Krimpenerwaard Area Businesses and Services

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳Netherlands ⁴²³⁶⁰⁵	Dutch websites by location	Websites related to specific locations in the Netherlands, including cities, towns, and regions.
↳Netherlands→South-Holland ⁹²³⁸²	South Holland: Local Businesses & Services	This collection of websites features a diverse range of local businesses and service providers across South Holland.
↳Netherlands→South-Holland→Krimpenerwaard ¹⁸⁴⁰	Krimpenerwaard Businesses and Services	Websites listed showcase businesses and service providers operating within the Krimpenerwaard region of South Holland.
↳Netherlands→South-Holland→Krimpenerwaard→Bergambacht ²⁹⁴	Krimpenerwaard Area Businesses and Services	This category features a diverse collection of websites representing businesses and service providers operating within the Krimpenerwaard region. The listings include companies specializing in sectors such as construction, automotive, agriculture, leisure, and professional services.

294 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
bergambacht-oost.nl	Erik van Erk projectontwikkeling B.V.	The website provides information about the Bergambacht-Oost housing development initiative, a project aimed at adding 4,000 homes to the Krimpenerwaard municipality by 2040.	Local Governance → Civic Engagement ⁵¹⁵ Tourism → Rural Tourism ⁵⁹	site ⁴²² agreement ¹⁰²⁹ resident ³²⁴⁵ municipality ⁶⁸³⁷ home ⁷⁹⁷⁶	Rotterdam → Prins Alexander ⁴³²
meetbureaudebruijn.nl	Meetbureau de Bruijn	Meetbureau de Bruijn is a surveying and engineering firm specializing in accurate measurements and solutions for the construction sector.	Engineering → Engineering Firms ⁹⁸⁹ Technology & Innovation → Construction Technology ⁷⁹⁰	technical solutions ²⁹ measurement ⁷³¹ construction ⁷⁴²¹	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
bizdewetering.nl	Stichting BIZ De Wetering	Stichting BIZ De Wetering is a foundation that facilitates joint investment in a safe and attractive business environment on De Wetering industrial park in Bergambacht.	Local Economy & Development → Regional Development ²⁹⁶ Associations & Groups → Business Associations ¹⁰¹⁸	industrial park ¹¹ biz ⁵² investment ²⁰⁷⁰ board ³⁴³⁸ municipality ⁶⁸³⁷
tvs-design.nl	TVS Design	The website of TVS Design presents the company's services as a specialist in interior design and stand construction, with a focus on customized solutions.	Finishing & Trades → Interior Construction ⁵⁰² Event Styling & Decoration → Stand Construction ¹²⁴	customized solutions ³¹ stand construction ⁹⁷ interior construction ²⁴⁰ decoration ⁴⁰⁸⁵ partner ⁴²⁷² interior ⁸⁰⁹³
broodjebab.nl	Broodje BAB	The Broodje BAB website is an online shop where customers can order sandwiches, salads, and Big Tosti's for pick-up or delivery. The website also features a prize wheel and the chance to win.	Sandwiches & Salads → Sandwich Shops ²²⁹	prize wheel ⁴⁰² sandwich ⁴⁰⁹⁸ webshop ⁸⁶⁴⁸ menu ¹³⁸⁵⁶
edwinterlouw.nl	Edwin Terlouw Timmer & Onderhoudsbedrijf	Edwin Terlouw Timmer- and Maintenance Company is a business that focuses on carpentry, renovation, and restoration of homes in Bergambacht and the surrounding area.	Building & Materials → Carpentry & Joinery ⁸³⁰	craftsmanship ¹⁸⁵⁸ carpentry ²²¹⁸ home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹
hbrevet.nl	H.B.Revet & Zn. V.O.F.	H.B.Revet & Zn. V.O.F. is a construction company in the Gouda, South Holland region that undertakes renovations, carpentry and maintenance work.	Installation & Repair → Tradespeople ⁴⁰⁹ Renovation & Restoration → Interior Renovation ⁸⁷⁹	garden furniture ⁵⁷⁸ skylight ⁹⁶⁶ extension ¹⁹⁴¹ window ²⁰³⁰ carpentry ²²¹⁸ renovation ¹³⁸⁴⁹	South-Holland → Gouda ³⁵²¹
infra-rent.nl	Infra-Rent B.V.	The website of Infra-Rent B.V. presents the organization as an independent partner providing asphalt support for the maintenance of public and private infrastructure, primarily through the rental of asphalt finishing machines and associated personnel.	Machine & Equipment → Machine Rental ¹⁹² Civil & Infrastructure → Earthworks ³⁷⁰	asphalt ¹⁶⁵ machine park ⁶⁴² rental ⁷²⁵⁷ maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hetadresomintelijsten.nl	Atelier Lijst in Beeld K5	Atelier Lijst in Beeld K5 is an atelier located in Bergambacht specializing in creating and framing artwork and other images.	Visual Arts → Framing ¹³⁹	hanging system ⁴¹ frame ⁸⁸³ artwork ²²⁴⁸ frames ²⁵⁵⁶
recruitment-marketeers.nl	Recruitment Marketeers	The website Recruitment Marketeers provides specialized services in job marketing, employer branding, and content creation, aimed at improving the effectiveness of recruitment campaigns and strengthening employer brands.	Online Marketing → Recruitment Marketing ¹⁷⁹ Online Marketing → Employer Branding ²⁰²	employer branding ¹⁰ job marketing ¹⁷ content creation ¹⁹⁰ campaign ³⁴²⁸ data ⁵⁸⁷²	Overijssel → Hardenberg ²³⁰⁹
dcmr.nl	DCMR	The DCMR website provides information and services related to environmental inspections, enforcement, and promoting a healthy and sustainable living environment in the Rijnmond region.	Government & Administration → Regional Government ³⁶⁷ Context → Environment ⁵⁴⁴³⁷	enforcement ¹⁰⁷ circular economy ³⁶⁵ permit ⁷⁴⁴ inspection ⁴²⁷⁹ report ⁴⁵⁵¹	Middelburg → City Center ⁹³
veerpas.nl	Veerpas.nl	The Veerpas website provides information about the new electronic boarding pass for the ferries in the region.	Water Transportation → Ferries ¹²⁹ Online & Digital → Online Services ²³⁶⁹	ferry service ¹³ cross ⁸⁸ balance ⁴⁵⁸²	Molenlanden → Kinderdijk ¹⁵⁸
handwerkenzondergrenzen.nl	Handwerken Zonder Grenzen	Handwerken Zonder Grenzen is a magazine focusing on various handcraft techniques and materials from around the world.	Textile Arts → Crafts ⁹¹¹⁷	handcrafts ¹⁰ edition ¹⁵⁷ textile ¹⁴²¹ technique ²¹⁵⁷ article ⁶⁰⁰⁰ shop ⁶⁴⁸³	Oirschot → East-West-and Middle Beers ²¹⁴
smitsauto.nl	Autobedrijf Smits Auto	The website of Autobedrijf Smits Auto offers a wide range of car maintenance services, used car sales, and financing options.	Automotive Maintenance → Vehicle Inspection ¹¹⁰²	used car ⁸²⁵ apk ¹³³³ lease ¹⁵⁹⁵ car ¹⁰⁸⁶⁵ maintenance ²⁰⁰⁹³	Westland → Wateringen ⁵³⁶
kikkersprong.nl	Zwemschool Kikkersprong	Zwemschool Kikkersprong is a training institute that offers swimming lessons to children from 3 years and 9 months old, focusing on safety, fun, and progress.	Swimming → Swimming Lessons ²⁷⁶	student tracking system ²¹ diploma ⁷⁹⁵	Albrandswaard → Poortugaal ²⁰⁶
fysiofitness-bergambacht.nl	Fysio-Fitness Bergambacht	Fysio-Fitness Bergambacht is a company offering physiotherapy and fitness services catering to various needs.	Medicine → Physiotherapy ²³⁷² Sports → Group Class ²⁰⁵¹	rehabilitation ¹⁵¹² fitness ²²⁵¹ schedule ²⁶²⁴ sport ⁴²²⁸ physiotherapy ⁴⁶⁸⁸
degierbv.nl	Loon- and Grondverzetbedrijf De Gier BV	Loon- and Grondverzetbedrijf De Gier BV’s website provides information about their services and projects in the areas of rental work, civil and cultural techniques, and waterworks.	Agriculture → Agricultural Services & Contracting ⁷⁰⁸ Exterior Works → Excavation ³¹⁶	rental work ¹⁶ hydraulic engineering ²³ civil engineering ⁹² excavation ³⁸² construction ⁷⁴²¹	Vijfheerenlanden → Vianen ⁷⁰⁷
voedselbankijsselenlek.nl	Voedselbank IJssel en Lek	The website of the Voedselbank IJssel en Lek provides information about the food assistance offered by the organization in the Krimpenerwaard municipality, specifically targeting people experiencing poverty. It offers information on applications, donations, and volunteer work.	Social Issues → Poverty Prevention ⁵⁵	food bank ²¹⁶ donation ⁵¹¹⁰ municipality ⁶⁸³⁷ volunteer ⁸³⁶⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hondenbrokkenmakers.nl	HondenBrokkenMakers	HondenBrokkenMakers is an organization focused on the adoption, fostering, and support of dogs.	Social Organization → Child Welfare ¹¹⁴⁷ Dogs → Adoption ⁹⁷	foster ²⁴ annual reports ³¹¹ adoption ³⁵⁹ partner ⁴²⁷² dog ⁵⁴⁸³ foundation ⁶⁶⁷⁸	Buren → Beusichem ¹⁶³
deelautovergelijker.nl	Deelauto Vergelijker B.V.	The website compares the prices of various car-sharing providers to help users find the most affordable option.	Mobility → Car Sharing ²⁵ Websites → Comparison Sites ⁸⁶⁹	car sharing ⁵⁵ filters ⁴²⁴ map ⁸⁰¹ provider ¹¹¹¹ route ³⁴²⁵ price ⁸³²⁸	Haarlemmermeer → Badhoevedorp ⁶⁰⁴
petsworldtropika.nl	Petsworld Tropika	Petsworld Tropika is a pet store in Bergambacht that sells everything for pets, horses, and other animals.	Animals → Pet Food ⁵⁸⁴	habitat ⁷⁵ pass ⁹² grooming ⁸⁹⁶ pet ¹⁶¹⁷ food ³⁸⁷² store ³⁹⁰¹
antobeeldengeluid.nl	Anto Beeld en Geluid	Anto Beeld en Geluid is a store in Bergambacht that has been active for over 25 years and focuses on televisions and sound systems from top brands.	Audio → Sound Systems ³⁶ Electronics & Components → Television ²⁶²	return policy ⁷² sound system ¹⁶⁶ television ⁷⁰⁹ assortment ⁷⁷⁹⁹ brand ¹⁷⁷³⁷
leerlingzakenmh.nl	Bureau Leerlingzaken Midden-Holland	Bureau Leerlingzaken Midden-Holland is a government agency dedicated to preventing and reducing school absenteeism among young people aged 12 to 18+, as well as supporting their parents and professionals. The aim is to promote participation in education and support the students' educational pathway.	Educational Policy & Systems → Compulsory Education ¹⁵ Special Needs & Support → Educational Support ²¹⁹⁵	young people ¹⁰⁴⁵ municipality ⁶⁸³⁷ education ¹³⁴⁷¹	Nieuwkoop → North ¹¹⁷
pietersrestaurant.nl	Pieters Restaurant	Pieters Restaurant is a restaurant in Bergambacht with a Michelin star offering culinary arrangements, particularly in the summer.	Outdoor → Terraces ¹⁸⁸ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	bakery ⁷¹⁸ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶
slotenmakerdrs.nl	DRS Lock Specialist	The website is an online advertisement for DRS Lock Specialist, a locksmith service provider operating in various regions of the Netherlands.	Repair → Lock Repair ²⁶⁶ Security & Surveillance → Security ³²⁵¹	locksmith ⁹¹⁹ locks ⁹⁵³ reviews ³¹⁷² security ⁶⁶⁵⁵ repair ¹⁴⁵⁷⁶	Leeuwarden → Bears ¹⁶
blauwebagger.nl	Blauwe Bagger	The website Circulaire Baggeroplossingen \| Blauwe Bagger aims to promote the reuse of dredged material as a sustainable and circular solution for raw materials, highlighting the problems with current extraction practices.	Civil & Infrastructure → Roads ²⁵² Sustainable Building → Dredging ⁴²	circular ³⁶⁹ raw materials ⁴⁴⁶ clay ⁴⁹⁵ sand ⁶³⁰	Rotterdam → Feijenoord ⁴⁷⁷
chiropractievanuithethart.nl	Chiropractie vanuit het hart	The website 'Chiropractie vanuit het hart' offers chiropractic treatments for both children and adults, with a focus on a holistic approach to health and vitality.	Physical Therapy → Chiropractic ⁴²⁰	spinal column ¹⁵ chiropractic ¹⁸⁴ baby ¹⁸⁹⁵ health ⁶³⁶⁶ complaint ⁶⁴⁷⁹	Vijfheerenlanden → Vianen ⁷⁰⁷
renobilia.nl	Renobilia	The Renobilia website is a platform dedicated to the love of classic Renault cars, specifically the Renault Museum and related activities.	Cars → Classic Cars ¹¹⁴⁵ Visual Arts → Museums ²⁰⁴⁹	renault ⁶⁹ rent ⁹⁸¹ museum ²⁰⁰² collection ⁷⁵⁶⁶ car ¹⁰⁸⁶⁵
kappetein.nl	Jan Kappetein	This website provides a genealogical overview of the Kappetein, Kaptein, and Kapteijn families, particularly from the Hoeksche Waard and other regions of the Netherlands.	Genealogy & Family History → Dutch Genealogy ⁷⁰	genealogy ⁵⁴³ name ⁶⁸³ date ¹¹¹² family ⁶⁴⁶² photo ⁷⁷⁷⁸	Hoeksche Waard → 's-Gravendeel ²⁰⁰
carolusbewind.nl	Carolus Bewind	Carolus Bewind is a guardianship and budget management company offering services to individuals in the Krimpenerwaard region and surrounding areas.	Legal → Guardianship ⁸⁷⁹	budget management ²⁸⁰ debt ⁷¹⁷ guardianship ⁷⁶⁷ financial ⁸⁵⁵	South-Holland → Drechtsteden ⁴¹⁶
novaform.nl	KlokGroep	The website of Novaform provides information about the collaboration with KlokGroep and the international activities of the various locations.	Commerce → Wholesale ¹⁸⁵⁵		North-Brabant → Eindhoven ¹¹⁸⁴⁵
denhoed.nl	Den Hoed Aannemers BV	The website of Den Hoed Aannemers BV describes the company and its services related to the restoration, maintenance, and renovation of historical buildings and monuments in the Netherlands.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Monuments → Preservation ³⁷	buildings ⁸⁹⁸ monument ¹¹⁶⁸ restoration ³⁴¹⁷ sustainability ¹⁸⁴⁵¹ maintenance ²⁰⁰⁹³	Alphen aan den Rijn → AWZI Alphen a/d Rijn ³⁵⁸
weidehofkrimpenerwaard.nl	Weidehof Krimpenerwaard	The website of Weidehof Krimpenerwaard presents agricultural nature and landscape management projects and the biodiversity of the Krimpenerwaard.	Green Spaces → Landscape Management ³⁸¹ Nature → Environmental Management ⁵²⁹	wetland bird ²⁷ flora ¹⁷¹ polder ⁴⁷⁶ agriculture ⁷⁷⁸ landscape ²⁶⁰⁹
rijleszonderstress.nl	Rijles Zonder Stress	Rijles Zonder Stress provides driving lessons for all ages and skill levels, focusing on overcoming driving anxiety and offering a stress-free learning environment.	Driver & Vehicle → Driver’s License ¹⁶²⁵	driving anxiety ³³ driving course ³⁹ driving instructor ²⁵² driver’s license ⁴³⁸ theory ⁹⁵⁶ driving lessons ²⁴⁵³	Zaanstad → Zaandam ²⁷⁴⁰
debibliotheekkrimpenerwaard.nl	Library	The website of the library serves as a portal to its collection, activities, online services, and local branches, with a particular focus on summer activities and the BiebBoys Summer Challenge.	Libraries → Local Libraries ⁷⁵ Family Fun → Youth Activities ²⁷³	library ⁹⁸⁸ collection ⁷⁵⁶⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
asbest-sanering.nl	AMF Asbestsanering	The website Asbest-sanering.nl provides asbestos removal and roofing renovation services, focusing on private and business clients, and manages the entire process from application to clearance.	Environmental Technology → Asbestos Remediation ¹⁹¹ Building & Materials → Asbestos ¹²²	shingle ⁴³ asbestos removal ¹³⁴ roof renovation ²⁰⁵ permit ⁷⁴⁴	Zutphen → Warnsveld ²⁵⁵
berkbedding.nl	Berk Bedding	Berk Bedding is a website that sells boxsprings, mattresses, and related accessories.	Beds → Boxsprings ²²⁹ Bedroom → Accessories ⁵⁶	topper ⁹² boxspring ²⁸² mattress ⁸⁹⁹ bedroom ²⁰⁵¹ accessories ¹²⁹⁷⁵
vaneijkinstallatietechniek.nl	Van Eijk Installatietechniek Bergambacht	Van Eijk Installatietechniek Bergambacht is a recognized installer and plumber offering a variety of installation services to private and business customers.	Home Improvement → HVAC Systems ⁷⁷³ Home Improvement → Plumbing ²⁷³³	climate system ⁷⁸ sustainable ⁷³⁹ boiler ¹²⁴⁰ plumbing ¹⁷⁶¹ air conditioning ²¹⁷⁸
grzplus.nl	GRZPLUS	GRZPLUS is an initiative that collaborates to improve the rehabilitation and recovery of elderly individuals by sharing knowledge and working together.	Specific Institutions → Hogeschool Van Amsterdam ¹⁸ Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹	healthcare professionals ²³⁵ symposium ³³⁹ rehabilitation ¹⁵¹² patient ⁴⁰⁸² research ⁸⁹⁶⁷ care ¹²³³⁸	Amsterdam → Southeast ⁸¹⁵
speksnijder.nl	Speksnijder Mode	Speksnijder Mode is a clothing store with shops in Bergambacht and Veenendaal, which also sells clothing online and specializes in festive fashion for men and women.	Fashion & Lifestyle → Television Programs ⁵⁶ Fashion → Men’s Fashion ⁶⁹⁰	fashion ²²¹² shop ⁶⁴⁸³ collection ⁷⁵⁶⁶ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	Utrecht → Veenendaal ²⁶⁴¹
ultimabedden.nl	ultimabedden.nl	The website offers handcrafted mattresses, boxsprings, and headboards, with a focus on ergonomic advice and personalized customization.	Bedding → Mattresses ⁴⁰²	headboard ²⁵ boxsprings ¹⁵⁵ mattress ⁸⁹⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
partytentverhuur-groenehart.nl	Partytentverhuur Groene Hart	The website Partytentverhuur Groene Hart offers party tents, easy-up tents, and other event rental products in the region of the Groene Hart, providing delivery and setup services and expert advice.	Event Rental → Tent Rental ⁴³⁷	lighting and sound ²⁰ party package ³⁶ heater ¹⁸⁴ party tent ²⁵⁶ table ¹⁷⁷⁸	Lansingerland → Bleiswijk ⁵⁷⁹
crimpenerwaert.nl	Crimpenerwaert Dierenartsen	Crimpenerwaert Dierenartsen is a veterinary practice providing animal care in the Krimpenerwaard region and surrounding areas.	Primary Care → Veterinary Medicine ⁷⁰⁴ Veterinarians → Veterinary Clinics ⁴¹⁹	veterinarian ⁸⁶⁴ animal ²⁹⁰⁸ practice ⁹⁰⁸⁹ care ¹²³³⁸	Zuidplas → Moordrecht ³³²
slibbank.nl	Slibbank	The Slibbank website offers services in the area of soil flows, soil research, waste management and logistics, with a focus on the reuse and sustainability of raw materials and waste streams. The organization facilitates project management and provides specialized advice, including PFAS advice and Japanese knotweed research.	Civil & Infrastructure → Earthworks ³⁷⁰ Environment → Waste Management ²⁶⁸⁰	soil research ⁴⁹ waste stream ¹¹⁰ soil ⁹³⁰ logistics ³²⁵⁷	Alphen aan den Rijn → Benthuizen ¹⁷⁹
bezemerbouw.nl	Bezemer Bouw B.V.	The website of Bezemer Bouw presents the company as a reputable construction firm with over a century of experience, specializing in new construction, renovation, and redevelopment of buildings, emphasizing quality, speed, and sustainability.	Real Estate → Project Development ⁶³³ Industry → Industrial ¹⁹⁸⁷	redevelopment ⁹³ construction project ⁷⁰¹ new construction ²⁶⁷² home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
bijonsaandehem.nl	Bij ons aan de Hem	The website presents a unique bed and breakfast, 'Bij ons aan de Hem', located in the polder of Bergambacht, offering accommodation and relaxation to visitors.	Accommodation → Beds ²²⁸ Food → Local & Regional Products ⁹³⁰	farm shop ²⁰⁴ polder ⁴⁷⁶ b&b ¹⁰⁶⁰ wellness ¹⁵⁶¹ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹
veerdienst-bergstoep.nl	B.V. Veerdienst Bergstoep	The website of B.V. Veerdienst-Bergstoep provides information about the ferry service between Bergambacht and Groot-Ammers/Streefkerk, including details about fares, schedules, and vehicle options.	Water Transportation → Ferries ¹²⁹ Bus Services → Public Transportation ⁷⁸²	fare ⁸⁶ ferry ¹⁷⁹ traffic ⁹¹⁶ schedule ²⁶²⁴ vehicle ³⁷⁴³	Molenlanden → Groot-Ammers ¹⁵⁸
jongenhoeve.nl	Kaasboerderij Jongenhoeve	Kaasboerderij Jongenhoeve is a farm producing and selling traditional Gouda cheese.	Farms & Farm Businesses → Cheese Farms ³⁶ Tourism → Rural Tourism ⁵⁹	milk ⁴²¹ taste ⁹³³ cheese ¹²⁰⁵ farm ²⁶²² shop ⁶⁴⁸³ history ⁷²⁸⁶	South-Holland → Gouda ³⁵²¹
zorgvoordier.nl	ZorgvoorDier	ZorgvoorDier is a company offering professional pet care services at home, including cat sitting, pet sitting, and grooming.	Animals → Animal Care ¹⁸⁴⁹	cat sitting ²¹ pet sitting ³⁶ grooming ⁸⁹⁶ pet ¹⁶¹⁷	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
homeopathiebergambacht.nl	Visie Homeopathie	The website of Marije Rappoldt-Smits is an online practice for classical homeopathy in Bergambacht, offering homeopathic treatments for the whole family.	Alternative Medicine → Homeopathy ⁶²⁷	homeopathy ⁵²⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³
garagewestland.nl	Garage Westland	Garage Westland is an auto dealership located in Wateringen that offers a wide range of automotive maintenance and repair services, including vehicle inspections, tire sales, and used car sales, and is known for its customer-friendliness and fixed prices.	Tires → Tire Service ⁹³¹ Maintenance & Services → MOT ⁵⁹	mot ⁸⁰⁶ used cars ⁸⁹⁴ tire ¹⁹⁷⁵ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Westland → Wateringen ⁵³⁶
drukkerijendrukwerk.nl	drukkerijendrukwerk.nl	The website provides an overview of printing companies and print shops in the Netherlands.	Directories → Websites ³⁴⁷³ Design & Creative → Graphic Services ¹⁰⁰³	printing companies ¹⁴ town ¹²⁶ province ⁵¹⁸ address ⁹⁰¹ print ⁵⁵¹¹	Westerwolde → Blijham ⁶²
gouda-loodgieter.nl	Folstra B.V.	Folstra B.V. is a plumber and installation company serving Gouda and the surrounding area.	Home Improvement → Plumbing ²⁷³³	pipework ⁸⁴ sanitary ⁷⁵⁰ leak ¹²⁰⁴ drainage ¹³²² heat ²¹⁸⁸ installation ¹³⁷⁴²	Oudewater → Papekop ²⁷
inekeweevers.nl	Ineke Weevers	The website of Ineke Weevers showcases her artwork, exhibition locations, and membership of the Kunstenaars Collectief Breekijzer.	Galleries → Individual Galleries ⁵¹ Painting → Acrylic Painting ⁵⁴⁷	paintings ³⁹⁰⁷ exhibition ⁵³³² artist ⁵⁷⁴⁵ photography ⁹⁵⁰³	Oude IJsselstreek → Ulft ³⁹²
hof21.nl	Brasserie Hof21	The website of Brasserie Hof21 is an online presence of a brasserie located in Bergambacht, focused on offering food, drinks, and a welcoming atmosphere to visitors.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Food & Dining → Outdoor Seating ²²⁸	brasserie ⁷⁵² reservation ³³⁷³ atmosphere ⁵⁵⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
agbbouw.nl	AGB Bouw	The website of AGB Bouw presents the company as an ambitious builder based in Stolwijk, specializing in building functional buildings for diverse clients.	Renovation & Restoration → Construction Industry ⁴⁹⁹	buildings ⁸⁹⁸ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Stolwijk ²³²
prokrimpenerwaard.nl	Pro Krimpenerwaard	Pro Krimpenerwaard is a political party dedicated to creating an honest, sustainable, social, and animal-friendly Krimpenerwaard.	Local Politics → Parties ⁶²² Local Politics → Political Parties ⁸⁹⁸	motion ⁹⁴ municipality ⁶⁸³⁷ research ⁸⁹⁶⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dezorgendehand.nl	Thuiszorg de Zorgende Hand	Thuiszorg de Zorgende Hand is a care organization that provides various forms of care, focused on supporting people to maintain their independence.	Social Services → Youth Support ⁵³⁰ Health → Medical Care & Services ²⁹⁴⁶¹	flexibility ⁹⁹⁶ provider ¹¹¹¹ care ¹²³³⁸	Zuidplas → Moordrecht ³³²
amolenaar.nl	A. Molenaar B.V.	The website of A. Molenaar is a company specializing in ground, road, and water construction services, including soil remediation, paving, groundwork, sand and gravel delivery, and the preparation of building sites.	Civil & Infrastructure → Ground ¹²⁰	sewer ²⁴⁶ ground ²⁸⁶ sand ⁶³⁰ groundwork ¹³⁴⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
zorgboerderij-bijdehem.nl	Zorgboerderij ‘Bij de Hem’”	The website of Zorgboerderij ‘Bij de Hem’ provides information about a care farm offering small-scale day care for young people, adults, and seniors, with a focus on meaningful work, social connections, and relaxation in nature.	Farms & Farm Businesses → Care Farms ⁴⁷³ Disability Services → Day Programs ³⁰⁵	social connection ³⁵ care farm ²⁴⁶ staff ³⁴⁰⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
uwbegrafenisverzorger.nl	Speksnijder Begrafenisverzorging	Speksnijder Begrafenisverzorging is a funeral home providing support to bereaved families in the Krimpenerwaard & Gouda region, focusing on arranging dignified funerals.	Death → Funerals ⁵⁵² Family → Funeral Services ²⁰⁸⁴	bereaved ²⁹¹ farewell ¹¹⁰⁹ grief ¹⁵⁷⁷ funeral ²⁴⁷⁷	South-Holland → Gouda ³⁵²¹
pannenkoekenrestaurantonderdemolen.nl	Scheer Family	Pannenkoekenrestaurant Onder de Molen is a restaurant located in Bergambacht that serves traditional Dutch pancakes and offers catering services.	Family & Themed Dining → Pancakes ⁴⁹ Family & Themed Dining → Pancake Restaurants ¹⁶⁶	pancakes ⁵⁶⁸ drink ⁵¹⁹¹ party ⁵⁹²⁸ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶
picknickbakfiets.nl	Picknickbakfiets	The website of ‘Picknickbakfiets’ offers a unique picknick experience, providing a convenient bike with picknick supplies for rent.	Cycling → Electric Bikes ⁴⁴⁵ Cycling → Bicycle Rental ⁶⁴³	basket ²⁷⁵ polder ⁴⁷⁶ bike ¹⁵⁴¹ route ³⁴²⁵	Midden-Groningen → Zuidbroek ¹⁸⁴
denhaesell.nl	Hannie van Haselen	The website of Bed & Breakfast 'den Haesell' presents a country-located bed and breakfast in Bergambacht, featuring two apartments and descriptions of the surrounding area and amenities.	Nature → Cycling ⁴⁷² AccommodationTypes → Other Accommodation ¹⁷²	bed & breakfast ³¹⁹ apartment ⁵⁰⁸⁸	Molenlanden → Kinderdijk ¹⁵⁸
molendenarend.nl	Molen den Arend	The website of Molen den Arend presents information about the history, management, opening hours, and offerings of the historic windmill, including the mill shop and events.	Historical Sites → Windmills ¹⁰⁰ Cultural Heritage → Historic Landmarks ¹⁹	millshop ²⁰ windmill ²⁴⁹ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹
heijmanswoningontruiming.nl	Heijmans Woningontruiming	The website of Heijmans Woningontruiming offers professional services for residential and commercial property clearance throughout the Netherlands, including specialized services such as estate clearance, post-mortem clearance and the purchase of household goods.	Home Services → Clearance ²⁸⁰ Moving & Storage → Moving ¹²⁸⁹	household goods ¹⁴¹ clearance ³⁴⁹ move ¹⁴⁴¹ transport ⁶¹⁰⁵ quote ¹²⁸⁶³	Maastricht → Maastricht-Southeast ¹¹³
kooronomatopee.nl	Vocal Ensemble Onomatopee	The Vocal Ensemble Onomatopee website showcases the repertoire, upcoming performances, and contact information of an enthusiastic singing ensemble.	Film → Production Companies ⁴⁰⁶	footage ⁴⁸ ensemble ⁵⁴⁶ repertoire ²⁴⁹⁷ arrangement ³¹⁰⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶	Alphen aan den Rijn → Hazerswoude-Rijndijk ²³⁵
vanegmondmakelaardij.nl	Van Egmond Makelaardij B.V.	Van Egmond Makelaardij B.V. is a real estate agency specializing in the purchase and sale of homes and commercial properties in the Krimpenerwaard region. The website aims to help clients find their ideal home or successfully sell their current property through tailored solutions.	Property Finance → Purchase ⁴⁹³ Property Agents & Brokers → Brokers ³⁵⁶	stock ¹¹⁵⁴ value ¹³⁵² appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ house ⁸¹²¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
verdo.nl	Verdo Staal	The Verdo Staal website showcases the company and its services related to steel construction and buildings.	Building & Materials → Steel & Metal ⁷⁷⁹ Fabrication & Production → Fabrication ⁹³	detail ⁶³⁸ buildings ⁸⁹⁸ steel ¹¹⁷⁷ truck ¹⁴¹²
bijmargo.nl	Margo SLAPEN EN ONTBYTEN	Margo Slapen en Ontbijten is a bed & breakfast located in Bergambacht, operating from a renovated farmhouse.	Accommodation → Guesthouses ⁷²⁶ Accommodation → Lodging ³¹⁷	bed and breakfast ³⁰⁵ sleep ⁷⁴⁶ farmhouse ⁸⁷⁸ guest ¹³³⁴ walk ²¹⁶¹ nature ⁹⁰⁹⁴	Midden-Groningen → Zuidbroek ¹⁸⁴
steunpunt-middenholland-rijnstreek.nl	Parent and Youth Support Point Midden Holland and Rijnstreek	The Parent and Youth Support Point for Midden Holland and Rijnstreek provides information and answers to questions about appropriate education (passend onderwijs) for primary and secondary education in the Gouda region, including Alphen a/d Rijn, Krimpenerwaard, and Waddinxveen.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹ Curriculum & Resources → Educational Resources ⁴⁰¹	chat ⁵⁴⁴ question ²²⁶¹ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Nieuwkoop → North ¹¹⁷
dietz.nl	Dietz	Dietz is an advisory firm specializing in spatial issues and citizen participation in decision-making.	Architecture → Urban Planning ¹⁴⁶⁵ Community → Government & Administration ¹⁰⁵⁶⁷	spatial issues ¹⁰ decision making ⁴⁰ participation ¹⁴³⁰ strategy ⁹³⁷⁹ communication ¹⁰¹⁶²	The Hague → City Center ⁴⁴⁵
totalharmony.nl	Total Harmony	The website Total Harmony is a practice offering naturopathic therapies, nutritional advice, massage and health coaching, aiming to help people become fitter and more vital, and to treat and prevent chronic ailments.	Alternative Medicine → Complementary Therapies ⁸⁵⁸	wellness ¹⁵⁶¹ vitality ¹⁷²⁶ nutrition ⁴⁹³⁵ complaint ⁶⁴⁷⁹ therapy ⁷⁴⁴⁸ massage ⁷⁶⁴⁶
my-lex.nl	MY-LEX	MY-LEX provides a comprehensive content integration search engine and solutions for managing the entire document lifecycle.	Business Software → Document Management ³²⁸ IT → Software Services ⁵⁹	search engine ⁵³⁶ integration ¹⁴⁵¹ document ¹⁶⁷⁸ archive ²⁰⁶⁷	The Hague → City Center ⁴⁴⁵
demengelmoestuin.nl	MengelmoesTuin	The website of the MengelmoesTuin presents the activities, products, and location of a natural fruit and herb garden that is present at various markets and events.	Plants → Nurseries ¹⁰¹²	harvest ²⁷⁵ herbs ⁹²⁴ market ²⁷⁷² newsletter ⁶⁵⁰⁴ garden ¹³¹²⁹	Zeist → Huis ter Heide ³⁸
elannotarissen.nl	Elan Notarissen	Elan Notarissen is a notary office providing expert legal advice and services to individuals and businesses, including wills, estate planning, and the drafting of purchase agreements.	Inheritance Law → Wills ²⁰⁰ Law → Business Law ¹³⁶¹	llc ¹³ purchase agreement ⁵⁶ estate planning ⁹³ will ⁵¹⁰ notary ⁷⁹¹ mortgage ⁴⁵⁶⁴	De Wolden → De Wijk ⁹⁶
thorvolleybal.nl	Volleybalvereniging THOR Bergambacht	The website of Thor Volleybal Vereniging Bergambacht provides information about the volleyball association, including membership, teams, events, and contact details.	Volleyball → Volleyball Associations ⁷²	volleyball association ⁴² youth ³¹²⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴²
amadeushuis.nl	Amadeushuis	The Amadeushuis provides small-scale residential care for elderly individuals with dementia, with music as a central theme, focused on preserving personal lifestyles and creating a warm, familiar environment.	Elderly Care → Dementia Care ⁴¹ Care → Residential Care ³⁰⁵	dementia ⁶⁷⁴ studio ⁵⁴⁶⁵ home ⁷⁹⁷⁶ care ¹²³³⁸ music ¹³¹⁷⁰	Lansingerland → Bergschenhoek ⁵⁶⁸
verloskundigenpraktijkbevaltbeter.nl	Bevalt Beter	Bevalt Beter is a midwifery practice that supports pregnant women and women who wish to become pregnant.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	breastfeeding ³⁹⁸ midwife ⁵⁵³ ultrasound ⁷⁶⁹ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹	Krimpenerwaard → Berkenwoude ⁶²
vesuvio.nl	Il Vesuvio	The website of Pizzeria Il Vesuvio presents the historic pizzeria in The Hague, with a mobile pizza wagon that also sells pizzas at various locations.	Essential → Food ⁴⁷⁹⁹⁹	pizza ⁴¹⁵⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Berkenwoude ⁶²
autoschadezijdepark.nl	ASN Autoschade Zijdepark	ASN Autoschade Zijdepark Bergambacht is an auto body repair shop that quickly and efficiently handles damage to passenger cars and company vehicles.	Auto Repair Services → Dent Repair ¹⁸⁶ Manufacturing & Industrial → Industrial Services ⁴⁰⁰	damage ¹⁵⁶² transportation ²⁸⁵¹ insurance ⁶³⁵⁹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶
ekb-nl.nl	EKB Container Logistik Nederland B.V.	EKB Container Logistics Netherlands is a logistics company specializing in container transport across Europe.	Freight & Shipments → International Logistics ¹⁰⁷	inland waterway ⁶⁹ rail ¹⁹⁹ europe ²⁸⁹ container ¹⁷⁰⁹ transport ⁶¹⁰⁵	South-Holland → Rotterdam ²⁵⁰⁴⁸
josedonatzafscheidsfotografie.nl	José Donatz Afscheidsfotografie	The website of José Donatz Afscheidsfotografie offers professional photo recordings of funerals, aiming to help bereaved families honor and capture the farewell of a loved one.	Death → Funerals ⁵⁵²	farewell photography ¹³ photo report ⁵⁶ funeral ²⁴⁷⁷
marketingkaart.nl	Marketingkaart	The website, Marketingkaart, provides an overview of 500+ Dutch marketing professionals and helps users quickly find a marketing agency that meets their needs.	Online Marketing → Affiliate Marketing ²⁹⁹ Business Development → Business Marketing ⁶¹⁴	marketer ⁴² compare ⁵⁸² agency ⁹⁴⁴ marketing ⁷¹⁰⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
taxicentraleappie.nl	Taxicentrale Appie	The website of Taxicentrale Appie in Gouda offers reliable and affordable taxi and transportation services, both locally and to international destinations via Schiphol Airport, and serves specific transportation needs such as school transportation and business travel.	Taxi & Ride Services → Taxi ¹⁰⁶² Specialized Transport → Business Transportation ²³¹	taxi ²⁰⁹⁰ rate ²⁶⁰⁶ transportation ²⁸⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
nana.nl	NANA Groen-Wonen	The website of 'NANA Groen-Wonen' is a florist shop offering a wide range of flowers, plants, and related items, specializing in occasion flowers, funeral flowers, bridal flowers, and corporate flowers, located in Bergambacht.	Flowers → Florists ¹⁴¹⁰	bridal ⁹⁶ pottery ¹⁵² facebook ⁸⁵⁰ funeral ²⁴⁷⁷ flowers ³²⁴⁸ home ⁷⁹⁷⁶	Krimpenerwaard → Berkenwoude ⁶²
accountantkaart.nl	Accountantkaart	The website Accountantkaart presents a top 500 of Dutch accountants.	Apps → Business Apps ¹⁰ Accounting → Service Providers ⁶³	accountant ⁶¹¹ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
bobdenboer.nl	DitchWitch B.V.	The website describes the activities of a company specializing in horizontal drilling underground, primarily between cables and pipelines in the Netherlands.	Construction Technology → Drilling ⁷¹	pipeline ²⁰⁴ drill ³⁰³ cable ⁷³² machine ³⁷²⁷	North-Holland → Zandvoort ¹²⁹⁸
dietistenpraktijkkuiperbesten.nl	Dietistenpraktijk De Kuiper & Den Besten	The website of Dietistenpraktijk De Kuiper & Den Besten is a practice offering nutrition advice and treatment plans for various health issues and lifestyle questions, with a focus on personalized guidance and flexible appointments.	Medical Care & Services → Nutrition ⁵⁷⁹⁹ Health → Disease & Treatment ⁴⁸⁰⁵	treatment plan ³⁸⁰ diet ⁷⁴⁷ lifestyle ²⁹¹⁸ practice ⁹⁰⁸⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
elsvandenboogaard.nl	Els van den Boogaard	The website of Els van den Boogaard showcases her paintings and provides an overview of past exhibitions. It offers insight into her artistic portfolio and the locations where her works have been displayed.	Painting → Oil Painting ³²⁶ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	oil painting ¹⁹ abstracts ²⁸ acrylic ⁵⁰⁶ landscape ²⁶⁰⁹ paintings ³⁹⁰⁷ exhibition ⁵³³²	Hoeksche Waard → 's-Gravendeel ²⁰⁰
bakkerarkel.nl	Bakker Arkel Bouwbedrijf	The website of Bakker Arkel Bouwbedrijf presents the profile of a family-owned construction company specializing in (new) construction, renovation, and maintenance of real estate, primarily in West Netherlands.	Construction Companies → Construction Contractors ⁵³⁶	real estate ⁴⁹⁸¹ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹ collaboration ¹⁶⁰³⁶ maintenance ²⁰⁰⁹³	Schiedam → Schiedam Center ⁵²
aannemersbedrijfklapwijk.nl	Klapwijk Aannemersbedrijf	Klapwijk Aannemersbedrijf is a construction company specializing in new construction, extensions, renovations, maintenance, and remodeling of residential and commercial buildings.	Construction Companies → Additions ⁴⁵⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	extension ¹⁹⁴¹ new construction ²⁶⁷² roofing ²⁸⁰⁶ tile ²⁸⁶⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
zangeralex.nl	Alex	The website of Alex, a Dutch party artist, presents his event schedule, music releases, and an overview of his 25-year anniversary show. It also provides information about events where he performs.	Popular → Pop ²⁹⁹ Theater → Performances ⁶⁴⁹	playlist ²³¹ schedule ²⁶²⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
bergambachtoptiek.nl	Bergambacht Optiek	Bergambacht Optiek is an optician specializing in personalized eye care services.	Specialty Medicine → Optometry ⁵³⁹ Services → Opticians ⁵⁵¹	eye measurement ²³² eye care ²³³ eyeglasses ⁴³⁷ contact lenses ⁵³⁸ appointment ¹³⁵¹⁰
bzc-bergambacht.nl	BZC Bergambacht	The website of BZC Bergambacht provides information about the water polo club, including membership details, sporting activities, swimming lessons, and contact information.	Sports Clubs → Water Polo ²¹⁹ Swimming → Swimming Clubs ²⁴²	swimming lesson ³⁹³ match ³⁴⁷¹ webshop ⁸⁶⁴⁸ membership ¹⁰⁴⁴²
hoeksesluis.nl	Belevenisboerderij De Hoeksesluis	De Hoeksesluis is a farm experience farm offering hospitality, respect for nature and various activities.	Accommodation → Beds ²²⁸	farm ²⁶²² animal ²⁹⁰⁸ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
aandedijck.nl	Restaurant and bar Aan de Dijck	The website aims to inform visitors about restaurant and bar 'Aan de Dijck', a hospitality establishment in the Krimpenerwaard, and to offer the possibility of reservations, viewing the menu, and seeing upcoming events.	Bars → Pubs ⁵⁴⁶	hostess ¹⁶⁵ bar ¹²¹⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
eetcafebergambacht.nl	Eetcafe 't Centrum	Eetcafe 't Centrum is a restaurant located in Bergambacht offering a welcoming and cozy atmosphere.	Cafes & Lunch → Local Restaurants ²⁹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	soup ¹⁰⁴³ buffet ¹⁷⁴⁷ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶
nabilsbarbershop.nl	Nabil’s Barbershop	Nabil’s Barbershop is a modern barbershop in Bergambacht that focuses on providing stylish haircuts and good service.	Men’s Grooming → Barbers ³⁹³ Services → Personal Services ¹⁰⁶²	look ¹⁶⁹ barber ⁴¹⁸ beard ⁴⁶⁸ haircut ¹¹⁵⁸ treatment ²¹²⁰³
slapenindepolder.nl	Slapen in de Polder	Slapen in de Polder is a Bed and Breakfast (B&B) offering holiday homes in the Krimpenerwaard.	Landscape → Polders ²¹² AccommodationTypes → Holiday Rentals ²⁰	e bike ⁴⁰ polder ⁴⁷⁶ peace ¹¹¹³ holiday home ²⁷⁵³ terrace ⁴⁸⁴⁷ kitchen ⁶⁴⁴³	South-Holland → Rotterdam ²⁵⁰⁴⁸
oskamschoenen.nl	Oskam shoes	The Oskam shoes/sport/clothing website presents a wide assortment of shoes, sportswear, and clothing for women, men, and children.	Clothing → Activewear ⁶⁴² Fashion → Shoes ¹²⁷⁴	sportswear ³⁵² shoes ²⁶⁹⁹ assortment ⁷⁷⁹⁹ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷
houdijkdenboer.nl	Loonbedrijf Houdijk den Boer BV	Loonbedrijf Houdijk den Boer BV is a rental and service company operating in the GGW, sports fields, and horticulture sectors.	Relationships → Partnerships ⁴⁸¹ Logistics & Transportation → Rental Companies ⁴¹⁴	path ⁴⁶⁶ level ⁴⁹⁴ machine ³⁷²⁷ rental ⁷²⁵⁷
topkamerverhuur.nl	Topkamerverhuur.nl	The website offers a network of rental rooms in the Netherlands.	Rental Properties → Rooms ¹⁰² Energy & Sustainability → National Websites ¹¹	landlord ²⁶⁷ database ¹¹⁵³ room ³⁴¹¹ rental ⁷²⁵⁷	Bunschoten → Bunschoten-Spakenburg ³⁸²
112krimpenerwaard.nl	Krimpenerwaard Municipality	The website provides ambulance call logs from the Krimpenerwaard municipality and surrounding areas.	Emergency Services → Fire Department ¹³⁸ Health → Medical Care & Services ²⁹⁴⁶¹	ambulance ¹⁷⁸ call ²⁰⁴ emergency ⁷⁵⁰ municipality ⁶⁸³⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
deguldenvrijheid.nl	Buurtvereniging De Gulden Vrijheid	The website of De Gulden Vrijheid neighborhood association presents information about the activities and events that the association organizes for the neighborhood of Opperduit.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Community & Social → Community Activities ⁵²	neighborhood ²⁴²⁴ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
hervormdbergambacht.nl	Hervormde Gemeente Bergambacht	The website of the Bergambacht Reformed Congregation provides information about the church, its activities, services, and contact details.	Reformed → Dutch Reformed Church ²¹⁹ Protestantism → Churches ¹⁰⁰⁹	pastoral care ¹²² mission ¹⁰⁰⁰ church ³⁴³⁹ app ⁴⁵⁹⁵ collection ⁷⁵⁶⁶
bos-grotematenmode.nl	Bos Grote Maten Mode	Bos Grote Maten Mode is an online store specializing in clothing for men with larger sizes, particularly those who are tall and/of stout.	Fashion → Men’s Fashion ⁶⁹⁰ Context ¹⁶¹³⁹⁴	men's clothing ¹⁸ size ⁸⁰⁰ assortment ⁷⁷⁹⁹ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷
publiquest.nl	Publiquest	Publiquest is a communication bureau established in 2016 as a strategic collaboration between three leading communication agencies. The agency focuses on strategy, dialogue, and participation to make complex issues, such as elder abuse, visible.	Writing → Copywriters ⁶³² Communication → Science Communication ⁶⁸	dialogue ⁴²⁶ strategy ⁹³⁷⁹ communication ¹⁰¹⁶²	Rotterdam → Feijenoord ⁴⁷⁷
bijlfietsen.nl	Bijl Tweewielercentrum	Bijl Tweewielercentrum is an e-bike specialist offering a wide range of electric bikes and accessories in Bergambacht.	Auto Parts & Tires → Wheels ⁵⁴⁵ Cycling → Electric Bikes ⁴⁴⁵	e-bike ⁹⁰⁸ bike ¹⁵⁴¹ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷	Utrecht → Lopik ⁴⁶⁴
overslagbergambacht.nl	Overslag Terminal Bergambacht B.V.	The website of Overslag Terminal Bergambacht (OTB) presents the services and activities of a family-run business specializing in inland waterway and road freight transport in the Hollands Midden region.	Transportation Services → Freight Transport ³⁷⁸ Administrative Support → Family Businesses ⁶⁶⁴	load ¹³⁶ container ¹⁷⁰⁹ storage ²⁴⁴⁶ transport ⁶¹⁰⁵	South-Holland → Rotterdam ²⁵⁰⁴⁸
mdewitte.nl	Bouwkundig Bureau M. de Witte	The website of Bouwkundig Bureau M. de Witte provides architectural services, including drawings, permits, advice, and structural calculations, primarily focused on the Krimpenerwaard and Rotterdam regions.	Visual Arts → Drawing ¹⁰⁴⁶ Engineering → Engineering Firms ⁹⁸⁹	structural calculation ³⁶ permits ⁶⁴³ drawings ¹³²⁹ budget ¹³³⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
slagerijfredvanlaar.nl	Slagerij Fred van Laar	The website of Slagerij Fred van Laar presents the products and services of a traditional butcher shop and catering service, located in Bergambacht, with a focus on quality, traditional preparation, and a wide range of products.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Dairy & Cheese → Delicatessens ⁶¹⁷	sausage ²⁵⁶ meal ¹⁶³⁸ meat ²⁰⁵⁵ promotion ²⁰⁶² catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹
ababanden.nl	ABA Banden	ABA Banden is a specialist in Stolwijk providing a wide range of tires, wheels, and truck tires for customers in the region.	Tires → Tire Service ⁹³¹ Auto Parts & Tires → Wheels ⁵⁴⁵	truck tires ¹⁵ wheel ⁷⁴⁶ tire ¹⁹⁷⁵ car ¹⁰⁸⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kyaros.nl	Kyaros	Kyaros is a luxury cat resort and grooming salon located in Krimpen aan de Lek, Netherlands, offering temporary accommodation and care for cats.	Dog Care → Grooming Salons ⁶⁵¹ Accommodation → Pet Hotels ⁸⁹	grooming salon ²⁶³ resort ²⁷⁹ accommodation ⁴⁹²¹ care ¹²³³⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
haptonomie-gouda.nl	Christine Bak	The website provides information about haptotherapy and haptonomic pregnancy guidance offered by Christine Bak in Gouda, focusing on restoring balance and guiding through pregnancy and loss.	Therapy → Haptotherapy ⁶³³ Health → Pregnancy & Childbirth ⁴²²²	haptonomy ¹²¹ haptotherapy ⁴⁴⁴ loss ⁷⁴⁰ pregnancy ²⁷³⁹	Zuidplas → Moordrecht ³³²
deleerhulp.nl	De Leerhulp	De Leerhulp is an organization that provides support and guidance to students in primary and secondary education.	Educational Support → Student Guidance ¹³⁴ Learning Disabilities → Dyslexia ⁴³⁸	atmosphere ⁵⁵⁹¹ research ⁸⁹⁶⁷
iconsult.nl	iConsult	iConsult offers a software package (SnelStart) for invoicing and accounting, including installation, support, and integration with other systems.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Invoicing Software ¹⁰⁴	snelstart ¹⁶ invoice ⁷⁹⁵ integration ¹⁴⁵¹ account ⁵⁷⁸¹
campingdebovenstad.nl	Camping de Bovenstad	Mini-camping de Bovenstad is a rural campsite located in the Green Heart of Holland, near the river Lek, offering camping facilities to guests.	Cycling → Bicycle Rental ⁶⁴³ Tourism → Rural Tourism ⁵⁹	shower ²⁷⁰ river ³¹² caravan ¹³⁹⁴ bike ¹⁵⁴¹ campsite ²⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
daginfo.nl	Daginfo.nl	Daginfo.nl is a website that provides an overview of local, regional, and national news.	Providers → Domain Names ¹⁴⁶⁶ News & Journalism → News Websites ³⁴⁰	overview ³²⁹ domain ¹⁸¹¹ region ⁵⁴¹² news ¹⁵²⁹³	Montfoort → Linschoten ¹⁶⁹
smash-tennis-padel.nl	Smash Tennis & Padel	The Smash Tennis & Padel website offers a wide range of tennis and padel courses and clubs for various levels and ages, focusing on both performance and recreation.	Tennis → Padel ⁸⁸⁰	padel ⁶⁰² tennis ⁸³⁶ club ⁴²²⁵ lesson ⁵¹⁵⁴ course ¹⁴⁷²⁸	Midden-Delfland → Maashorst ²⁷⁵
meetbureauwindroos.nl	Meetbureau Windroos	Meetbureau Windroos provides professional surveying and building measurement services for various construction projects.	Technology & Innovation → Construction Technology ⁷⁹⁰	volume ¹⁶⁶ dimension ²¹⁶ survey ³⁷⁰ measurement ⁷³¹	South-Holland → Sliedrecht ⁸⁶³
staal2000.nl	Staal2000	The website of Staal2000 presents the company as a specialist in the calculation, engineering, delivery, and assembly of steel structures, with over 35 years of experience in the metal industry and a focus on reliability and customer service.	Metals & Fabrication → Metals ⁴⁸⁶ Assembly & Production → Assembly ²²⁷	steel structure ²⁰⁸ job vacancies ¹²⁴¹ engineering ¹⁴⁶⁸ assembly ¹⁷³³	Krimpenerwaard → Gouderak ¹⁰³
keukenstyl.nl	KeukenStyl	KeukenStyl is a complete kitchen solution, offering design and purchase services to help customers create their dream kitchens.	Kitchen → Kitchen Design ⁴⁴³ Kitchen & Dining → Kitchen Shops ¹⁵	advisor ¹⁰⁵⁵ style ²³⁴⁸ wishes ²⁷¹⁷ equipment ⁴¹⁴³ kitchen ⁶⁴⁴³ design ²⁷²⁰²	Emmen → Klazienaveen ²⁹⁷
avvhoveniers.nl	AVV Hoveniers	AVV Hoveniers is a landscaping company offering services for garden design, landscaping, maintenance, and related work, such as paving, planting, and boundary demarcation.	Outdoor & Garden → Landscape Companies ³³⁹	garden maintenance ⁴⁶² garden design ⁹⁶⁴ landscaping ¹⁵²⁹ paving ¹⁹⁴²	Buren → Beusichem ¹⁶³
makelaaroverzicht.nl	HuisVerkopen.nl	The website provides an overview of real estate agents in the Netherlands and information about selling and buying houses.	Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴ Boats → Selling ²⁰	buy ¹⁶⁹ sell ²³⁰ agent ¹²⁵³ valuation ²⁶⁹⁷ house ⁸¹²¹	Simpelveld → Bocholtz ⁷⁰
zontec.nl	Zontec	The Zontec website provides information and offers sustainable solar energy solutions for businesses and private individuals, including advice, installation, and maintenance.	Energy & Sustainability → Energy Consulting ⁸⁸³	roof ³⁶⁶² solar panels ⁴⁷⁰¹ quote ¹²⁸⁶³ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Rheden → Velp ⁷⁰⁰
bosbedrijfskleding.nl	Bos Bedrijfskleding	Bos Bedrijfskleding is a supplier of workwear and business attire, offering a wide range of products and customization options.	Clothing → Workwear ¹⁰⁰¹ Commerce → Textile Retail ¹³⁷	attire ¹⁷ workwear ⁸⁵¹ shoes ²⁶⁹⁹ print ⁵⁵¹¹ assortment ⁷⁷⁹⁹	Krimpenerwaard → Stolwijk ²³²
cbs-deark.nl	Christelijke BasisSchool de Ark	The Christelijke BasisSchool de Ark in Bergambacht is a Christian primary school that offers open and passionate education to all students.	Primary Education → Christian Education ⁴⁴⁶ Higher Learning → Educational Institutions ¹⁰⁴⁹	study day ⁴⁰ annual report ⁸⁷⁷ tour ²³¹⁵ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶
herrevelddevogel.nl	Herreveld & de Vogel makelaardij	Herreveld & de Vogel makelaardij is a real estate agency specializing in the Krimpenerwaard, dedicated to guiding private and commercial clients through the purchase, sale, and rental of real estate.	Property Agents & Brokers → Regional Agents ³⁵² Commercial Property → Office Buildings ¹⁴⁴	negotiation ²⁹⁶ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶ house ⁸¹²¹	Utrecht → Lopik ⁴⁶⁴
goudseslotenmaker.nl	Goudse Slotenmaker	The website of Slotenmaker Gouda offers 24/7 emergency locksmith services and locksmith repair services in Gouda and the surrounding municipalities, with a focus on reliability, quality, and transparency.	Security Systems → Lock Systems ¹²⁴ Transportation → Emergency Services ⁶³⁰	locksmith ⁹¹⁹ locks ⁹⁵³ security ⁶⁶⁵⁵	Zuidplas → Moordrecht ³³²
camperpioneer.nl	Camper Pioneer	The website Camper Pioneer offers custom-built bus campers, focusing on various truck brands and a wide range of designs and options.	Camping → Bus Campers ²⁰ Vehicles → Camper Vehicles ⁷²	buscamper ⁴⁰ creative ⁵³⁹ layout ⁸⁹⁹ truck ¹⁴¹² portfolio ⁶⁸⁵⁴ sustainability ¹⁸⁴⁵¹
autobedrijfterlouw.nl	Smits Auto	The website informs about the cessation of operations of Carteam Autobedrijf Terlouw in Bergambacht and refers customers to colleague car dealership Smits Auto for maintenance, warranty, and roadside assistance.	Automotive → Cars (Brands) ⁴³⁶	winter tires ¹¹³ roadside assistance ²¹¹ used cars ⁸⁹⁴ warranty ⁴⁷⁰¹ maintenance ²⁰⁰⁹³
ctbb.nl	CTBB B.V.	The website of CTBB B.V. presents company information and the scope of their civil technical works.	Engineering → Engineering Firms ⁹⁸⁹ Construction → Civil & Infrastructure ³⁴⁵³	distribution center ⁷⁷ buildings ⁸⁹⁸ infrastructure ¹⁴⁶⁰ work ³¹²²	Lansingerland → Bleiswijk ⁵⁷⁹
peterstuurman.nl	Peter Stuurman Photography	The website of Peter Stuurman Photography presents and sells photographs of the Krimpenerwaard, a polder region in the Green Heart of the Netherlands, and offers photography courses.	Nature & Landscape → Nature Photography ⁴⁸² Nature & Landscape → Landscape Photography ⁵³⁰	photographs ²⁵⁴ polder ⁴⁷⁶ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
flirtfashion.nl	FlirtFashion	The website of FlirtFashion presents a women's fashion store with locations in Lekkerkerk, Papendrecht, and Bergambacht. The aim is to inform visitors about opening hours, locations, and the offered clothing.	Fashion → Men’s Fashion ⁶⁹⁰	women's fashion ¹⁰⁵ opening hours ²⁹⁵³ store ³⁹⁰¹ clothing ⁹⁴⁴³	Krimpenerwaard → Lekkerkerk ²⁴⁴
toa-geluidsinstallaties.nl	Vodavi bv	The website of TOA geluidsinstallaties and Vodavi bv offers a selection of audio and broadcast installations, amplifiers, microphones, and speakers, geared towards professional applications and custom solutions.	Installation & Fixings → Installation Materials ²⁴⁷ Audio → Sound Technology ¹⁶⁸	sound system ¹⁶⁶ microphone ¹⁹⁸ amplifier ³⁰² speaker ¹⁴⁸¹ installation ¹³⁷⁴²
rioolserviceklapwijk.nl	Klapwijk Rioolservice	The website of Klapwijk Rioolservice offers drain services, including unclogging, repair, inspection, odor detection, preventative maintenance, new installation, and replacement of drainage systems, and informs visitors about potential misdirection and fraud within the drain cleaning sector.	Plumbing → Waste Water Management ¹⁴ Plumbing → Drainage ⁵⁷⁰	unclogging ²⁴⁴ drain ⁸⁸⁶ drainage ¹³²² vacancy ⁶⁵⁹⁸ quote ¹²⁸⁶³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hvsamenwonen.nl	Huurdersvereniging Samen Wonen (HSW)	The website of the Huurdersvereniging "Samen Wonen" (HSW) serves as a platform for tenants of the housing corporation "QuaWonen" in the communities of Schoonhoven, Bergambacht, Berkenwoude and Ammerstol to find information and contact regarding their rights and interests.	Rental Properties → Tenant Associations ³⁵¹ Homeownership & Management → Housing Corporations ⁴²⁶	right ³⁷⁹ tenant ⁹²⁰ complaint ⁶⁴⁷⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bothautos.nl	Both Auto's Bergambacht	Both Auto's Bergambacht is a family-run car dealership offering car sales, maintenance, repairs, and used car sales.	Automotive → Car Dealerships ¹⁶⁴⁷ Transportation → Automotive Technology ³¹⁵	used car ⁸²⁵ apk ¹³³³ tire ¹⁹⁷⁵ air conditioning ²¹⁷⁸ car ¹⁰⁸⁶⁵ maintenance ²⁰⁰⁹³
tcberkenwoude.nl	TC Berkenwoude	The website of TC Berkenwoude Tennis Club provides information about the club, including events, the agenda, rules, news, and membership information.	Sports Clubs → Local Sports Clubs ²⁴⁸ Tennis → Tennis Clubs ⁷²⁰	tennis club ³³⁷ tournament ²⁴⁷⁶ agenda ⁴³⁷⁴ membership ¹⁰⁴⁴²	Krimpenerwaard → Berkenwoude ⁶²
winkelhof.nl	Winkelhof Bergambacht	The Winkelhof Bergambacht website is a shopping center located in Bergambacht, offering a diverse range of products and services, including home goods, fashion, shoes, accessories, food, care, pet supplies, and more.	Shopping Centers → Local Shopping Centers ²⁶ Economy → Local Economy & Development ⁷²¹	home goods ³⁹ voucher ²⁷⁹ shopping center ⁴⁹¹ instagram ¹²¹⁶ fashion ²²¹² food ³⁸⁷²
willdoomakelaardij.nl	Willdoo Makelaardij	Willdoo Makelaardij is a real estate agency located in Schoonhoven that specializes in selling, renting, and buying properties.	Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴ Real Estate → Immobilien ²⁸⁴	agent ¹²⁵³ wishes ²⁷¹⁷ sale ⁵⁹³⁰ rental ⁷²⁵⁷ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
degenkamp-isolatie.nl	Degenkamp Isolatie B.V.	Degenkamp Isolatie is a company specializing in various forms of insulation, including heat, cold, and acoustic insulation, and offers thermal inspections and advice.	Insulation & Glazing → Insulation ¹⁵⁴³	cost ¹⁹⁹⁰ insulation ²⁴⁴⁸ energy ⁹⁰⁷⁵	Zuidplas → Moerkapelle ²¹³
vanderendebv.nl	Bouw- en aannemingsbedrijf Van der Ende	The website of Bouw- en aannemingsbedrijf Van der Ende from Bergambacht presents the company as a comprehensive general contractor specializing in new construction, maintenance, and commercial construction, operating in the Randstad region and focused on delivering high-quality projects for various clients.	Architecture → Architectural Services ¹⁰⁰⁶ Project Management → Construction Management ¹⁰³⁸	housing corporation ⁴²⁴ new construction ²⁶⁷² maintenance ²⁰⁰⁹³	Almere → Almere City ⁹³⁴
jvbergambacht.nl	JVB – Jeu de Boules Vereniging Bergambacht	The website of JVB – Jeu de Boules Vereniging Bergambacht provides information to members, potential members, and visitors about the association, its activities, rules, members, and contact details.	Team Sports → Boules ¹⁵⁹	boules ³⁸ clubhouse ⁷⁸⁴ tournament ²⁴⁷⁶ sponsors ²⁶⁴² region ⁵⁴¹² member ¹⁰¹⁵⁴
bedrijfsbouwpartners.nl	Bedrijfsbouw Partners	Bedrijfsbouw Partners is a construction company specializing in the design and construction of office buildings and commercial real estate.	Commercial Property → Business Parks ³²⁴ Construction Companies → Residential Construction ¹⁰¹³	office buildings ³¹ business park ³⁷² real estate ⁴⁹⁸¹ construction ⁷⁴²¹ collaboration ¹⁶⁰³⁶	Hoeksche Waard → Heinenoord ¹²³
vanreeuwijkbv.nl	Van Reeuwijk B.V.	Van Reeuwijk B.V. is a company specializing in various demolition and construction-related services.	Building & Materials → Demolition Services ³¹⁷	drill ³⁰³ asbestos ³⁸⁷ demolition ¹¹⁴⁴ renovation ¹³⁸⁴⁹
bedrijvenadressen.nl	www.bedrijvenadressen.nl	The website ‘Companies & Directories’ is a directory that presents local businesses and contact information by municipality.	Office & Workspace → Business Directories ⁴²¹	municipality ⁶⁸³⁷	Reimerswaal → Yerseke ²⁶²
destelling.nl	De Stelling	De Stelling offers various spaces for storage and business, including garage boxes, office units, and business units in Gouda and Bergambacht.	Office & Workspace → Office Space ¹²⁹²	self storage ²⁰ business unit ¹²⁹ garage box ¹³⁸ space ³⁸⁴⁶ price ⁸³²⁸	South-Holland → Gouda ³⁵²¹
gemeentehuisvesting.nl	GemeenteHuisvesting	GemeenteHuisvesting is a knowledge platform focused on developments and innovations impacting the work environment of municipal organizations regarding workspace.	Energy → Heat Generation ⁶⁶ Management & Consulting → Consultants ⁴⁴⁴	operation ⁴⁸⁰ workplace ¹⁰⁴⁶ innovation ⁴⁶⁵⁹ municipality ⁶⁸³⁷ sustainability ¹⁸⁴⁵¹	Land van Cuijk → Mill ³⁴²
witvlietmeubelen.nl	Witvliet Meubelen	Witvliet Meubelen is an interior construction and furniture maker that creates custom interiors and furniture for private and business clients.	Interior → Furniture ⁷⁴⁵⁴ Crafts → Woodworking ¹¹⁰⁹	wood ⁴¹⁵³ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²
leukeauto.nl	Leukeauto.nl	Leukeauto.nl is an automobile dealership based in Bergambacht that offers used cars and financing options.	Loans & Credit → Auto Loans ²⁴² Leasing → Auto Lease ³⁰	used car ⁸²⁵ showroom ⁴⁸⁸³ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵
okkrimpenerwaard.nl	Ondernemerskring Krimpenerwaard	The Ondernemerskring Krimpenerwaard is an organization that connects and strengthens entrepreneurs in the Krimpenerwaard region, with the goal of representing their material and immaterial interests.	Local Economy & Development → Regional Development ²⁹⁶ Associations & Groups → Business Associations ¹⁰¹⁸	policy ²¹⁴⁹ region ⁵⁴¹² network ¹¹¹²³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jagtstoffeerderij.nl	Van der Jagt Stoffeerderij	Van der Jagt Stoffeerderij is a upholstery workshop specializing in restoring and renewing interiors of cars, furniture, boats, campers, and caravans.	Upholstery & Fabrics → Upholsterers ¹⁶⁵ Personal & Household → Household Services ¹⁰⁵⁰	upholstery ⁶⁷³ boat ²⁹⁸⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ car ¹⁰⁸⁶⁵	Zuidplas → Moordrecht ³³²
tandartsbergambacht.nl	Tandartspraktijk Bergambacht	The website of Tandartspraktijk Bergambacht provides information about the practice, treatments, team members, and contact details.	Dentistry → Implantology ³⁰⁴	oral hygiene ²⁵⁶ prevention ¹⁷⁶³ dentist ²⁵¹⁴ treatment ²¹²⁰³
pbfk.nl	Praktijk Bekken Fysiotherapie Krimpenerwaard	The website of Praktijk Bekken Fysiotherapie Krimpenerwaard offers physiotherapy focused on pelvic problems, lower back pain, and pelvic floor dysfunction for both men and women.	Physiotherapy → Pelvic Physiotherapy ¹³⁷ Health → Pregnancy & Childbirth ⁴²²²	pelvic ²⁶ pelvic floor ¹¹⁷ pain complaints ¹²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
loodgieter-bergambacht.nl	Loodgieter Bergambacht	Loodgieter Bergambacht is a local plumber offering 24/7 service and various plumbing services in Bergambacht and surrounding areas.	Regional News → Province of North Brabant ⁶³ Home Improvement → Plumbing ²⁷³³	plumber ¹²¹⁰ rate ²⁶⁰⁶ warranty ⁴⁷⁰¹
neetnetworks.nl	Neet Networks B.V.	Neet Networks is a company specializing in datanetworks, prioritizing customer needs and offering services like installation, consulting, design, and certification.	Networking → Network Installation ¹³⁰	data network ⁹⁰ fiber optic ²⁷⁹ measurement ⁷³¹ certification ³³⁸⁰ consulting ³⁶³⁹ design ²⁷²⁰²
stigterinterieur.nl	Stigter Interieur	Stigter Interieur is a home interior specialist based in Schoonhoven offering advice and helping customers furnish their homes with flooring, window coverings, and furniture.	Bedroom → Bedroom Furniture ¹⁵¹ Interior → Window Coverings ¹⁰²⁶	closet ⁹³ window coverings ¹²¹³ bed ¹³⁸⁴ floor ⁴⁷⁸¹ home ⁷⁹⁷⁶ interior ⁸⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
buitenkans.nl	Buitenkans Aankoopmakelaars	Buitenkans Aankoopmakelaars is a property purchasing agency specializing in assisting clients with buying homes and land plots in rural areas.	Property Sales → Buying a House ⁸⁷² Property Finance → Buying ²⁵⁴	dream house ⁵⁹ buyer ²³³ plot ¹⁰⁵¹ advisor ¹⁰⁵⁵ property ⁷⁴⁰⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
krimpenerwaardintercultureel.nl	Krimpenerwaard Intercultureel	Krimpenerwaard Intercultureel (KIC) is an organization that helps asylum seekers integrate into the Krimpenerwaard community and feel at home.	Social Organization → Integration Organizations ³⁷ Language Learning → Language Courses ⁷⁶⁹	asylum seekers ⁹⁶ community ⁷⁹³¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
lekgoed.nl	Lekgoed BV	The website showcases real estate projects and services, with a focus on new construction and the renovation of existing properties.	Commercial Property → Commercial Space ⁴⁸⁹ Commercial Property → Industrial Space ¹⁸	unit ⁴⁰⁵ real estate ⁴⁹⁸¹	Hoeksche Waard → 's-Gravendeel ²⁰⁰
abcontainers.nl	AB Containers B.V.	AB Containers is a company that provides container rental, waste removal, and demolition services.	Building & Materials → Demolition Services ³¹⁷ Waste Management → Container Rental ³⁶⁸	roll container ⁴⁵ demolition ¹¹⁴⁴ waste ¹³¹² groundwork ¹³⁴⁸ container ¹⁷⁰⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
rodenburgbeauty.nl	Rodenburg Beauty Schoonheidssalon Bergambacht	Rodenburg Beauty Schoonheidssalon Bergambacht is a multi-faceted beauty and wellness salon offering a wide range of products and services, including perfumes, cosmetics, pharmacy items, wellness treatments, and accessories.	Household & Cleaning → Household Goods ¹⁶⁴² Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵	perfume ⁵³⁴ cosmetics ⁶⁴⁸ wellness ¹⁵⁶¹ treatment ²¹²⁰³
vodavi.nl	Vodavi	The website of Vodavi is an online platform for a specialized installation company based in Bergambacht, focusing on providing installation services and products in the areas of security, telephony, audio, and WiFi networks.	Security Systems → Security Technology ³⁹⁹ Radio & Communication → Telecommunications ¹³⁶¹	alarm ³⁷⁷ telephony ⁴⁹⁴ audio ⁹³⁴ wifi ¹³⁷² security ⁶⁶⁵⁵ network ¹¹¹²³
bakkerijblanken.nl	Bakkerij Blanken	Bakkerij Blanken is a family-run bakery located in Bergambacht, Stolwijk, and Lopik, selling a variety of breads and pastries, as well as lunch and catering for special occasions.	Bakery & Food Production → Bread ⁷⁶⁵ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	pastries ⁹⁴⁶ bread ¹⁶²² history ⁷²⁸⁶	Krimpenerwaard → Stolwijk ²³²
casteleijnbroodenbanket.nl	Casteleijn Brood en Banket	The website of Casteleijn Brood en Banket presents a bakery and tearoom in Bergambacht that offers artisan bread, pastries, and chocolates, as well as seasonal products, with a focus on tradition and family history.	Pastry → Cakes ⁸²⁶ Chocolate → Chocolatiers ⁹⁶	seasonal products ²⁶ tea room ⁵⁸ bakery ⁷¹⁸ chocolate ⁹¹¹ pastries ⁹⁴⁶ bread ¹⁶²²
hairandmorebergambacht.nl	HAIR & more Bergambacht	The website of HAIR & more Bergambacht showcases a hair salon and make-up artist offering personal styling, color services, and make-up services.	Makeup → Makeup Artists ⁷³³	stylist ⁴⁷⁶ makeup ¹⁴⁷⁷ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰
svfbergambacht.nl	SVF Bergambacht	The SVF Bergambacht website provides financial support and advice to individuals and diaconies, primarily focused on addressing financial problems and offering stability.	Financial Assistance → Debt Support ⁷⁶	debt ⁷¹⁷ financial ⁸⁵⁵ administration ⁶⁵⁸⁷ education ¹³⁴⁷¹	South-Holland → Hardinxveld-Giessendam ⁵³⁴
hospicekrimpenerwaard.nl	Stichting Hospice Krimpenerwaard	Hospice Krimpenerwaard is a foundation aiming to create a ‘near-home’ environment for people in the Krimpenerwaard who cannot spend their final days at home, providing loving and caring support.	Palliative & End-Of-Life Care → Hospice ¹²³	hospice ¹⁶⁸ foundation ⁶⁶⁷⁸ construction ⁷⁴²¹ house ⁸¹²¹ care ¹²³³⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vaneijkbergambacht.nl	J. Van Eijk Constructie	J. Van Eijk Constructie is a steel construction company that manufactures and installs various metal structures, fences, and accessories.	Garden → Fences ⁸²⁴ Construction → Building & Materials ¹⁹⁴⁴⁹	gate ⁴⁹⁹ stair ⁸¹⁵ metal ¹⁰⁹⁰ steel ¹¹⁷⁷ fence ¹⁸¹⁴ repair ¹⁴⁵⁷⁶
blankenafbouw.nl	Blanken Afbouw	Blanken Afbouw is a company specializing in finishing and plastering work, focusing on renovation projects and new construction.	Construction Companies → Plasterers ⁸⁴³ Finishing & Trades → Interior Finishing ⁹⁸	finish ⁷⁴⁷ plaster ²¹⁷⁵ new construction ²⁶⁷² renovation ¹³⁸⁴⁹
2date.nl	Commercive B.V.	The 2Date.nl website is a comparison site that enables users to compare dating websites in the Netherlands based on various criteria, including target audience, wishes, and locations.	Social Media → Dating ¹⁶⁴⁴ Websites → Comparison Sites ⁸⁶⁹	preference ⁶⁶	Maastricht → Maastricht-Southeast ¹¹³
miniopslagkrimpenerwaard.nl	Miniopslag Krimpenerwaard	The website of Miniopslag Krimpenerwaard offers temporary storage space and storage boxes for rent, targeting both private and business customers in the Krimpenerwaard region.	Logistics → Storage ¹¹⁷⁰	storage space ³⁸⁸ box ¹⁹⁸² storage ²⁴⁴⁶ space ³⁸⁴⁶ quote ¹²⁸⁶³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vanoosteromvanleeuwen.nl	Van Oosterom & Van Leeuwen Administratieve Dienstverlening	Van Oosterom & Van Leeuwen Administratieve Dienstverlening is an administrative office based in Bergambacht that provides financial administration, accounting, and tax filing services.	Accounting → Administrative Offices ⁹⁶ Administrative Support → Business Operations ¹¹⁵⁶	tax ²¹⁰⁰ account ⁵⁷⁸¹ administration ⁶⁵⁸⁷
opslagwaddinxveen.nl	Opslag Waddinxveen	Opslag Waddinxveen offers self-storage rental for individuals and businesses, emphasizing competitive prices and convenient access.	Logistics → Storage ¹¹⁷⁰	unit ⁴⁰⁵ storage ²⁴⁴⁶ security ⁶⁶⁵⁵ rental ⁷²⁵⁷	Alphen aan den Rijn → AWZI Alphen a/d Rijn ³⁵⁸
damesmodeplus.nl	Elenora’s XL Fashion	Eleonora’s XL Fashion is a women’s clothing store in Bergambacht specializing in fashionable clothing and accessories for women in sizes 42 to 56 (often referred to as ‘plus size’ or ‘large sizes’).	Women’s Clothing → Plus Size ¹²¹	plus size ²⁹ store ³⁹⁰¹ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵
dejonginterieurbouw.nl	Jan de Jong Interieurbouw B.V.	Jan de Jong Interieurbouw is a company based in Bergambacht that designs and manufactures custom furniture and interiors.	Interior → Furniture ⁷⁴⁵⁴ Finishing & Trades → Interior Construction ⁵⁰²	cabinet ¹⁷³⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
mevrouwlingerie.nl	Mevrouw Lingerie	Mevrouw Lingerie is a lingerie boutique and online shop offering a wide range of lingerie, nightwear, swimwear, and undergarments for women and men.	Retailers → Specialty Stores ¹¹ Underwear → Lingerie ⁴⁷¹	nightwear ¹⁶⁰ lingerie ⁴⁸⁸ online shop ¹³¹⁰ store ³⁹⁰¹ sale ⁵⁹³⁰ brand ¹⁷⁷³⁷
wovenwithlove.nl	Woven With Love	The website Woven With Love is a women's clothing boutique located in Bergambacht, offering exclusive clothing focused on quality, style, sustainability, and fair fashion.	Women’s Clothing → Boutique ¹³⁹ Clothing → Second-Hand Clothing ⁷⁴	styling advice ⁹⁶ women's clothing ¹⁰⁸ boutique ¹³³ webshop ⁸⁶⁴⁸ brand ¹⁷⁷³⁷
cafeensuite.nl	Cafe en Suite	Cafe en Suite is a combination of a lunchroom and a fashion store, located in Bergambacht, where visitors can have lunch, enjoy coffee and pastries, and simultaneously shop.	Cafes & Lunch → Lunch Spots ²³⁷ Economy → Retail & Commerce ⁹⁹⁴¹	lunchroom ³¹² staff ³⁴⁰⁵ coffee ³⁸³⁸ menu ¹³⁸⁵⁶
deknegtkaasennoten.nl	De Knegt Kaasspeciaalzaak	De Knegt Kaasspeciaalzaak is a shop in Bergambacht that sells nuts, fresh cheese, and wine.	Dairy → Cheese ⁵³⁰ Dairy & Cheese → Delicatessens ⁶¹⁷	dip ⁴⁹ nuts ⁴¹⁷ cheese ¹²⁰⁵ wine ⁴⁴⁷⁶ assortment ⁷⁷⁹⁹
vandriel-nl.nl	Van Driel Transport	Van Driel Transport is a transportation company specializing in one-way container transport and offers logistics solutions for container transport across Europe.	Transportation Services → Container Transportation ¹⁸¹ Freight & Logistics → International Transportation ⁵⁷⁶	chassis ⁷² europe ²⁸⁹ truck ¹⁴¹² container ¹⁷⁰⁹ transport ⁶¹⁰⁵	South-Holland → Rotterdam ²⁵⁰⁴⁸
verstopping-gouda.nl	Rioleringsbedrijf Gouda	The website of Rioleringsbedrijf Gouda offers rioolservice (drainage services), unclogging services, and other pipe repair services in Gouda and surrounding areas.	Water Management → Sewers ²⁵ Personal & Household → Service Industry ³⁷⁶	unclogging ²⁴⁴ sewer ²⁴⁶ drainage ¹³²² region ⁵⁴¹²	Oudewater → Papekop ²⁷
blomzonweringen.nl	Blom Zonweringen	Blom Zonwering is a specialized sun shading company providing custom shading solutions and installation services.	Interior → Window Coverings ¹⁰²⁶ Household & Cleaning → Home Services ¹³²¹	sunshade ³⁵⁶ showroom ⁴⁸⁸³ installation ¹³⁷⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mtsolutions.nl	MT Solutions	MT Solutions provides custom interior solutions, including lighting plans, floors, window coverings, and steel doors.	Agriculture → Agricultural Technology & Innovation ⁷⁴³ Technology → Smart Home & Automation ¹¹⁴⁶	steel door ⁸⁵ lighting plan ²⁰⁰ led lighting ³³² window coverings ¹²¹³ floor ⁴⁷⁸¹	Overbetuwe → Heteren ²³⁶
totalbootcamp.nl	Total Bootcamp	The website of Total Bootcamp presents and promotes the organization of bootcamp classes in the Schoonhoven region and surrounding areas, aimed at improving participants' fitness, strength, and endurance.	Group Class → Bootcamp ²⁰⁸	bootcamp ⁴⁹⁷ exercise ⁷⁰⁶ participant ¹⁹³⁴ class ²⁰⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
loonbedrijfdenboer.nl	Loonbedrijf den Boer	Loonbedrijf den Boer is a construction company specializing in groundwork, demolition, pile driving, paving, and drainage services.	Land Development & Earthworks → Site Preparation ²³ Building & Materials → Demolition ⁶⁸⁷	pile driving ¹⁵ demolition ¹¹⁴⁴ groundwork ¹³⁴⁸ paving ¹⁹⁴² equipment ⁴¹⁴³	Altena → Werkendam ³⁹⁹
ardkorevaar.nl	Ard Korevaar personenschade	The website of Ard Korevaar personenschade and letselschade is an online platform providing expert advice and guidance on personal injury claims to clients in various regions. It aims to provide customer satisfaction and a personalized approach.	Criminal Law → Personal Injury ⁷⁷¹	dossier ²⁴⁸ personal injury ⁴²⁸ legal assistance ⁵³⁷ charity ⁷⁰⁰ claim ⁷⁰²	Alphen aan den Rijn → Boskoop ⁶⁵²
autorijschooldunnewold.nl	Autorijschool Dunnewold	The website of Autorijschool Dunnewold from Stolwijk offers information and services for obtaining a driving license B, including driving lessons, driver training courses, theory exam materials, and an online shop.	Driving & Vehicle → Vehicle Training ⁵⁵³	driver training ²⁰ ris method ²¹ theory exam ⁹⁷ driving license ⁴⁰² online shop ¹³¹⁰ driving lessons ²⁴⁵³	Krimpenerwaard → Berkenwoude ⁶²
a-vastgoedzorg.nl	A-vastgoed Zorg	A-vastgoed Zorg is a company specializing in the management of real estate specifically geared towards residential care facilities.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Physiotherapy → Geriatric Physiotherapy ³⁰	elderly care ¹²⁸ seniors ⁹⁰⁴ housing ⁴³⁷⁸ real estate ⁴⁹⁸¹	Bodegraven-Reeuwijk → Waarder ⁶⁸
hoogerbrug-groep.nl	Hoogerbrug Bouwbedrijf	The website of Hoogerbrug Bouwbedrijf describes the company as a builder of relationships that works with clients on real estate projects, with the client's wishes at the center and an accommodating approach followed.	Construction Companies → Residential Construction ¹⁰¹³	construction company ⁸²⁴ relationship ⁴²⁰⁵ real estate ⁴⁹⁸¹ sustainability ¹⁸⁴⁵¹
schoonheidssalonexclusief.nl	Exclusief Skinstore & Salon	Exclusief Skinstore & Salon is a beauty salon in Bergambacht specializing in personalized skincare and treatments.	Science → Medical Sciences ⁹⁷ Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵	scan ⁷⁹⁰ skin ²⁵¹⁸ plan ²⁵⁶⁶ salon ⁵⁵⁴¹ treatment ²¹²⁰³
infra-techniek.nl	Infra-Techniek B.V.	Infra Techniek is a pavement and concrete milling company that offers support for the maintenance of infrastructure and provides pavement processing sets and cleaning services.	Civil & Infrastructure → & Waterways ⁹⁶ Civil & Infrastructure → Road Construction ⁴⁸¹	infrastructure ¹⁴⁶⁰ equipment ⁴¹⁴³
houtvisiebv.nl	Houtvisie B.V.	Houtvisie is a specialist in sustainable woodworking, providing wood import, processing, construction, and execution for various projects.	Garden → Decking ⁴⁴ Wood & Timber → Wood ¹⁰³⁵	processing ³³⁴ sustainable ⁷³⁹ wood ⁴¹⁵³ construction ⁷⁴²¹
kruiswijkcontainer.nl	Kruiswijk Groep BV	The Kruiswijk Container website in Bergambacht offers the possibility to quickly and easily rent containers for various types of waste, with a focus on good service and competitive prices.	Waste Management → Waste Processing ⁹⁶ Waste Management → Container Rental ³⁶⁸	rent ⁹⁸¹ waste ¹³¹² container ¹⁷⁰⁹ price ⁸³²⁸
osmosepunt.nl	ANDERS	OsmosePunt in Bergambacht offers a service for tapping osmose water for spotless cleaning of windows and other surfaces.	Maintenance & Services → Glass Maintenance ³⁷¹	osmose water ¹³ payment ¹³⁸⁹ water ²⁵⁰¹ app ⁴⁵⁹⁵
vignoble.nl	Huidverzorgingsinstituut Vignoble	Huidverzorgingsinstituut Vignoble offers personalized and natural skincare treatments and massages.	Cosmetics → Natural Cosmetics ²⁵⁴	skin type ²²⁹ natural ²³⁵ skincare ¹⁹⁷² relaxation ³⁹⁶⁸ massage ⁷⁶⁴⁶ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stefanderuitervof.nl	Hoveniersbedrijf Stefan de Ruiter VOF	Hoveniersbedrijf Stefan de Ruiter VOF offers garden design, landscaping, maintenance, and renovation services in the Netherlands, with a focus on creating a pleasant and attractive garden for the client.	Garden Maintenance → Gardeners ⁶⁸⁵ Agriculture → Horticulture & Floristry ¹⁴⁰⁴	landscaping ¹⁵²⁹ paving ¹⁹⁴² plant ⁴⁵⁰⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kcdeschakel.nl	Kerkelijk Centrum ‘De Schakel”	Kerkelijk Centrum ‘De Schakel’ is an event location in Bergambacht, Krimpenerwaard, offering rental of halls for various occasions, from business meetings to family gatherings and events.	Venues → Halls ⁴¹⁹ Culture → Religion ⁸³²⁷	hall ¹⁷⁸⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
galajurken-in.nl	Galajurk Winkel	The website presents a gala dress shop and offers information about the location, opening hours, and customer base.	Fashion → Evening Wear ¹⁶ Context ¹⁶¹³⁹⁴	gala dresses ¹⁷ accessories ¹²⁹⁷⁵	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
denederlandsezoutbank.nl	The Nederlandse Zoutbank	The Nederlandse Zoutbank is a specialist in the procurement, transport, storage, and delivery of salt, aiming to ensure the safety and continuity of salt supplies.	Logistics → Storage ¹¹⁷⁰ Construction → Civil & Infrastructure ³⁴⁵³	salt ¹⁵⁰ packaging ²²³⁶ storage ²⁴⁴⁶ network ¹¹¹²³	Beekdaelen → Nuth ²²³
uitlaatservicekrimpenerwaard.nl	Hondenuitlaatservice Krimpenerwaard	Hondenuitlaatservice Krimpenerwaard offers a dog walking and dog snack service in the Gouda, Krimpenerwaard, and Krimpen a/d IJssel region.	Dog Care → Dog Walking Service ³⁵⁶ Family → Pet Services ⁵⁴	field ⁵²⁷ game ²⁸⁰⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
geleijntransport.nl	Geleijn Transport	Geleijn Transport is a transportation company with a long history specializing in the transport of various goods, including shipping containers and loose bulk products.	Transportation Services → Refrigerated Transport ²²⁶	container ¹⁷⁰⁹ driver ¹⁸³² route ³⁴²⁵ relationship ⁴²⁰⁵ transport ⁶¹⁰⁵	Amsterdam → West ⁷⁷⁷
nieuwveldschilders.nl	Nieuwveld Schilders	Nieuwveld Schilders is a painting company based in Bergambacht offering painting, wall finishing, and glazing services to individuals, businesses, and government organizations.	Insulation → Glazing ¹⁸⁸ Maintenance & Repair → Facility Services ⁶⁷¹	glazing ⁴⁸² painter ⁷⁴⁰ paint ⁸⁷⁴⁷ quote ¹²⁸⁶³
gospelkoorelim.nl	Gospelkoor Elim	The website of Gospelkoor Elim provides information about the gospel choir, including the agenda, members, contact details, and a registration form.	Choir → Gospel Choir ¹⁵⁰ Social Organization → Religious Organizations ¹⁰⁶⁹	choir ³¹²³ agenda ⁴³⁷⁴ concert ⁴⁴⁰⁹ member ¹⁰¹⁵⁴ music ¹³¹⁷⁰	Ede → Ederveen ¹⁹⁵
josgym.nl	JOSGYM	The JOSGYM website offers personal training and nutrition advice in Bergambacht and surrounding areas, aiming to help individuals get fit and enjoy sports.	Personal Development → Motivation ⁴³⁴	fun ²⁴¹ motivation ⁸⁹⁴ nutrition ⁴⁹³⁵ goal ⁴⁹⁷⁴ training ²⁸¹³³
werkenbijcasteleijn.nl	Casteleijn Stroopwafels B.V.	The website presents job vacancies and provides information about the company and its culture.	Bakery & Food Production → Bread ⁷⁶⁵ Pastry → Waffles ¹⁷	corporate culture ²⁹ stroopwafel ⁷⁶ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸
bcbluesky.nl	Badminton Club Blue Sky Bergambacht	The website of Badminton Club Blue Sky Bergambacht provides information about the association, its activities, members and events, and offers opportunities to become a member or visit the club.	Combat → Badminton ⁷⁰²	badminton ⁴⁵³ youth ³¹²⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴²
slobsite.nl	Bouwkundig Tekenburo Slob	The website is a bureau offering architectural drafting and consulting services, primarily for private and business clients.	Architecture → Architectural Services ¹⁰⁰⁶ Architecture & Design → Building Consulting ³¹⁴	architectural ²⁰ drafting ³⁰⁸ drawings ¹³²⁹ application ³³⁷⁷ consulting ³⁶³⁹	Buren → Maurik ¹⁶²
tillytollenaar.nl	Pianodocent	The website of Pianodocent, owned by Tilly Tollenaar, offers piano lessons located in Bergambacht, initially established in 1981. It is a platform where individuals, particularly children, can learn to play the piano.	Instrument → Piano ⁵⁷² Music Education → Piano Lessons ³¹⁷	classical ¹⁶ music school ¹¹⁵ conservatory ²³⁷ piano ⁸²⁰ lesson ⁵¹⁵⁴	South-Holland → Gouda ³⁵²¹
logopedieschoonhoven.nl	Logopediepraktijk Schoonhoven and Bergambacht	The website of Logopediepraktijk Schoonhoven and Bergambacht provides information about speech therapy, the offered treatments, and contact details for clients with problems related to voice, speech, language, hearing, and swallowing.	Childcare → Language Development ⁵⁷⁴ Mental & Emotional Well-Being → Speech Disorders ⁸¹	swallowing ¹²⁹ speech ⁵³² speech therapy ⁵⁴⁰ voice ¹⁰⁹⁰ language ²⁰¹⁶ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stichtingtanmar.nl	Stichting TanMar Pedagogische Dienstverlening	Stichting TanMar offers pedagogical services, including a livable environment, respite care, and outpatient support, aimed at young people and adults with various challenges.	Social Services → Youth Work ³⁵³ Youth Development → Youth ¹⁰³³	living group ¹⁵ future ⁴⁰⁴ situation ⁶⁵⁵ youth ³¹²⁶ care ¹²³³⁸
blaubemiddeling.nl	BLAU Bemiddeling	BLAU Bemiddeling is a platform that connects public sector professionals with organizations seeking assignments.	Jobs → Vacancies ¹⁰⁹⁹ Government & Administration → Public Sector ³¹⁹	duration ⁴⁶ post ¹⁴⁰ advisor ¹⁰⁵⁵ assignment ¹¹²¹ region ⁵⁴¹²	Barneveld → Kootwijkerbroek ²⁵⁶
jacobskerstbomen.nl	B. Jacobs Kerstbomen	The website of B. Jacobs Kerstbomen offers a selection of Christmas trees and provides information on types, maintenance, and contact details.	Christmas → Christmas Trees ¹⁶²	lights ¹⁵⁵ christmas tree ³²² tree ¹⁸⁷⁹ maintenance ²⁰⁰⁹³
loodgieterlekkerkerk.nl	Loodgieter Lekkerkerk	The website Loodgieterlekkerkerk.nl provides emergency service and free quotes for plumbing work, drain cleaning, leak repairs, and roof maintenance in and around Lekkerkerk, aiming to offer a reliable and skilled solution for all plumbing problems.	Home Improvement → Plumbing ²⁷³³	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgieterbergambacht.nl	Loodgieter Bergambacht	The website Loodgieterbergambacht.nl provides emergency plumbing services, blockage removal and roof maintenance in Bergambacht and surrounding municipalities, emphasizing reliability, transparency, and quick response times.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Molenlanden → Groot-Ammers ¹⁵⁸
loodgieterammerstol.nl	Loodgieter Ammerstol	The website Loodgieter Ammerstol provides emergency service and free quotes for plumbing, drain cleaning, and roofing maintenance in and around Ammerstol. The goal is to be a reliable and fast plumber for the local population.	Repair → Plumbing Repair ⁴⁷ Installation & Repair → Water Installation ⁸¹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roofing ²⁸⁰⁶ quote ¹²⁸⁶³	Molenlanden → Ottoland ⁴¹
afvalcontainers-randstad.nl	Steehouwer Hoveniers	The website Afvalcontainers-Randstad.nl provides specialized waste removal services for soil, green waste, clean rubble, and other waste streams in the Randstad region, with a focus on environmentally friendly processing and customized solutions.	Logistics → Transportation ¹¹⁰² Environment → Waste Management ²⁶⁸⁰	green waste ²² removal ²⁶⁷ soil ⁹³⁰ waste ¹³¹² container ¹⁷⁰⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
daansontbijtservice.nl	Daans Catering	Daans Catering is an breakfast service that delivers fresh breakfasts, lunch buffets and snacks to private individuals and businesses in various regions, including Gouda, Alphen aan den Rijn and Nieuwerkerk aan den IJssel.	Accommodation → Breakfast ³⁶⁴ Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Lansingerland → Bleiswijk ⁵⁷⁹
hogendoornadvies.nl	Hogendoorn Advies	Hogendoorn Advies is a consultancy firm offering construction and sustainability advice for both residential and commercial projects.	Legal → Construction Law ¹⁵⁰ Legal & Permits → Construction Advice ²⁸⁹	construction advice ¹⁸⁸ stable ⁷⁶⁸ housing ⁴³⁷⁸ sustainability ¹⁸⁴⁵¹
trenddoor.nl	Trenddoor B.V.	Trenddoor is a specialist in access technology, providing delivery, installation, repair, and maintenance services for various doors, gates, and access control systems for businesses and private individuals.	Doors → Garage Doors ²⁴⁸ Security → Access Control ²⁵³	access control ³⁵⁰ garage door ³⁶⁵ door ²²¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Almere → Almere City ⁹³⁴
zeepdispensershop.nl	Zeepdispensershop	The website Zeepdispensershop is an online store that sells a wide assortment of soap dispensers, parts, and mounting materials.	Advertising → Lettering ⁵⁶⁹ Household & Cleaning → Household Goods ¹⁶⁴²	soap dispenser ¹⁰ mounting ⁴⁴⁸ part ⁵⁰⁴⁴
besttaxi.nl	E.E Best Taxi Service	The website of E.E Best Taxi Service provides taxi and transportation services, including taxi to Schiphol, business transportation, airport service, and transport to other airports.	Logistics & Transportation → Travel Arrangements ¹³³	airport ⁷⁸⁹ taxi ²⁰⁹⁰ transportation ²⁸⁵¹ reservation ³³⁷³ price ⁸³²⁸ quote ¹²⁸⁶³	Eindhoven → Strijp ⁵²⁷
bloemistservice.nl	Bloemenbezorging.nl	The website offers a service to deliver flowers, bouquets, and flower arrangements in the Netherlands.	Delivery → Flower Delivery ²¹⁰ Gifts & Occasions → Flower Shops ⁷⁷⁶	florist ⁵⁷ roses ²¹⁴ bouquet ¹¹⁴⁷ flowers ³²⁴⁸ shop ⁶⁴⁸³	Vijfheerenlanden → Ameide ⁹⁷
bnbthebarnhouse.nl	Banning Family	The Barnhouse website presents a charming cottage located in Bergambacht, a renovated cow stable converted into a comfortable accommodation for two people.	Hotels → Country Houses ¹⁷² Accommodation → Cottages ²⁹⁸	meadow ⁷⁵ cottage ²⁹⁹ farmhouse ⁸⁷⁸ internet ¹⁶⁷⁸ bedroom ²⁰⁵¹ terrace ⁴⁸⁴⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
boekenwinkel-gids.nl	Bookshop Guide	The website Bookshop Guide provides an overview of bookstores in various provinces of the Netherlands.	Directories → Websites ³⁴⁷³ Context ¹⁶¹³⁹⁴	town ¹²⁶ bookstore ¹⁴⁹ directory ¹⁷⁶ province ⁵¹⁸	Zwartewaterland → Genemuiden ⁴⁰⁵
boetiekvintique.nl	Boetiek Vintique	Boetiek Vintique is a vintage shop that sells secondhand women's clothing, shoes, and accessories with a focus on sustainability and style.	Context ¹⁶¹³⁹⁴	coffee ³⁸³⁸ atmosphere ⁵⁵⁹¹ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷ sustainability ¹⁸⁴⁵¹
bouwburovink.nl	Bouwburo Vink	Bouwburo Vink is an independent construction advice agency based in Gouda that supports various building projects, from new construction to renovation.	Project Management → Construction Supervision ³⁶⁴	construction supervision ¹⁸⁷ construction advice ¹⁸⁸ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	The Hague → Scheveningen ¹⁶²⁵
dhadvocatuur.nl	De Haas Advocatuur & Mediation	De Haas Advocatuur & Mediation is a law firm specializing in personal and family law.	Family → Alimony ⁷⁰ Law → Family Law ¹⁴¹³	situation ⁶⁵⁵ court ⁹⁹⁹ lawyer ²⁶⁸³ mediation ²⁷⁸⁷ family ⁶⁴⁶²
dokterelectro.nl	Dokter Electro	Dokter Electro is an electrician offering emergency electrical work, installations, repairs, and maintenance.	Lighting & Electrical → Utilities ³⁸⁸	panel ⁸⁶⁸ electrical ¹⁴¹⁴ home ⁷⁹⁷⁶ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Lelystad → City Center ¹⁵
dutchteamsecurity.nl	Dutch Team Security	The website of Dutch Team Security offers security services including surveillance, object security, and event security.	Security & Surveillance → Security ³²⁵¹ Industry → Industrial ¹⁹⁸⁷	surveillance ¹⁹² risk ²⁸⁹⁶ security ⁶⁶⁵⁵ event ⁴⁵¹⁹⁹	Nissewaard → Simonshaven ⁴⁶
eenhandjenodig.nl	DigiWaard	Handje Nodig provides computer assistance, maintenance, and security services to individuals and businesses in the Krimpenerwaard and Gouda region.	Computer Hardware & Peripherals → Computer Stores ²⁸¹	internet ¹⁶⁷⁸ computer ¹⁹⁶⁹ data ⁵⁸⁷² security ⁶⁶⁵⁵ software ⁸²⁹¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
fiscalistkaart.nl	Fiscalistkaart BV	The website Fiscalistkaart provides an overview of Dutch fiscalists and facilitates finding a suitable fiscalist.	Websites → Professional Websites ¹⁷ Software → Online Services & Platforms ⁷³⁵	fiscalist ¹⁰ compare ⁵⁸² search ¹⁰²⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
floreathoveniers.nl	Floreat Hoveniers	Floreat Hoveniers is a landscaping company in Schoonhoven that offers garden design, landscaping, maintenance, and renovation services.	Outdoor & Garden → Landscape Companies ³³⁹	plan ²⁵⁶⁶ showroom ⁴⁸⁸³ communication ¹⁰¹⁶² quote ¹²⁸⁶³ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gjvn.nl	Graaf Jan van Nassauschool	The website of the Graaf Jan van Nassauschool in Gouda presents the school, its vision, team, programs, and important information for parents and students.	Elementary Schools → Christian Primary Schools ³⁴² Education & Youth → Local Institutions ¹⁰⁶	bible ¹²⁷⁶ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Gouderak ¹⁰³
gouda-glaszetter.nl	Glaspunt B.V.	Glaspunt B.V. is a glass fitter company based in Gouda that provides 24-hour glass repair and glass installation services.	Insulation → Glazing ¹⁸⁸ Exterior Works → Glass Fitting ¹¹²	glass fitter ³² glass damage ¹³⁵ window ²⁰³⁰ glass ²⁹¹⁹ quote ¹²⁸⁶³	Oudewater → Papekop ²⁷
goudmakelaardij.nl	GOUD Makelaardij	GOUD Makelaardij is a real estate agency offering homes for sale and rent in Midden-Brabant.	Property Agents & Brokers → Regional Agents ³⁵²	plot ¹⁰⁵¹ agent ¹²⁵³ result ¹⁹⁰² bedroom ²⁰⁵¹ property ⁷⁴⁰⁶	Altena → Hank ¹¹³
grillroompizzeriaamon-bergambacht.nl	Eetcafé Amon Bergambacht	Eetcafé Amon Bergambacht is an online restaurant where customers can view the menu and place online orders.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
groothandel-nederland.nl	groothandel-nederland.nl	This website provides information about wholesalers, including their function and activities.	Commerce → Wholesale ¹⁸⁵⁵	enterprise ¹⁰¹ wholesaler ²²⁵ flow ²⁶³ goods ⁶⁶⁶ supplier ¹⁷²⁵	Achtkarspelen → Harkema ¹¹³
haagsmatrading.nl	Haagsma Trading Company	Haagsma Trading Company is a company specializing in the supply of heavy-duty wheels and wheels for various industrial applications.	Tools & Equipment → Industrial Tools ²⁴⁴ Bicycles & Wheels → Wheels ¹⁹	wheel ⁷⁴⁶
hippischwonen.nl	Hippisch Vastgoed	This website provides an overview of equestrian properties in the Netherlands and Belgium.	Property Finance → Buying ²⁵⁴ Office & Workspace → Business Directories ⁴²¹	objects ⁴²⁶ province ⁵¹⁸ listings ⁵²⁵ real estate ⁴⁹⁸¹ property ⁷⁴⁰⁶ price ⁸³²⁸	Land van Cuijk → Oeffelt ⁹⁶
hovenierverkade.nl	Hovenier Verkade	Hovenier Verkade is a landscaping company that offers garden design, maintenance, and renovation services.	Garden Maintenance → Garden Improvement ³³	quote ¹²⁸⁶³ garden ¹³¹²⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
jobofo.nl	Johann Borst	The website of Johann Borst showcases a portfolio of photography focusing on nature and animals, with a particular emphasis on birds and raptors.	Nature & Landscape → Nature Photography ⁴⁸² Animals → Birds ⁴⁷⁰	bird ⁹²² album ¹⁴⁹⁵ animal ²⁹⁰⁸ nature ⁹⁰⁹⁴ photography ⁹⁵⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kostentuinman.nl	Kosten Tuinman	The website ‘Kosten Tuinman’ provides an overview of gardening services in various regions of the Netherlands.	Office & Workspace → Business Directories ⁴²¹	gardener ²⁹⁹	Emmen → Nieuw-Amsterdam ¹⁴⁹
kruidenboterkruiden.nl	kruidenboterkruiden.nl	The website describes the history, ingredients, and sales channels of a unique herb butter mix, originally started in a café and now sold in supermarkets and online.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷ Sandwiches & Salads → Appetizers ⁴⁰	packaging ²²³⁶ store ³⁹⁰¹ vacation ⁴²³⁴ recipe ⁵¹⁴²
mariellebutter.nl	Paard & Coach Marielle Butter	Paard & Coach Marielle Butter offers guidance and coaching through the use of horses.	Coaching → Horse Coaching ³³⁹ Outdoor → Horse Riding ⁹⁴¹	insight ⁶²⁸ session ¹⁷⁹¹ growth ⁴⁰⁵⁴ horse ⁴³³⁷ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
michaelashair.nl	Michaela’s Hair@Home	The website of Michaela’s Hair@Home is a personal hair salon offering services to residents of Bergambacht, Schoonhoven, and Lekkerkerk, with a focus on a relaxed atmosphere and professional results.	Hair Education → Hair Products ⁶¹²	hair coloring ¹¹⁴ hair products ³⁰¹ cut ⁹²⁶ hairdresser ¹³⁷²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
oosterhoef30.nl	Kleurrijk NVM Makelaars & Taxateurs	The website of Kleurrijk NVM Makelaars & Taxateurs presents a property for sale in Bergambacht, providing detailed information about the location, features, layout, and amenities.	Houses → Semi-Detached Houses ⁷⁵¹ Houses → Townhouses ⁶³²	living area ³⁴⁹ agent ¹²⁵³ property ⁷⁴⁰⁶ garden ¹³¹²⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
renssenklusbedrijf.nl	Renssen Klusbedrijf	Renssen Klusbedrijf is a handyman service that provides a wide range of services in the Bergambacht and surrounding area.	Maintenance & Repair → Skilled Trades ²²⁰ Household & Cleaning → Home Services ¹³²¹	handyman ⁸³⁶ carpentry ²²¹⁸ paint ⁸⁷⁴⁷ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rijschoolboutique.nl	Rijschool Boutique	Rijschool Boutique is a driving school that offers lessons for various driving license categories and specializes in driving, motorcycle and scooter lessons.	Traffic Management → Traffic ⁵⁸⁹	driving skills ¹⁶ driving license ⁴⁰² driving lessons ²⁴⁵³ instructor ³¹²⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rijschoolmara.nl	Rijschool Mara	Rijschool Mara’s website offers driving lessons in various areas and focuses on personalized attention and a positive learning experience.	Driver & Vehicle → Driver’s License ¹⁶²⁵	practice book ²¹ ris ⁴¹ driver’s license ⁴³⁸ driving lessons ²⁴⁵³ instructor ³¹²⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rijschoolmaraya.nl	Rijschool Maraya	Rijschool Maraya in Gouda offers driving lessons in the region and surrounding areas, with various packages and options.	Driver & Vehicle → Driver’s License ¹⁶²⁵	driving license ⁴⁰² exam ²¹²⁰ driving lessons ²⁴⁵³ instructor ³¹²⁶ package ⁶¹¹²	Alphen aan den Rijn → Boskoop ⁶⁵²
siloservice.nl	Silo Service de Langen	Silo Service De Langen is a company that offers service and repair of silos and polyester products.	Plastics → Manufacturing ⁷⁷⁰⁸ Agriculture → Agricultural Technology & Innovation ⁷⁴³	silo ⁹⁶ polyester ¹⁰¹ pipe ⁶⁹⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
stellingbeveiliging.nl	Stelling Beveiliging & Telecommunicatie	The website Stelling Beveiliging offers security solutions and advice for homes, shops, and offices.	Security → Security Systems ⁹⁷¹	alarm ³⁷⁷ plan ²⁵⁶⁶ risk ²⁸⁹⁶ shop ⁶⁴⁸³ security ⁶⁶⁵⁵ home ⁷⁹⁷⁶
tcbergambacht.nl	Tennisclub Bergambacht	The website of Tennisclub Bergambacht provides information about membership, activities, competitions, court availability, and events, focusing on tennis in Bergambacht.	Sport Facility → Tennis ²⁰⁷⁸	tennis ⁸³⁶ court ⁹⁹⁹ competition ⁴⁷⁵⁹ lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹
trouwborstbv.nl	Trouwborst Konstrukties BV	Trouwborst Konstrukties BV is a specialist in the production and supply of lead balcony feeders and rainwater drainage systems.	Metalworking → Stainless Steel Fabrication ¹⁶¹ Garden → Fencing ³⁰⁷	bracket ⁵⁷
vanwurmond.nl	Van Wurmond Administratiekantoor	Van Wurmond Administratiekantoor offers bookkeeping, administrative, tax advisory, and payroll administration services to SMEs and self-employed entrepreneurs.	Company & Business → Individuals ⁸²⁷	payroll administration ⁹⁷⁹ bookkeeping ¹³¹⁹ tax advice ¹⁵²² administration ⁶⁵⁸⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vuurwerkbergambacht.nl	Van Eijk Vuurwerk	The website of Van Eijk Vuurwerk presents a fireworks shop with both a physical store and a webshop, and offers the possibility to purchase or order fireworks.	Party Supplies → Fireworks ²⁵⁸	identification ⁷⁶ fireworks ⁴¹³ store ³⁹⁰¹ webshop ⁸⁶⁴⁸
zz-people.nl	ZZ People B.V.	ZZPeople is a service provider specializing in placing production and logistics personnel, agricultural and green personnel, groundwork specialists, and cleaners, primarily for construction and industrial business owners.	Land Development & Earthworks → Earthmoving ⁶⁴³	business owner ⁶⁰ personnel ¹⁰⁸⁴ assignment ¹¹²¹ communication ¹⁰¹⁶² network ¹¹¹²³
iphonereparatiekrimpenerwaard.nl	iPhone Reparatie Krimpenerwaard	The website provides iPhone and tablet repair services in the Krimpenerwaard region.	Computer → Computer Repair ⁸⁹⁸ Repair → Mobile Phone Repair ¹⁰¹²	ipad ⁴⁰⁴ iphone ⁶⁶² device ⁶⁹⁸ screen ¹⁴³⁸ battery ¹⁷⁵¹ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
stichtevents.nl	Sticht Events	Sticht Events is a catering company that provides mobile fry trucks for various occasions, including parties and larger events.	Catering → Mobile Catering ⁸⁷	fry truck ³⁸ guest ¹³³⁴ drink ⁵¹⁹¹ package ⁶¹¹² event ⁴⁵¹⁹⁹
smartphonereparatiekrimpenerwaard.nl	Smartphone Repair Krimpenerwaard	The website Smartphone Repair Krimpenerwaard offers professional repair services for smartphones and tablets, with locations in Krimpenerwaard and surrounding areas. The goal is to be a reliable and specialist provider for smartphone and tablet repairs in the region.	Electronics & Components → Mobile Phones ¹¹⁸⁶ Electronics & Components → Tablets ¹⁹¹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
ceritransport.nl	Ceri Transport	Ceri Transport in Bergambacht is a transportation company specializing in the transport of hazardous materials and related services.	Specialized Transport → Tank Transport ³⁰	tank container ¹⁷ hazardous materials ²² germany ¹⁸⁵ certification ³³⁸⁰ transport ⁶¹⁰⁵
snackbar-denuyl.nl	Snackbar Den Uyl	The website of Snackbar Den Uyl Bergambacht provides the opportunity to order food online for takeaway or delivery, including a menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶
zwanenpartners.nl	Van der Zwan and partners	Van der Zwan and Partners is a tax and administrative advisory firm serving the Schoonhoven region.	Taxation → VAT ²⁶⁶ Accounting → Bookkeeping ¹²³⁰	filings ³² financial statement ³²¹ tax advice ¹⁵²² administration ⁶⁵⁸⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
adriaanmeerkerk.nl	Meerkerk Melkvee Zorg en Loonbedrijf	Meerkerk Melkvee Zorg en Loonbedrijf is a family business that combines dairy farming, agricultural services, and a care farm.	Livestock → Dairy Farming ⁶⁷¹ Community → Social Issues & Welfare ²⁸¹⁵⁹	agricultural services ³⁸ dairy farm ¹²⁹ day activities ¹³⁷ earthmoving ²³³ care farm ²⁴⁶ cow ⁵⁹⁶
jhdistributie.nl	JH Distributie	JH Distributie is a distribution company that provides local newspaper distribution services in the Krimpenerwaard region.	Marketing → Direct Mail & Distribution ²⁸⁶ Local News → Municipal News ¹⁵³	printed materials ¹⁷ district ³⁷¹ newspaper ³⁹⁶	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
ansichtopnederland.nl	ansichtopnederland.nl	The website provides an overview of places in the Netherlands.	Context ¹⁶¹³⁹⁴	place ²⁴² province ⁵¹⁸ region ⁵⁴¹²	Hollands Kroon → Barsingerhorn ⁴⁰
kwog.nl	Kruiswijk Woudenberg Verhuur	The website of Kruiswijk Woudenberg Verhuur presents a rental offer for residential and commercial spaces in various locations, including Schoonhoven, Bergambacht and Gouda, and provides information on project development and investment in real estate.	Rental Properties → Student Housing ¹⁸² Commercial Property → Commercial Space ⁴⁸⁹	business hall ²³ student housing ³⁴ garage box ¹³⁸ commercial space ²⁴⁵ apartment ⁵⁰⁸⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
alleschoenenwinkels.nl	AlleSchoenenwinkels.nl	The website AlleSchoenenwinkels.nl provides an overview of all shoe stores in the Netherlands, including their opening hours, addresses and contact details.	Clothing & Accessories → Shoe Stores ⁴⁴¹	search function ²⁷³ map ⁸⁰¹ address ⁹⁰¹ shoes ²⁶⁹⁹ opening hours ²⁹⁵³	South-Holland → Rotterdam ²⁵⁰⁴⁸
stal-lammerts.nl	Stal Lammerts	Stal Lammerts is a horse breeding and sales company specializing in jumping horses.	Animal Husbandry → Horse Farms ¹⁷⁴ Apparel → Equestrian ²³¹⁹	jump ⁹² breed ¹⁷⁴⁴ horse ⁴³³⁷ video ⁶⁷¹⁴
remij.nl	Remij b.v.	Remij is a company specializing in the reuse of waste materials and the creation of new valuable materials within a circular economy.	Sustainable Construction → Circular Construction ⁸⁰ Building & Materials → Demolition ⁶⁸⁷	waste material ³⁴ reuse ¹⁰⁰ demolition ¹¹⁴⁴
blauwlichten.nl	blauwlichten.nl	This website presents a list of fire departments (Brandweerkorpsen) in the Netherlands.	Emergency Services → Fire Department ¹³⁸	netherlands ¹³⁷⁶	Hof van Twente → Diepenheim ²⁰⁰
peethoogendoornkaas.nl	Peet Hoogendoorn Kaas	The Peet Hoogendoorn Kaas website showcases a family-run cheese business with over 150 years of history. The website offers a variety of cheeses, including renowned brands and regional cheeses, through various channels such as markets, a country store, and online ordering.	Dairy → Cheese ⁵³⁰	cheese ¹²⁰⁵ market ²⁷⁷² production ⁴⁵⁸²	Hoeksche Waard → Strijen ²³⁶
joyworshipband.nl	Joy!	The website of Joy! presents this musical band that, driven by a passion for God and music, performs at various occasions, including church services, events, and weddings.	Church & Religious → Gospel Music ³¹ Religious & Spiritual → Religious Events ¹³¹	crowdfunding ²⁴⁶ band ²⁹⁷⁷ church ³⁴³⁹ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mourikassurantien.nl	Mourik Assurantiën, Administraties, Adviezen & Belastingen	Mourik Assurantiën, Administraties, Adviezen & Belastingen is a firm that offers a range of financial services to individuals and businesses.	Governance → Law ¹⁴¹³³ Financial Services → Entrepreneur Advice ⁶²	taxes ⁵⁰⁰ bookkeeping ¹³¹⁹ insurance ⁶³⁵⁹ administration ⁶⁵⁸⁷
bo-bestrating.nl	Bo’s Bestrating	Bo’s Bestrating is a company offering paving and garden design services in the province of South Holland.	Garden Maintenance → Gardeners ⁶⁸⁵ Garden → Paving ¹⁰⁰³	streetwork ¹¹² fence ¹⁸¹⁴ paving ¹⁹⁴²
opslagbijdeboer.nl	Opslagbijdeboer.nl	Opslagbijdeboer.nl offers affordable storage space in and around Bergambacht, with flexible rental terms and a personal approach.	Logistics → Storage ¹¹⁷⁰	flexibility ⁹⁹⁶ storage ²⁴⁴⁶ rental ⁷²⁵⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
e-chopperkrimpenerwaard.nl	E-chopper rental Krimpenerwaard	The website, E-chopper rental Krimpenerwaard, offers the opportunity to rent e-scooters and fatbikes in the Krimpenerwaard, with a focus on green and relaxing tours.	Electric Vehicles → Electric Scooters ¹⁰⁸ Tourism → Regional Tourism ²⁴²	e-scooter ⁵³ scooter ¹²³⁶ reservation ³³⁷³ route ³⁴²⁵
holistic-harmony.nl	Holistic Harmony	The website of Holistic Harmony is a naturopathic therapy practice located in Bergambacht, Krimpenerwaard, offering holistic treatments.	Alternative Medicine → Naturopathy ¹⁰⁹⁷	haptonomy ¹²¹ drainage ¹³²² energy ⁹⁰⁷⁵
rttransport.nl	R&T Transport B.V.	The website of R&T Transport describes a family-owned transport company offering services throughout Europe, with a focus on flexibility and supporting various clients.	Construction Machinery → Crane Rental ¹³⁵	transport service ¹⁸ fleet ¹³⁵¹ truck ¹⁴¹² trailer ¹⁶²⁴ transport ⁶¹⁰⁵
schijfdata.nl	SchijfData.nl	The website SchijfData.nl offers data recovery, computer upgrade, and data destruction services, primarily in the region of Gouda and Bodegraven-Reeuwijk.	IT → Data Recovery ¹⁹	data destruction ⁴³ data recovery ⁸⁴ drive ⁴²⁸ backup ⁴⁹⁴	Zuidplas → Moerkapelle ²¹³
verkuilkaas.nl	Verkuil Kaashandel V.O.F.	The website of Verkuil Cheese Shop presents weekly offers of cheese, nuts, and other treats, and provides information about the locations where the cheese shop can be found.	Dairy → Cheese ⁵³⁰ Produce & Vegetables → Vegetables ¹⁰⁷⁰	vacuum ⁹⁵ nuts ⁴¹⁷ cheese ¹²⁰⁵ market ²⁷⁷²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
mgraveland.nl	M. Graveland Bouw	M. Graveland Bouw is a construction company specializing in new construction, renovation, insulation, and carpentry work, with a focus on concrete construction and monolithic floors.	Building & Materials → Concrete ³⁹⁰ Insulation & Glazing → Insulation ¹⁵⁴³	concrete construction ²⁴ carpentry ²²¹⁸ insulation ²⁴⁴⁸ new construction ²⁶⁷² renovation ¹³⁸⁴⁹
uitvaartbergambacht.nl	Uitvaart Bergambacht	Uitvaart Bergambacht is an end-of-life care provider in Bergambacht that arranges and cares for complete funerals.	Funeral Services → Funeral Arrangement ⁴⁸⁶	undertaker ²⁸ burial ⁴⁰⁶ cremation ⁶¹⁵ farewell ¹¹⁰⁹ funeral ²⁴⁷⁷
huismanbouwentimmerwerken.nl	Huisman Bouw- en Timmerwerken	Huisman Bouw- en Timmerwerken is a construction and carpentry company based in Lekkerkerk, Netherlands, that offers renovation and building services in the surrounding area.	Building & Materials → Carpentry & Joinery ⁸³⁰	carpentry ²²¹⁸ renovation ¹³⁸⁴⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
paso-geluidsinstallaties.nl	Vodavi bv	Paso Geluids- & Omroepinstallaties offers installation and supply of audio and broadcast equipment, as well as emergency evacuation systems, with a focus on quality and good value for money.	Technology → Audiovisual & Media ⁶⁸⁸ Technology → Smart Home & Automation ¹¹⁴⁶	evacuation system ¹¹ audio system ⁴⁰
vanderzwaal.nl	Van der Zwaal B.V.	The website of Vanderzwaal.nl offers educational pathways and support to educational institutions, focused on improving processes, preventing early school leaving, and addressing teacher shortages.	Special Needs & Support → Support Education ²³⁴ Research & Academia → Educational Development ³⁵⁴	career orientation ¹⁴ project leadership ⁸⁵ process guidance ⁸⁶ pathway ⁴⁴⁷ collaboration ¹⁶⁰³⁶	Katwijk → Katwijk aan Zee ⁶¹⁶
hoveniersbedrijfweltevree.nl	Hoveniersbedrijf Weltevree	Hoveniersbedrijf Weltevree is a landscaping company specializing in garden maintenance, ranging from garden design and construction to ground work and property boundaries.	Garden → Fences ⁸²⁴ Environment → Environmental Technology ⁷¹²	property boundary ¹⁰ garden maintenance ⁴⁶² garden design ⁹⁶⁴ groundwork ¹³⁴⁸ portfolio ⁶⁸⁵⁴	De Fryske Marren → Echtenerbrug ²⁴
jaapvermeulen.nl	Timmer- en Aannemingsbedrijf Jaap Vermeulen	Timmer- en Aannemingsbedrijf Jaap Vermeulen is a construction company offering various building projects, from renovations to new builds, with a customer-focused approach.	Construction Companies → Construction Contractors ⁵³⁶ Building & Materials → Carpentry & Joinery ⁸³⁰	extension ¹⁹⁴¹ carpentry ²²¹⁸ new construction ²⁶⁷² renovation ¹³⁸⁴⁹
vijzelbedrijfvandam.nl	Vijzelbedrijf Van Dam	Vijzelbedrijf Van Dam is a company specializing in the straightening of leaning buildings.	Garden → Garden Sheds ⁴⁰⁰	shed ⁶³⁰ buildings ⁸⁹⁸ home ⁷⁹⁷⁶	Garmerwolde → Lageweg ¹²
campagne.zorgpartners.nl	Zorgpartners Midden-Holland	Zorgpartners Midden-Holland is a care organization providing care for elderly individuals with dementia, brain injuries, or physical limitations, both in traditional and innovative settings.	Neurology → Dementia ⁵⁰⁹ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	colleague ³⁷⁸ home care ⁸²⁷ home ⁷⁹⁷⁶ care ¹²³³⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
eijk.echtebakker.nl	Arjan van der Eijk, De Echte Bakker	The website of ‘De Echte Bakker’ is an online shop and a presentation of a bakery with locations in Gouda, Bergambacht and Haastrecht, which sells and delivers artisan bread and baked goods.	Dairy → Cheese ⁵³⁰	specialty ²²⁹ bakery ⁷¹⁸ bread ¹⁶²² webshop ⁸⁶⁴⁸	Krimpenerwaard → Haastrecht ¹⁹³

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.