments within their respective fields.	Disease & Treatment → Medicine ¹⁰¹⁷ Context ¹⁶¹³⁹⁴	meeting ²³⁸¹ knowledge ³⁵²⁸ party ⁵⁹²⁸ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Rotterdam → Hillegersberg-Schiebroek ⁴⁰⁴
stichtingabcoudesportbuiten.nl	Stichting Abcoude Sport Buiten	The Cruijff Court Matthijs de Ligt is a sports field where children can try and practice various sports.	Local Government → Municipalities ³⁰²⁶ Sport Facility → Sports Fields ¹⁵²	court ⁹⁹⁹ clinic ¹⁰⁷⁹ sport ⁴²²⁸ municipality ⁶⁸³⁷ school ⁷⁸⁵⁶	De Ronde Venen → Abcoude ⁴⁷²
libroledenadministratie.nl	Avarix	Users can add an unlimited number of custom fields.	Administration & Maintenance → Administration Software ¹² Equestrian → Riding Clubs ²⁴⁵	feature ³⁰⁰ search engine ⁵³⁶ flexibility ⁹⁹⁶ administration ⁶⁵⁸⁷ member ¹⁰¹⁵⁴
techlifeengineering.nl	Techlife Engineering	The company operates in several technical fields including Mechanical Engineering and Electrical Engineering.	Automation & Control → Automation ¹⁴⁹⁴ Construction → Civil & Infrastructure ³⁴⁵³	reference ³³² vacancy ⁶⁵⁹⁸	The Hague → City Center ⁴⁴⁵
nvvmt.vaktherapie.nl	Nederlandse Vereniging voor Muziektherapie (NVvMT)	Within the NVvMT, there are several field groups active.	Organizations → Professional Associations ¹⁰⁰⁴ Vocational Training → MBO ⁶⁹⁰	music therapy ¹⁰⁶ register ³⁶² goal ⁴⁹⁷⁴ association ⁸⁵⁶² member ¹⁰¹⁵⁴
vacatures-heerlen.werk-t.nl	werk-t.nl	The website offers job postings per field, so that users can search specifically.	Job Postings → Regional Job Postings ³⁴ Online Services → Job Boards ¹⁰³⁶	place ²⁴² employer ²³⁸³ job ²⁷⁹⁵ region ⁵⁴¹² vacancy ⁶⁵⁹⁸	Sittard-Geleen → Sittard ¹⁹⁹⁷
vacatures-venlo.werk-t.nl	werk-t.nl	The vacancies are categorized based on field, such as VMBO, HBO, and WO.	Universities → Eindhoven University of Technology ¹¹ Online Services → Job Boards ¹⁰³⁶	employer ²³⁸³ region ⁵⁴¹² vacancy ⁶⁵⁹⁸	Sittard-Geleen → Sittard ¹⁹⁹⁷
fcfochteloo.nl	FC Fochteloo	The championship celebration took place at sport park Et Legien.	Football → Amateur Football ⁷⁵⁷	championship ²¹⁰ football club ⁶⁰³ match ³⁴⁷¹ club ⁴²²⁵ goal ⁴⁹⁷⁴	Steenwijkerland → Blankenham ¹⁹
scveluwezoom.nl	Sportclub Veluwezoom	The club has a sports park called 'de Pinkenberg'.	Football → Amateur Football ⁷⁵⁷ Sports Clubs → Dutch Sports Clubs ³³⁷	football association ¹²⁹ tournament ²⁴⁷⁶ event ⁴⁵¹⁹⁹	Rheden → Velp ⁷⁰⁰
gcheelsum.nl	Golfclub Heelsum	The course layout is inspired by classic Scottish and English heathland courses.	Golf → Golf Clubs ¹⁸⁹	heathland ⁴⁰ golf club ¹¹³ golf course ⁵⁰⁷ tournament ²⁴⁷⁶ facility ²⁶¹⁶	Rheden → Veluwezoom ¹⁰⁹
ontdeknoordgroningen.nl	Discover North Groningen	Extensive fields characterize the landscape of North Groningen and provide space for the agricultural business.	Nature → National Parks ⁸⁹⁸	dyke ²⁰ village ⁸⁰⁸	Oldambt → Winschoten ⁸³⁰
veluwe-events.nl	Veluwe Events	Most activities take place on their own terrain and in the surrounding area of the Veluwe.	Conferences & Meetings → Corporate Events ²⁴⁷² Events & Activities → Outdoor Activities ¹⁰⁴³	arrangement ³¹⁰⁴ catering ⁶⁴⁵⁶	Gelderland → Veluwe ¹⁸¹⁵
jeudebouleszeewolde.nl	Jeu de Boulesvereniging LTE	The championship takes place on the Jeu de Boules fields at Horsterweg.	Team Sports → Boules ¹⁵⁹ Competitive Activity → Competitive Sports ⁸³	jeu de boules ¹¹⁷ championship ²¹⁰ match ³⁴⁷¹ member ¹⁰¹⁵⁴	Flevoland → Zeewolde ¹²⁴³
zwethoeve.nl	Zwethoeve	Farmer Piet uses a praam (small boat) to milk the cows, a ritual that has been carried out on the farm for 40 years.	Water Sports → Water Recreation ⁵⁹⁹ Outdoor & Recreation → Group Activities ⁵⁰⁹	rowboat ¹⁴ canoe ²⁶⁹ canal ⁵⁰⁷ farm ²⁶²² nature ⁹⁰⁹⁴	Wormerland → Jisp ⁴²
dagwandeling.nl	Dagwandeling.nl	The described walks lead through various landscapes, including heathlands, forests and valleys.	Planning → Travel Planning ⁷¹⁶	filter ⁴⁸⁷ map ⁸⁰¹ walk ²¹⁶¹ route ³⁴²⁵	Amsterdam → West ⁷⁷⁷
bedandbreakfastpergamo.nl	Bed & Breakfast Pergamo	The B&B is located in the midst of the fields, offering a unique location, especially in the spring.	Hotels → Boutique Hotels ⁹¹⁴ Accommodation → Country Estates ⁷³⁸	b&b ¹⁰⁶⁰ wellness ¹⁵⁶¹ boat ²⁹⁸⁰ room ³⁴¹¹	Lisse → Van Lyndenweg ⁷⁷
korfbalinfo.nl	Korfbalinfo.nl	The website describes outdoor training sessions for senior and youth teams.	Student Life → Students ³⁵² Team Sports → Korfbal ⁴⁰⁶	korfbal ¹⁸² checklist ⁴²⁶ training ²⁸¹³³
dorhoutmeesgolf.nl	Golfbaan Dorhout Mees	The golf course is located on the Veluwemeer and is surrounded by the charming landscapes of Harderwijk, Zeewolde, and Elburg.	Hotels → Golf Hotels ¹⁵ Sport Facility → Golf ¹⁴⁴¹	golf lesson ¹³⁸ golf course ⁵⁰⁷ brasserie ⁷⁵² conference ⁷⁶³ hotel ³⁵⁴³	Dronten → Biddinghuizen ⁴⁰⁶
minicamping-debeerostie.nl	Minicamping De Beeröstie	The campsites are car-free, ensuring peace and safety.	Camping → Minicamping ²⁴⁶ Camping → Campsites Netherlands ⁷⁹²	polder ⁴⁷⁶ campsite ²⁰⁹³ facility ²⁶¹⁶ beach ³²¹⁰	Sluis → Cadzand ²³⁴
bvkwinkslag.nl	Badmintonvereniging Kwinkslag	The Christmas tournament in 2024 had an expanded volleyball-format.	Beach Sports → Beach Volleyball ¹¹⁶ Combat → Badminton ⁷⁰²	badminton ⁴⁵³ handyman ⁸³⁶ tournament ²⁴⁷⁶ match ³⁴⁷¹ club ⁴²²⁵	De Ronde Venen → Vinkeveen ⁴⁷²
voetbalschool2fast.nl	Voetbalschool 2FAST	The training takes place at a location of your choice.	Professional Education → Legal Education ¹⁰² Events & Activities → Outdoor Activities ¹⁰⁴³	show ¹³⁹¹ camp ²⁴⁶⁶ training ²⁸¹³³ event ⁴⁵¹⁹⁹
barbiervianen.nl	De Barbier	De Barbier continuously stays up-to-date with the latest trends and techniques in the hairdressing profession.	Makeup → Makeup Artists ⁷³³ Services → Personal Services ¹⁰⁶²	hairdresser ¹³⁷² atmosphere ⁵⁵⁹¹ appointment ¹³⁵¹⁰	Vijfheerenlanden → Vianen ⁷⁰⁷
vitaalenactief.nl	Vitaal en Actief	Classes take place every Wednesday and Friday at the football club v.v. Dieren.	Social Services → Seniors ⁸²²	class ²⁰⁷⁶ movement ²³⁰⁴ meeting ²³⁸¹	Rheden → Dieren ⁴⁶²
cromtigers.nl	Vereniging Cromtigers	The website mentions Sportpark de Omzoom as the location for the matches.	Associations → Sports Associations ¹⁰⁸²	sport ⁴²²⁸ competition ⁴⁷⁵⁹ association ⁸⁵⁶² membership ¹⁰⁴⁴²	Zaanstad → Assendelft ⁵²⁴
mwkunst.nl	MWkunst	Fields of tulips are a significant theme in her work, often depicted in colorful detail.	Painting → Contemporary Painting ⁴⁵² Painting → Individual Artists ⁶⁶⁸	oil paint ²⁰² beach ³²¹⁰ paintings ³⁹⁰⁷ photography ⁹⁵⁰³	South-Holland → Lisse ¹⁰⁸⁹
geutjen.nl	Boerderij 't Geutjen	The Christmas trees are sourced from their own land by Boerderij 't Geutjen.	Christmas → Christmas Trees ¹⁶² Nature → Forest ³⁸⁷	christmas tree ³²² tree ¹⁸⁷⁹	Gelderland → Doetinchem ²⁷⁰⁶
onweerstaanbaaronline.nl	Onweerstaanbaar	This refers to the frequency, the feeling and the mission that the entrepreneur wants to project.	International Aid → Development Aid ⁴⁰¹	word ⁵⁶⁷ mission ¹⁰⁰⁰
krachtigverbonden.nl	Krachtig Verbonden	Krachtig Verbonden describes a connected environment where individuals can follow their unique path and activate their inner strength point.	Spiritual Practices → Spirituality ⁴³⁹⁹ Community & Social → Social ¹⁵⁴	circle ²³⁵ journey ⁷⁰¹ strength ⁷⁸⁹ energy ⁹⁰⁷⁵	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
ardjanlangedijk.nl	Ardjan Langedijk	The text points to a worsening situation for Russia on the battlefield.	Writing → Columnists ¹⁰⁸ Politics & Government → International Politics ¹⁹⁹	russia ⁴⁶ ukraine ¹³¹ war ²⁷² conflict ¹²⁹⁰

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.