| bergambacht-oost.nl | Erik van Erk projectontwikkeling B.V. | The website provides information about the Bergambacht-Oost housing development initiative, a project aimed at adding 4,000 homes to the Krimpenerwaard municipality by 2040. | Local Governance → Civic Engagement 515 Tourism → Rural Tourism 59 | site 422 agreement 1029 resident 3245 municipality 6837 home 7976 | Rotterdam → Prins Alexander 432 |
| meetbureaudebruijn.nl | Meetbureau de Bruijn | Meetbureau de Bruijn is a surveying and engineering firm specializing in accurate measurements and solutions for the construction sector. | Engineering → Engineering Firms 989 Technology & Innovation → Construction Technology 790 | technical solutions 29 measurement 731 construction 7421 | Zuidplas → Nieuwerkerk aan den IJssel 557 |
| bizdewetering.nl | Stichting BIZ De Wetering | Stichting BIZ De Wetering is a foundation that facilitates joint investment in a safe and attractive business environment on De Wetering industrial park in Bergambacht. | Local Economy & Development → Regional Development 296 Associations & Groups → Business Associations 1018 | industrial park 11 biz 52 investment 2070 board 3438 municipality 6837 | |
| tvs-design.nl | TVS Design | The website of TVS Design presents the company's services as a specialist in interior design and stand construction, with a focus on customized solutions. | Finishing & Trades → Interior Construction 502 Event Styling & Decoration → Stand Construction 124 | customized solutions 31 stand construction 97 interior construction 240 decoration 4085 partner 4272 interior 8093 | |
| broodjebab.nl | Broodje BAB | The Broodje BAB website is an online shop where customers can order sandwiches, salads, and Big Tosti's for pick-up or delivery. The website also features a prize wheel and the chance to win. | Sandwiches & Salads → Sandwich Shops 229 | prize wheel 402 sandwich 4098 webshop 8648 menu 13856 | |
| edwinterlouw.nl | Edwin Terlouw Timmer & Onderhoudsbedrijf | Edwin Terlouw Timmer- and Maintenance Company is a business that focuses on carpentry, renovation, and restoration of homes in Bergambacht and the surrounding area. | Building & Materials → Carpentry & Joinery 830 | craftsmanship 1858 carpentry 2218 home 7976 renovation 13849 | |
| hbrevet.nl | H.B.Revet & Zn. V.O.F. | H.B.Revet & Zn. V.O.F. is a construction company in the Gouda, South Holland region that undertakes renovations, carpentry and maintenance work. | Installation & Repair → Tradespeople 409 Renovation & Restoration → Interior Renovation 879 | garden furniture 578 skylight 966 extension 1941 window 2030 carpentry 2218 renovation 13849 | South-Holland → Gouda 3521 |
| infra-rent.nl | Infra-Rent B.V. | The website of Infra-Rent B.V. presents the organization as an independent partner providing asphalt support for the maintenance of public and private infrastructure, primarily through the rental of asphalt finishing machines and associated personnel. | Machine & Equipment → Machine Rental 192 Civil & Infrastructure → Earthworks 370 | asphalt 165 machine park 642 rental 7257 maintenance 20093 | Krimpenerwaard → Krimpen aan de Lek 193 |
| hetadresomintelijsten.nl | Atelier Lijst in Beeld K5 | Atelier Lijst in Beeld K5 is an atelier located in Bergambacht specializing in creating and framing artwork and other images. | Visual Arts → Framing 139 | hanging system 41 frame 883 artwork 2248 frames 2556 | |
| recruitment-marketeers.nl | Recruitment Marketeers | The website Recruitment Marketeers provides specialized services in job marketing, employer branding, and content creation, aimed at improving the effectiveness of recruitment campaigns and strengthening employer brands. | Online Marketing → Recruitment Marketing 179 Online Marketing → Employer Branding 202 | employer branding 10 job marketing 17 content creation 190 campaign 3428 data 5872 | Overijssel → Hardenberg 2309 |
| dcmr.nl | DCMR | The DCMR website provides information and services related to environmental inspections, enforcement, and promoting a healthy and sustainable living environment in the Rijnmond region. | Government & Administration → Regional Government 367 Context → Environment 54437 | enforcement 107 circular economy 365 permit 744 inspection 4279 report 4551 | Middelburg → City Center 93 |
| veerpas.nl | Veerpas.nl | The Veerpas website provides information about the new electronic boarding pass for the ferries in the region. | Water Transportation → Ferries 129 Online & Digital → Online Services 2369 | ferry service 13 cross 88 balance 4582 | Molenlanden → Kinderdijk 158 |
| handwerkenzondergrenzen.nl | Handwerken Zonder Grenzen | Handwerken Zonder Grenzen is a magazine focusing on various handcraft techniques and materials from around the world. | Textile Arts → Crafts 9117 | handcrafts 10 edition 157 textile 1421 technique 2157 article 6000 shop 6483 | Oirschot → East-West-and Middle Beers 214 |
| smitsauto.nl | Autobedrijf Smits Auto | The website of Autobedrijf Smits Auto offers a wide range of car maintenance services, used car sales, and financing options. | Automotive Maintenance → Vehicle Inspection 1102 | used car 825 apk 1333 lease 1595 car 10865 maintenance 20093 | Westland → Wateringen 536 |
| kikkersprong.nl | Zwemschool Kikkersprong | Zwemschool Kikkersprong is a training institute that offers swimming lessons to children from 3 years and 9 months old, focusing on safety, fun, and progress. | Swimming → Swimming Lessons 276 | student tracking system 21 diploma 795 | Albrandswaard → Poortugaal 206 |
| fysiofitness-bergambacht.nl | Fysio-Fitness Bergambacht | Fysio-Fitness Bergambacht is a company offering physiotherapy and fitness services catering to various needs. | Medicine → Physiotherapy 2372 Sports → Group Class 2051 | rehabilitation 1512 fitness 2251 schedule 2624 sport 4228 physiotherapy 4688 | |
| degierbv.nl | Loon- and Grondverzetbedrijf De Gier BV | Loon- and Grondverzetbedrijf De Gier BV’s website provides information about their services and projects in the areas of rental work, civil and cultural techniques, and waterworks. | Agriculture → Agricultural Services & Contracting 708 Exterior Works → Excavation 316 | rental work 16 hydraulic engineering 23 civil engineering 92 excavation 382 construction 7421 | Vijfheerenlanden → Vianen 707 |
| voedselbankijsselenlek.nl | Voedselbank IJssel en Lek | The website of the Voedselbank IJssel en Lek provides information about the food assistance offered by the organization in the Krimpenerwaard municipality, specifically targeting people experiencing poverty. It offers information on applications, donations, and volunteer work. | Social Issues → Poverty Prevention 55 | food bank 216 donation 5110 municipality 6837 volunteer 8367 | Krimpenerwaard → Krimpen aan de Lek 193 |
| hondenbrokkenmakers.nl | HondenBrokkenMakers | HondenBrokkenMakers is an organization focused on the adoption, fostering, and support of dogs. | Social Organization → Child Welfare 1147 Dogs → Adoption 97 | foster 24 annual reports 311 adoption 359 partner 4272 dog 5483 foundation 6678 | Buren → Beusichem 163 |
| deelautovergelijker.nl | Deelauto Vergelijker B.V. | The website compares the prices of various car-sharing providers to help users find the most affordable option. | Mobility → Car Sharing 25 Websites → Comparison Sites 869 | car sharing 55 filters 424 map 801 provider 1111 route 3425 price 8328 | Haarlemmermeer → Badhoevedorp 604 |
| petsworldtropika.nl | Petsworld Tropika | Petsworld Tropika is a pet store in Bergambacht that sells everything for pets, horses, and other animals. | Animals → Pet Food 584 | habitat 75 pass 92 grooming 896 pet 1617 food 3872 store 3901 | |
| antobeeldengeluid.nl | Anto Beeld en Geluid | Anto Beeld en Geluid is a store in Bergambacht that has been active for over 25 years and focuses on televisions and sound systems from top brands. | Audio → Sound Systems 36 Electronics & Components → Television 262 | return policy 72 sound system 166 television 709 assortment 7799 brand 17737 | |
| leerlingzakenmh.nl | Bureau Leerlingzaken Midden-Holland | Bureau Leerlingzaken Midden-Holland is a government agency dedicated to preventing and reducing school absenteeism among young people aged 12 to 18+, as well as supporting their parents and professionals. The aim is to promote participation in education and support the students' educational pathway. | Educational Policy & Systems → Compulsory Education 15 Special Needs & Support → Educational Support 2195 | young people 1045 municipality 6837 education 13471 | Nieuwkoop → North 117 |
| pietersrestaurant.nl | Pieters Restaurant | Pieters Restaurant is a restaurant in Bergambacht with a Michelin star offering culinary arrangements, particularly in the summer. | Outdoor → Terraces 188 Restaurants & Dining → Fine Dining & Gastronomy 2338 | bakery 718 arrangement 3104 wine 4476 terrace 4847 restaurant 11215 menu 13856 | |
| slotenmakerdrs.nl | DRS Lock Specialist | The website is an online advertisement for DRS Lock Specialist, a locksmith service provider operating in various regions of the Netherlands. | Repair → Lock Repair 266 Security & Surveillance → Security 3251 | locksmith 919 locks 953 reviews 3172 security 6655 repair 14576 | Leeuwarden → Bears 16 |
| blauwebagger.nl | Blauwe Bagger | The website Circulaire Baggeroplossingen | Blauwe Bagger aims to promote the reuse of dredged material as a sustainable and circular solution for raw materials, highlighting the problems with current extraction practices. | Civil & Infrastructure → Roads 252 Sustainable Building → Dredging 42 | circular 369 raw materials 446 clay 495 sand 630 | Rotterdam → Feijenoord 477 |
| chiropractievanuithethart.nl | Chiropractie vanuit het hart | The website 'Chiropractie vanuit het hart' offers chiropractic treatments for both children and adults, with a focus on a holistic approach to health and vitality. | Physical Therapy → Chiropractic 420 | spinal column 15 chiropractic 184 baby 1895 health 6366 complaint 6479 | Vijfheerenlanden → Vianen 707 |
| renobilia.nl | Renobilia | The Renobilia website is a platform dedicated to the love of classic Renault cars, specifically the Renault Museum and related activities. | Cars → Classic Cars 1145 Visual Arts → Museums 2049 | renault 69 rent 981 museum 2002 collection 7566 car 10865 | |
| kappetein.nl | Jan Kappetein | This website provides a genealogical overview of the Kappetein, Kaptein, and Kapteijn families, particularly from the Hoeksche Waard and other regions of the Netherlands. | Genealogy & Family History → Dutch Genealogy 70 | genealogy 543 name 683 date 1112 family 6462 photo 7778 | Hoeksche Waard → 's-Gravendeel 200 |
| carolusbewind.nl | Carolus Bewind | Carolus Bewind is a guardianship and budget management company offering services to individuals in the Krimpenerwaard region and surrounding areas. | Legal → Guardianship 879 | budget management 280 debt 717 guardianship 767 financial 855 | South-Holland → Drechtsteden 416 |
| novaform.nl | KlokGroep | The website of Novaform provides information about the collaboration with KlokGroep and the international activities of the various locations. | Commerce → Wholesale 1855 | | North-Brabant → Eindhoven 11845 |
| denhoed.nl | Den Hoed Aannemers BV | The website of Den Hoed Aannemers BV describes the company and its services related to the restoration, maintenance, and renovation of historical buildings and monuments in the Netherlands. | Architecture & Sites → Historical Sites 1951 Monuments → Preservation 37 | buildings 898 monument 1168 restoration 3417 sustainability 18451 maintenance 20093 | Alphen aan den Rijn → AWZI Alphen a/d Rijn 358 |
| weidehofkrimpenerwaard.nl | Weidehof Krimpenerwaard | The website of Weidehof Krimpenerwaard presents agricultural nature and landscape management projects and the biodiversity of the Krimpenerwaard. | Green Spaces → Landscape Management 381 Nature → Environmental Management 529 | wetland bird 27 flora 171 polder 476 agriculture 778 landscape 2609 | |
| rijleszonderstress.nl | Rijles Zonder Stress | Rijles Zonder Stress provides driving lessons for all ages and skill levels, focusing on overcoming driving anxiety and offering a stress-free learning environment. | Driver & Vehicle → Driver’s License 1625 | driving anxiety 33 driving course 39 driving instructor 252 driver’s license 438 theory 956 driving lessons 2453 | Zaanstad → Zaandam 2740 |
| debibliotheekkrimpenerwaard.nl | Library | The website of the library serves as a portal to its collection, activities, online services, and local branches, with a particular focus on summer activities and the BiebBoys Summer Challenge. | Libraries → Local Libraries 75 Family Fun → Youth Activities 273 | library 988 collection 7566 | Krimpenerwaard → Krimpen aan de Lek 193 |
| asbest-sanering.nl | AMF Asbestsanering | The website Asbest-sanering.nl provides asbestos removal and roofing renovation services, focusing on private and business clients, and manages the entire process from application to clearance. | Environmental Technology → Asbestos Remediation 191 Building & Materials → Asbestos 122 | shingle 43 asbestos removal 134 roof renovation 205 permit 744 | Zutphen → Warnsveld 255 |
| berkbedding.nl | Berk Bedding | Berk Bedding is a website that sells boxsprings, mattresses, and related accessories. | Beds → Boxsprings 229 Bedroom → Accessories 56 | topper 92 boxspring 282 mattress 899 bedroom 2051 accessories 12975 | |
| vaneijkinstallatietechniek.nl | Van Eijk Installatietechniek Bergambacht | Van Eijk Installatietechniek Bergambacht is a recognized installer and plumber offering a variety of installation services to private and business customers. | Home Improvement → HVAC Systems 773 Home Improvement → Plumbing 2733 | climate system 78 sustainable 739 boiler 1240 plumbing 1761 air conditioning 2178 | |
| grzplus.nl | GRZPLUS | GRZPLUS is an initiative that collaborates to improve the rehabilitation and recovery of elderly individuals by sharing knowledge and working together. | Specific Institutions → Hogeschool Van Amsterdam 18 Palliative & End-Of-Life Care → Elderly Care 1061 | healthcare professionals 235 symposium 339 rehabilitation 1512 patient 4082 research 8967 care 12338 | Amsterdam → Southeast 815 |
| speksnijder.nl | Speksnijder Mode | Speksnijder Mode is a clothing store with shops in Bergambacht and Veenendaal, which also sells clothing online and specializes in festive fashion for men and women. | Fashion & Lifestyle → Television Programs 56 Fashion → Men’s Fashion 690 | fashion 2212 shop 6483 collection 7566 clothing 9443 brand 17737 | Utrecht → Veenendaal 2641 |
| ultimabedden.nl | ultimabedden.nl | The website offers handcrafted mattresses, boxsprings, and headboards, with a focus on ergonomic advice and personalized customization. | Bedding → Mattresses 402 | headboard 25 boxsprings 155 mattress 899 | Lansingerland → Bergschenhoek 568 |
| partytentverhuur-groenehart.nl | Partytentverhuur Groene Hart | The website Partytentverhuur Groene Hart offers party tents, easy-up tents, and other event rental products in the region of the Groene Hart, providing delivery and setup services and expert advice. | Event Rental → Tent Rental 437 | lighting and sound 20 party package 36 heater 184 party tent 256 table 1778 | Lansingerland → Bleiswijk 579 |
| crimpenerwaert.nl | Crimpenerwaert Dierenartsen | Crimpenerwaert Dierenartsen is a veterinary practice providing animal care in the Krimpenerwaard region and surrounding areas. | Primary Care → Veterinary Medicine 704 Veterinarians → Veterinary Clinics 419 | veterinarian 864 animal 2908 practice 9089 care 12338 | Zuidplas → Moordrecht 332 |
| slibbank.nl | Slibbank | The Slibbank website offers services in the area of soil flows, soil research, waste management and logistics, with a focus on the reuse and sustainability of raw materials and waste streams. The organization facilitates project management and provides specialized advice, including PFAS advice and Japanese knotweed research. | Civil & Infrastructure → Earthworks 370 Environment → Waste Management 2680 | soil research 49 waste stream 110 soil 930 logistics 3257 | Alphen aan den Rijn → Benthuizen 179 |
| bezemerbouw.nl | Bezemer Bouw B.V. | The website of Bezemer Bouw presents the company as a reputable construction firm with over a century of experience, specializing in new construction, renovation, and redevelopment of buildings, emphasizing quality, speed, and sustainability. | Real Estate → Project Development 633 Industry → Industrial 1987 | redevelopment 93 construction project 701 new construction 2672 home 7976 renovation 13849 | Alphen aan den Rijn → Boskoop 652 |
| bijonsaandehem.nl | Bij ons aan de Hem | The website presents a unique bed and breakfast, 'Bij ons aan de Hem', located in the polder of Bergambacht, offering accommodation and relaxation to visitors. | Accommodation → Beds 228 Food → Local & Regional Products 930 | farm shop 204 polder 476 b&b 1060 wellness 1561 hospitality 3491 accommodation 4921 | |
| veerdienst-bergstoep.nl | B.V. Veerdienst Bergstoep | The website of B.V. Veerdienst-Bergstoep provides information about the ferry service between Bergambacht and Groot-Ammers/Streefkerk, including details about fares, schedules, and vehicle options. | Water Transportation → Ferries 129 Bus Services → Public Transportation 782 | fare 86 ferry 179 traffic 916 schedule 2624 vehicle 3743 | Molenlanden → Groot-Ammers 158 |
| jongenhoeve.nl | Kaasboerderij Jongenhoeve | Kaasboerderij Jongenhoeve is a farm producing and selling traditional Gouda cheese. | Farms & Farm Businesses → Cheese Farms 36 Tourism → Rural Tourism 59 | milk 421 taste 933 cheese 1205 farm 2622 shop 6483 history 7286 | South-Holland → Gouda 3521 |
| zorgvoordier.nl | ZorgvoorDier | ZorgvoorDier is a company offering professional pet care services at home, including cat sitting, pet sitting, and grooming. | Animals → Animal Care 1849 | cat sitting 21 pet sitting 36 grooming 896 pet 1617 | Ouder-Amstel → Ouderkerk aan de Amstel 410 |
| homeopathiebergambacht.nl | Visie Homeopathie | The website of Marije Rappoldt-Smits is an online practice for classical homeopathy in Bergambacht, offering homeopathic treatments for the whole family. | Alternative Medicine → Homeopathy 627 | homeopathy 529 practice 9089 treatment 21203 | |
| garagewestland.nl | Garage Westland | Garage Westland is an auto dealership located in Wateringen that offers a wide range of automotive maintenance and repair services, including vehicle inspections, tire sales, and used car sales, and is known for its customer-friendliness and fixed prices. | Tires → Tire Service 931 Maintenance & Services → MOT 59 | mot 806 used cars 894 tire 1975 appointment 13510 repair 14576 maintenance 20093 | Westland → Wateringen 536 |
| drukkerijendrukwerk.nl | drukkerijendrukwerk.nl | The website provides an overview of printing companies and print shops in the Netherlands. | Directories → Websites 3473 Design & Creative → Graphic Services 1003 | printing companies 14 town 126 province 518 address 901 print 5511 | Westerwolde → Blijham 62 |
| gouda-loodgieter.nl | Folstra B.V. | Folstra B.V. is a plumber and installation company serving Gouda and the surrounding area. | Home Improvement → Plumbing 2733 | pipework 84 sanitary 750 leak 1204 drainage 1322 heat 2188 installation 13742 | Oudewater → Papekop 27 |
| inekeweevers.nl | Ineke Weevers | The website of Ineke Weevers showcases her artwork, exhibition locations, and membership of the Kunstenaars Collectief Breekijzer. | Galleries → Individual Galleries 51 Painting → Acrylic Painting 547 | paintings 3907 exhibition 5332 artist 5745 photography 9503 | Oude IJsselstreek → Ulft 392 |
| hof21.nl | Brasserie Hof21 | The website of Brasserie Hof21 is an online presence of a brasserie located in Bergambacht, focused on offering food, drinks, and a welcoming atmosphere to visitors. | Brasseries & Bistros → Brasserie 1005 Food & Dining → Outdoor Seating 228 | brasserie 752 reservation 3373 atmosphere 5591 dish 5936 menu 13856 | |
| agbbouw.nl | AGB Bouw | The website of AGB Bouw presents the company as an ambitious builder based in Stolwijk, specializing in building functional buildings for diverse clients. | Renovation & Restoration → Construction Industry 499 | buildings 898 collaboration 16036 | Krimpenerwaard → Stolwijk 232 |
| prokrimpenerwaard.nl | Pro Krimpenerwaard | Pro Krimpenerwaard is a political party dedicated to creating an honest, sustainable, social, and animal-friendly Krimpenerwaard. | Local Politics → Parties 622 Local Politics → Political Parties 898 | motion 94 municipality 6837 research 8967 | Krimpenerwaard → Schoonhoven 544 |
| dezorgendehand.nl | Thuiszorg de Zorgende Hand | Thuiszorg de Zorgende Hand is a care organization that provides various forms of care, focused on supporting people to maintain their independence. | Social Services → Youth Support 530 Health → Medical Care & Services 29461 | flexibility 996 provider 1111 care 12338 | Zuidplas → Moordrecht 332 |
| amolenaar.nl | A. Molenaar B.V. | The website of A. Molenaar is a company specializing in ground, road, and water construction services, including soil remediation, paving, groundwork, sand and gravel delivery, and the preparation of building sites. | Civil & Infrastructure → Ground 120 | sewer 246 ground 286 sand 630 groundwork 1348 | Krimpenerwaard → Lekkerkerk 244 |
| zorgboerderij-bijdehem.nl | Zorgboerderij ‘Bij de Hem’” | The website of Zorgboerderij ‘Bij de Hem’ provides information about a care farm offering small-scale day care for young people, adults, and seniors, with a focus on meaningful work, social connections, and relaxation in nature. | Farms & Farm Businesses → Care Farms 473 Disability Services → Day Programs 305 | social connection 35 care farm 246 staff 3405 | Krimpenerwaard → Schoonhoven 544 |
| uwbegrafenisverzorger.nl | Speksnijder Begrafenisverzorging | Speksnijder Begrafenisverzorging is a funeral home providing support to bereaved families in the Krimpenerwaard & Gouda region, focusing on arranging dignified funerals. | Death → Funerals 552 Family → Funeral Services 2084 | bereaved 291 farewell 1109 grief 1577 funeral 2477 | South-Holland → Gouda 3521 |
| pannenkoekenrestaurantonderdemolen.nl | Scheer Family | Pannenkoekenrestaurant Onder de Molen is a restaurant located in Bergambacht that serves traditional Dutch pancakes and offers catering services. | Family & Themed Dining → Pancakes 49 Family & Themed Dining → Pancake Restaurants 166 | pancakes 568 drink 5191 party 5928 restaurant 11215 menu 13856 | |
| picknickbakfiets.nl | Picknickbakfiets | The website of ‘Picknickbakfiets’ offers a unique picknick experience, providing a convenient bike with picknick supplies for rent. | Cycling → Electric Bikes 445 Cycling → Bicycle Rental 643 | basket 275 polder 476 bike 1541 route 3425 | Midden-Groningen → Zuidbroek 184 |
| denhaesell.nl | Hannie van Haselen | The website of Bed & Breakfast 'den Haesell' presents a country-located bed and breakfast in Bergambacht, featuring two apartments and descriptions of the surrounding area and amenities. | Nature → Cycling 472 AccommodationTypes → Other Accommodation 172 | bed & breakfast 319 apartment 5088 | Molenlanden → Kinderdijk 158 |
| molendenarend.nl | Molen den Arend | The website of Molen den Arend presents information about the history, management, opening hours, and offerings of the historic windmill, including the mill shop and events. | Historical Sites → Windmills 100 Cultural Heritage → Historic Landmarks 19 | millshop 20 windmill 249 history 7286 event 45199 | |
| heijmanswoningontruiming.nl | Heijmans Woningontruiming | The website of Heijmans Woningontruiming offers professional services for residential and commercial property clearance throughout the Netherlands, including specialized services such as estate clearance, post-mortem clearance and the purchase of household goods. | Home Services → Clearance 280 Moving & Storage → Moving 1289 | household goods 141 clearance 349 move 1441 transport 6105 quote 12863 | Maastricht → Maastricht-Southeast 113 |
| kooronomatopee.nl | Vocal Ensemble Onomatopee | The Vocal Ensemble Onomatopee website showcases the repertoire, upcoming performances, and contact information of an enthusiastic singing ensemble. | Film → Production Companies 406 | footage 48 ensemble 546 repertoire 2497 arrangement 3104 concert 4409 performance 7586 | Alphen aan den Rijn → Hazerswoude-Rijndijk 235 |
| vanegmondmakelaardij.nl | Van Egmond Makelaardij B.V. | Van Egmond Makelaardij B.V. is a real estate agency specializing in the purchase and sale of homes and commercial properties in the Krimpenerwaard region. The website aims to help clients find their ideal home or successfully sell their current property through tailored solutions. | Property Finance → Purchase 493 Property Agents & Brokers → Brokers 356 | stock 1154 value 1352 appraisal 1488 purchase 2212 sale 5930 house 8121 | Krimpenerwaard → Krimpen aan de Lek 193 |
| verdo.nl | Verdo Staal | The Verdo Staal website showcases the company and its services related to steel construction and buildings. | Building & Materials → Steel & Metal 779 Fabrication & Production → Fabrication 93 | detail 638 buildings 898 steel 1177 truck 1412 | |
| bijmargo.nl | Margo SLAPEN EN ONTBYTEN | Margo Slapen en Ontbijten is a bed & breakfast located in Bergambacht, operating from a renovated farmhouse. | Accommodation → Guesthouses 726 Accommodation → Lodging 317 | bed and breakfast 305 sleep 746 farmhouse 878 guest 1334 walk 2161 nature 9094 | Midden-Groningen → Zuidbroek 184 |
| steunpunt-middenholland-rijnstreek.nl | Parent and Youth Support Point Midden Holland and Rijnstreek | The Parent and Youth Support Point for Midden Holland and Rijnstreek provides information and answers to questions about appropriate education (passend onderwijs) for primary and secondary education in the Gouda region, including Alphen a/d Rijn, Krimpenerwaard, and Waddinxveen. | Primary & Secondary Schooling → Secondary Education 1639 Curriculum & Resources → Educational Resources 401 | chat 544 question 2261 education 13471 collaboration 16036 | Nieuwkoop → North 117 |
| dietz.nl | Dietz | Dietz is an advisory firm specializing in spatial issues and citizen participation in decision-making. | Architecture → Urban Planning 1465 Community → Government & Administration 10567 | spatial issues 10 decision making 40 participation 1430 strategy 9379 communication 10162 | The Hague → City Center 445 |
| totalharmony.nl | Total Harmony | The website Total Harmony is a practice offering naturopathic therapies, nutritional advice, massage and health coaching, aiming to help people become fitter and more vital, and to treat and prevent chronic ailments. | Alternative Medicine → Complementary Therapies 858 | wellness 1561 vitality 1726 nutrition 4935 complaint 6479 therapy 7448 massage 7646 | |
| my-lex.nl | MY-LEX | MY-LEX provides a comprehensive content integration search engine and solutions for managing the entire document lifecycle. | Business Software → Document Management 328 IT → Software Services 59 | search engine 536 integration 1451 document 1678 archive 2067 | The Hague → City Center 445 |
| demengelmoestuin.nl | MengelmoesTuin | The website of the MengelmoesTuin presents the activities, products, and location of a natural fruit and herb garden that is present at various markets and events. | Plants → Nurseries 1012 | harvest 275 herbs 924 market 2772 newsletter 6504 garden 13129 | Zeist → Huis ter Heide 38 |
| elannotarissen.nl | Elan Notarissen | Elan Notarissen is a notary office providing expert legal advice and services to individuals and businesses, including wills, estate planning, and the drafting of purchase agreements. | Inheritance Law → Wills 200 Law → Business Law 1361 | llc 13 purchase agreement 56 estate planning 93 will 510 notary 791 mortgage 4564 | De Wolden → De Wijk 96 |
| thorvolleybal.nl | Volleybalvereniging THOR Bergambacht | The website of Thor Volleybal Vereniging Bergambacht provides information about the volleyball association, including membership, teams, events, and contact details. | Volleyball → Volleyball Associations 72 | volleyball association 42 youth 3126 match 3471 membership 10442 | |
| amadeushuis.nl | Amadeushuis | The Amadeushuis provides small-scale residential care for elderly individuals with dementia, with music as a central theme, focused on preserving personal lifestyles and creating a warm, familiar environment. | Elderly Care → Dementia Care 41 Care → Residential Care 305 | dementia 674 studio 5465 home 7976 care 12338 music 13170 | Lansingerland → Bergschenhoek 568 |
| verloskundigenpraktijkbevaltbeter.nl | Bevalt Beter | Bevalt Beter is a midwifery practice that supports pregnant women and women who wish to become pregnant. | Pregnancy & Childbirth → Midwifery 619 | breastfeeding 398 midwife 553 ultrasound 769 childbirth 894 pregnancy 2739 | Krimpenerwaard → Berkenwoude 62 |
| vesuvio.nl | Il Vesuvio | The website of Pizzeria Il Vesuvio presents the historic pizzeria in The Hague, with a mobile pizza wagon that also sells pizzas at various locations. | Essential → Food 47999 | pizza 4158 event 45199 | Krimpenerwaard → Berkenwoude 62 |
| autoschadezijdepark.nl | ASN Autoschade Zijdepark | ASN Autoschade Zijdepark Bergambacht is an auto body repair shop that quickly and efficiently handles damage to passenger cars and company vehicles. | Auto Repair Services → Dent Repair 186 Manufacturing & Industrial → Industrial Services 400 | damage 1562 transportation 2851 insurance 6359 car 10865 repair 14576 | |
| ekb-nl.nl | EKB Container Logistik Nederland B.V. | EKB Container Logistics Netherlands is a logistics company specializing in container transport across Europe. | Freight & Shipments → International Logistics 107 | inland waterway 69 rail 199 europe 289 container 1709 transport 6105 | South-Holland → Rotterdam 25048 |
| josedonatzafscheidsfotografie.nl | José Donatz Afscheidsfotografie | The website of José Donatz Afscheidsfotografie offers professional photo recordings of funerals, aiming to help bereaved families honor and capture the farewell of a loved one. | Death → Funerals 552 | farewell photography 13 photo report 56 funeral 2477 | |
| marketingkaart.nl | Marketingkaart | The website, Marketingkaart, provides an overview of 500+ Dutch marketing professionals and helps users quickly find a marketing agency that meets their needs. | Online Marketing → Affiliate Marketing 299 Business Development → Business Marketing 614 | marketer 42 compare 582 agency 944 marketing 7107 quote 12863 | Goeree-Overflakkee → Middelharnis 340 |
| taxicentraleappie.nl | Taxicentrale Appie | The website of Taxicentrale Appie in Gouda offers reliable and affordable taxi and transportation services, both locally and to international destinations via Schiphol Airport, and serves specific transportation needs such as school transportation and business travel. | Taxi & Ride Services → Taxi 1062 Specialized Transport → Business Transportation 231 | taxi 2090 rate 2606 transportation 2851 | Krimpenerwaard → Krimpen aan de Lek 193 |
| nana.nl | NANA Groen-Wonen | The website of 'NANA Groen-Wonen' is a florist shop offering a wide range of flowers, plants, and related items, specializing in occasion flowers, funeral flowers, bridal flowers, and corporate flowers, located in Bergambacht. | Flowers → Florists 1410 | bridal 96 pottery 152 facebook 850 funeral 2477 flowers 3248 home 7976 | Krimpenerwaard → Berkenwoude 62 |
| accountantkaart.nl | Accountantkaart | The website Accountantkaart presents a top 500 of Dutch accountants. | Apps → Business Apps 10 Accounting → Service Providers 63 | accountant 611 quote 12863 | Goeree-Overflakkee → Middelharnis 340 |
| bobdenboer.nl | DitchWitch B.V. | The website describes the activities of a company specializing in horizontal drilling underground, primarily between cables and pipelines in the Netherlands. | Construction Technology → Drilling 71 | pipeline 204 drill 303 cable 732 machine 3727 | North-Holland → Zandvoort 1298 |
| dietistenpraktijkkuiperbesten.nl | Dietistenpraktijk De Kuiper & Den Besten | The website of Dietistenpraktijk De Kuiper & Den Besten is a practice offering nutrition advice and treatment plans for various health issues and lifestyle questions, with a focus on personalized guidance and flexible appointments. | Medical Care & Services → Nutrition 5799 Health → Disease & Treatment 4805 | treatment plan 380 diet 747 lifestyle 2918 practice 9089 | Krimpenerwaard → Schoonhoven 544 |
| elsvandenboogaard.nl | Els van den Boogaard | The website of Els van den Boogaard showcases her paintings and provides an overview of past exhibitions. It offers insight into her artistic portfolio and the locations where her works have been displayed. | Painting → Oil Painting 326 Galleries & Exhibitions → Exhibitions 1083 | oil painting 19 abstracts 28 acrylic 506 landscape 2609 paintings 3907 exhibition 5332 | Hoeksche Waard → 's-Gravendeel 200 |
| bakkerarkel.nl | Bakker Arkel Bouwbedrijf | The website of Bakker Arkel Bouwbedrijf presents the profile of a family-owned construction company specializing in (new) construction, renovation, and maintenance of real estate, primarily in West Netherlands. | Construction Companies → Construction Contractors 536 | real estate 4981 construction 7421 renovation 13849 collaboration 16036 maintenance 20093 | Schiedam → Schiedam Center 52 |
| aannemersbedrijfklapwijk.nl | Klapwijk Aannemersbedrijf | Klapwijk Aannemersbedrijf is a construction company specializing in new construction, extensions, renovations, maintenance, and remodeling of residential and commercial buildings. | Construction Companies → Additions 458 Building & Materials → Carpentry & Joinery 830 | extension 1941 new construction 2672 roofing 2806 tile 2869 renovation 13849 maintenance 20093 | Molenlanden → Nieuw-Lekkerland 188 |
| zangeralex.nl | Alex | The website of Alex, a Dutch party artist, presents his event schedule, music releases, and an overview of his 25-year anniversary show. It also provides information about events where he performs. | Popular → Pop 299 Theater → Performances 649 | playlist 231 schedule 2624 concert 4409 performance 7586 music 13170 event 45199 | Haarlemmermeer → Nieuw-Vennep 869 |
| bergambachtoptiek.nl | Bergambacht Optiek | Bergambacht Optiek is an optician specializing in personalized eye care services. | Specialty Medicine → Optometry 539 Services → Opticians 551 | eye measurement 232 eye care 233 eyeglasses 437 contact lenses 538 appointment 13510 | |
| bzc-bergambacht.nl | BZC Bergambacht | The website of BZC Bergambacht provides information about the water polo club, including membership details, sporting activities, swimming lessons, and contact information. | Sports Clubs → Water Polo 219 Swimming → Swimming Clubs 242 | swimming lesson 393 match 3471 webshop 8648 membership 10442 | |
| hoeksesluis.nl | Belevenisboerderij De Hoeksesluis | De Hoeksesluis is a farm experience farm offering hospitality, respect for nature and various activities. | Accommodation → Beds 228 | farm 2622 animal 2908 hospitality 3491 accommodation 4921 nature 9094 event 45199 | Krimpenerwaard → Lekkerkerk 244 |
| aandedijck.nl | Restaurant and bar Aan de Dijck | The website aims to inform visitors about restaurant and bar 'Aan de Dijck', a hospitality establishment in the Krimpenerwaard, and to offer the possibility of reservations, viewing the menu, and seeing upcoming events. | Bars → Pubs 546 | hostess 165 bar 1216 terrace 4847 restaurant 11215 menu 13856 event 45199 | |
| eetcafebergambacht.nl | Eetcafe 't Centrum | Eetcafe 't Centrum is a restaurant located in Bergambacht offering a welcoming and cozy atmosphere. | Cafes & Lunch → Local Restaurants 29 Mediterranean & Middle Eastern → Takeout 286 | soup 1043 buffet 1747 terrace 4847 catering 6456 restaurant 11215 menu 13856 | |
| nabilsbarbershop.nl | Nabil’s Barbershop | Nabil’s Barbershop is a modern barbershop in Bergambacht that focuses on providing stylish haircuts and good service. | Men’s Grooming → Barbers 393 Services → Personal Services 1062 | look 169 barber 418 beard 468 haircut 1158 treatment 21203 | |
| slapenindepolder.nl | Slapen in de Polder | Slapen in de Polder is a Bed and Breakfast (B&B) offering holiday homes in the Krimpenerwaard. | Landscape → Polders 212 AccommodationTypes → Holiday Rentals 20 | e bike 40 polder 476 peace 1113 holiday home 2753 terrace 4847 kitchen 6443 | South-Holland → Rotterdam 25048 |
| oskamschoenen.nl | Oskam shoes | The Oskam shoes/sport/clothing website presents a wide assortment of shoes, sportswear, and clothing for women, men, and children. | Clothing → Activewear 642 Fashion → Shoes 1274 | sportswear 352 shoes 2699 assortment 7799 clothing 9443 brand 17737 | |
| houdijkdenboer.nl | Loonbedrijf Houdijk den Boer BV | Loonbedrijf Houdijk den Boer BV is a rental and service company operating in the GGW, sports fields, and horticulture sectors. | Relationships → Partnerships 481 Logistics & Transportation → Rental Companies 414 | path 466 level 494 machine 3727 rental 7257 | |
| topkamerverhuur.nl | Topkamerverhuur.nl | The website offers a network of rental rooms in the Netherlands. | Rental Properties → Rooms 102 Energy & Sustainability → National Websites 11 | landlord 267 database 1153 room 3411 rental 7257 | Bunschoten → Bunschoten-Spakenburg 382 |
| 112krimpenerwaard.nl | Krimpenerwaard Municipality | The website provides ambulance call logs from the Krimpenerwaard municipality and surrounding areas. | Emergency Services → Fire Department 138 Health → Medical Care & Services 29461 | ambulance 178 call 204 emergency 750 municipality 6837 | Krimpenerwaard → Krimpen aan de Lek 193 |
| deguldenvrijheid.nl | Buurtvereniging De Gulden Vrijheid | The website of De Gulden Vrijheid neighborhood association presents information about the activities and events that the association organizes for the neighborhood of Opperduit. | Neighborhood Organizations → Residents’ Associations 965 Community & Social → Community Activities 52 | neighborhood 2424 association 8562 event 45199 | Krimpenerwaard → Lekkerkerk 244 |
| hervormdbergambacht.nl | Hervormde Gemeente Bergambacht | The website of the Bergambacht Reformed Congregation provides information about the church, its activities, services, and contact details. | Reformed → Dutch Reformed Church 219 Protestantism → Churches 1009 | pastoral care 122 mission 1000 church 3439 app 4595 collection 7566 | |
| bos-grotematenmode.nl | Bos Grote Maten Mode | Bos Grote Maten Mode is an online store specializing in clothing for men with larger sizes, particularly those who are tall and/of stout. | Fashion → Men’s Fashion 690 Context 161394 | men's clothing 18 size 800 assortment 7799 clothing 9443 brand 17737 | |
| publiquest.nl | Publiquest | Publiquest is a communication bureau established in 2016 as a strategic collaboration between three leading communication agencies. The agency focuses on strategy, dialogue, and participation to make complex issues, such as elder abuse, visible. | Writing → Copywriters 632 Communication → Science Communication 68 | dialogue 426 strategy 9379 communication 10162 | Rotterdam → Feijenoord 477 |
| bijlfietsen.nl | Bijl Tweewielercentrum | Bijl Tweewielercentrum is an e-bike specialist offering a wide range of electric bikes and accessories in Bergambacht. | Auto Parts & Tires → Wheels 545 Cycling → Electric Bikes 445 | e-bike 908 bike 1541 accessories 12975 brand 17737 | Utrecht → Lopik 464 |
| overslagbergambacht.nl | Overslag Terminal Bergambacht B.V. | The website of Overslag Terminal Bergambacht (OTB) presents the services and activities of a family-run business specializing in inland waterway and road freight transport in the Hollands Midden region. | Transportation Services → Freight Transport 378 Administrative Support → Family Businesses 664 | load 136 container 1709 storage 2446 transport 6105 | South-Holland → Rotterdam 25048 |
| mdewitte.nl | Bouwkundig Bureau M. de Witte | The website of Bouwkundig Bureau M. de Witte provides architectural services, including drawings, permits, advice, and structural calculations, primarily focused on the Krimpenerwaard and Rotterdam regions. | Visual Arts → Drawing 1046 Engineering → Engineering Firms 989 | structural calculation 36 permits 643 drawings 1329 budget 1335 | Krimpenerwaard → Krimpen aan de Lek 193 |
| slagerijfredvanlaar.nl | Slagerij Fred van Laar | The website of Slagerij Fred van Laar presents the products and services of a traditional butcher shop and catering service, located in Bergambacht, with a focus on quality, traditional preparation, and a wide range of products. | Supermarkets & Grocery → Butchers 747 Dairy & Cheese → Delicatessens 617 | sausage 256 meal 1638 meat 2055 promotion 2062 catering 6456 assortment 7799 | |
| ababanden.nl | ABA Banden | ABA Banden is a specialist in Stolwijk providing a wide range of tires, wheels, and truck tires for customers in the region. | Tires → Tire Service 931 Auto Parts & Tires → Wheels 545 | truck tires 15 wheel 746 tire 1975 car 10865 | Krimpenerwaard → Schoonhoven 544 |
| kyaros.nl | Kyaros | Kyaros is a luxury cat resort and grooming salon located in Krimpen aan de Lek, Netherlands, offering temporary accommodation and care for cats. | Dog Care → Grooming Salons 651 Accommodation → Pet Hotels 89 | grooming salon 263 resort 279 accommodation 4921 care 12338 | Krimpenerwaard → Krimpen aan de Lek 193 |
| haptonomie-gouda.nl | Christine Bak | The website provides information about haptotherapy and haptonomic pregnancy guidance offered by Christine Bak in Gouda, focusing on restoring balance and guiding through pregnancy and loss. | Therapy → Haptotherapy 633 Health → Pregnancy & Childbirth 4222 | haptonomy 121 haptotherapy 444 loss 740 pregnancy 2739 | Zuidplas → Moordrecht 332 |
| deleerhulp.nl | De Leerhulp | De Leerhulp is an organization that provides support and guidance to students in primary and secondary education. | Educational Support → Student Guidance 134 Learning Disabilities → Dyslexia 438 | atmosphere 5591 research 8967 | |
| iconsult.nl | iConsult | iConsult offers a software package (SnelStart) for invoicing and accounting, including installation, support, and integration with other systems. | Business Software → Accounting Software 984 Business Software → Invoicing Software 104 | snelstart 16 invoice 795 integration 1451 account 5781 | |
| campingdebovenstad.nl | Camping de Bovenstad | Mini-camping de Bovenstad is a rural campsite located in the Green Heart of Holland, near the river Lek, offering camping facilities to guests. | Cycling → Bicycle Rental 643 Tourism → Rural Tourism 59 | shower 270 river 312 caravan 1394 bike 1541 campsite 2093 | Krimpenerwaard → Schoonhoven 544 |
| daginfo.nl | Daginfo.nl | Daginfo.nl is a website that provides an overview of local, regional, and national news. | Providers → Domain Names 1466 News & Journalism → News Websites 340 | overview 329 domain 1811 region 5412 news 15293 | Montfoort → Linschoten 169 |
| smash-tennis-padel.nl | Smash Tennis & Padel | The Smash Tennis & Padel website offers a wide range of tennis and padel courses and clubs for various levels and ages, focusing on both performance and recreation. | Tennis → Padel 880 | padel 602 tennis 836 club 4225 lesson 5154 course 14728 | Midden-Delfland → Maashorst 275 |
| meetbureauwindroos.nl | Meetbureau Windroos | Meetbureau Windroos provides professional surveying and building measurement services for various construction projects. | Technology & Innovation → Construction Technology 790 | volume 166 dimension 216 survey 370 measurement 731 | South-Holland → Sliedrecht 863 |
| staal2000.nl | Staal2000 | The website of Staal2000 presents the company as a specialist in the calculation, engineering, delivery, and assembly of steel structures, with over 35 years of experience in the metal industry and a focus on reliability and customer service. | Metals & Fabrication → Metals 486 Assembly & Production → Assembly 227 | steel structure 208 job vacancies 1241 engineering 1468 assembly 1733 | Krimpenerwaard → Gouderak 103 |
| keukenstyl.nl | KeukenStyl | KeukenStyl is a complete kitchen solution, offering design and purchase services to help customers create their dream kitchens. | Kitchen → Kitchen Design 443 Kitchen & Dining → Kitchen Shops 15 | advisor 1055 style 2348 wishes 2717 equipment 4143 kitchen 6443 design 27202 | Emmen → Klazienaveen 297 |
| avvhoveniers.nl | AVV Hoveniers | AVV Hoveniers is a landscaping company offering services for garden design, landscaping, maintenance, and related work, such as paving, planting, and boundary demarcation. | Outdoor & Garden → Landscape Companies 339 | garden maintenance 462 garden design 964 landscaping 1529 paving 1942 | Buren → Beusichem 163 |
| makelaaroverzicht.nl | HuisVerkopen.nl | The website provides an overview of real estate agents in the Netherlands and information about selling and buying houses. | Property Valuation & Appraisal → Regional Real Estate Agents 454 Boats → Selling 20 | buy 169 sell 230 agent 1253 valuation 2697 house 8121 | Simpelveld → Bocholtz 70 |
| zontec.nl | Zontec | The Zontec website provides information and offers sustainable solar energy solutions for businesses and private individuals, including advice, installation, and maintenance. | Energy & Sustainability → Energy Consulting 883 | roof 3662 solar panels 4701 quote 12863 installation 13742 maintenance 20093 | Rheden → Velp 700 |
| bosbedrijfskleding.nl | Bos Bedrijfskleding | Bos Bedrijfskleding is a supplier of workwear and business attire, offering a wide range of products and customization options. | Clothing → Workwear 1001 Commerce → Textile Retail 137 | attire 17 workwear 851 shoes 2699 print 5511 assortment 7799 | Krimpenerwaard → Stolwijk 232 |
| cbs-deark.nl | Christelijke BasisSchool de Ark | The Christelijke BasisSchool de Ark in Bergambacht is a Christian primary school that offers open and passionate education to all students. | Primary Education → Christian Education 446 Higher Learning → Educational Institutions 1049 | study day 40 annual report 877 tour 2315 vacancy 6598 school 7856 | |
| herrevelddevogel.nl | Herreveld & de Vogel makelaardij | Herreveld & de Vogel makelaardij is a real estate agency specializing in the Krimpenerwaard, dedicated to guiding private and commercial clients through the purchase, sale, and rental of real estate. | Property Agents & Brokers → Regional Agents 352 Commercial Property → Office Buildings 144 | negotiation 296 valuation 2697 property 7406 house 8121 | Utrecht → Lopik 464 |
| goudseslotenmaker.nl | Goudse Slotenmaker | The website of Slotenmaker Gouda offers 24/7 emergency locksmith services and locksmith repair services in Gouda and the surrounding municipalities, with a focus on reliability, quality, and transparency. | Security Systems → Lock Systems 124 Transportation → Emergency Services 630 | locksmith 919 locks 953 security 6655 | Zuidplas → Moordrecht 332 |
| camperpioneer.nl | Camper Pioneer | The website Camper Pioneer offers custom-built bus campers, focusing on various truck brands and a wide range of designs and options. | Camping → Bus Campers 20 Vehicles → Camper Vehicles 72 | buscamper 40 creative 539 layout 899 truck 1412 portfolio 6854 sustainability 18451 | |
| autobedrijfterlouw.nl | Smits Auto | The website informs about the cessation of operations of Carteam Autobedrijf Terlouw in Bergambacht and refers customers to colleague car dealership Smits Auto for maintenance, warranty, and roadside assistance. | Automotive → Cars (Brands) 436 | winter tires 113 roadside assistance 211 used cars 894 warranty 4701 maintenance 20093 | |
| ctbb.nl | CTBB B.V. | The website of CTBB B.V. presents company information and the scope of their civil technical works. | Engineering → Engineering Firms 989 Construction → Civil & Infrastructure 3453 | distribution center 77 buildings 898 infrastructure 1460 work 3122 | Lansingerland → Bleiswijk 579 |
| peterstuurman.nl | Peter Stuurman Photography | The website of Peter Stuurman Photography presents and sells photographs of the Krimpenerwaard, a polder region in the Green Heart of the Netherlands, and offers photography courses. | Nature & Landscape → Nature Photography 482 Nature & Landscape → Landscape Photography 530 | photographs 254 polder 476 course 14728 | Krimpenerwaard → Schoonhoven 544 |
| flirtfashion.nl | FlirtFashion | The website of FlirtFashion presents a women's fashion store with locations in Lekkerkerk, Papendrecht, and Bergambacht. The aim is to inform visitors about opening hours, locations, and the offered clothing. | Fashion → Men’s Fashion 690 | women's fashion 105 opening hours 2953 store 3901 clothing 9443 | Krimpenerwaard → Lekkerkerk 244 |
| toa-geluidsinstallaties.nl | Vodavi bv | The website of TOA geluidsinstallaties and Vodavi bv offers a selection of audio and broadcast installations, amplifiers, microphones, and speakers, geared towards professional applications and custom solutions. | Installation & Fixings → Installation Materials 247 Audio → Sound Technology 168 | sound system 166 microphone 198 amplifier 302 speaker 1481 installation 13742 | |
| rioolserviceklapwijk.nl | Klapwijk Rioolservice | The website of Klapwijk Rioolservice offers drain services, including unclogging, repair, inspection, odor detection, preventative maintenance, new installation, and replacement of drainage systems, and informs visitors about potential misdirection and fraud within the drain cleaning sector. | Plumbing → Waste Water Management 14 Plumbing → Drainage 570 | unclogging 244 drain 886 drainage 1322 vacancy 6598 quote 12863 repair 14576 | Krimpenerwaard → Krimpen aan de Lek 193 |
| hvsamenwonen.nl | Huurdersvereniging Samen Wonen (HSW) | The website of the Huurdersvereniging "Samen Wonen" (HSW) serves as a platform for tenants of the housing corporation "QuaWonen" in the communities of Schoonhoven, Bergambacht, Berkenwoude and Ammerstol to find information and contact regarding their rights and interests. | Rental Properties → Tenant Associations 351 Homeownership & Management → Housing Corporations 426 | right 379 tenant 920 complaint 6479 | Krimpenerwaard → Schoonhoven 544 |
| bothautos.nl | Both Auto's Bergambacht | Both Auto's Bergambacht is a family-run car dealership offering car sales, maintenance, repairs, and used car sales. | Automotive → Car Dealerships 1647 Transportation → Automotive Technology 315 | used car 825 apk 1333 tire 1975 air conditioning 2178 car 10865 maintenance 20093 | |
| tcberkenwoude.nl | TC Berkenwoude | The website of TC Berkenwoude Tennis Club provides information about the club, including events, the agenda, rules, news, and membership information. | Sports Clubs → Local Sports Clubs 248 Tennis → Tennis Clubs 720 | tennis club 337 tournament 2476 agenda 4374 membership 10442 | Krimpenerwaard → Berkenwoude 62 |
| winkelhof.nl | Winkelhof Bergambacht | The Winkelhof Bergambacht website is a shopping center located in Bergambacht, offering a diverse range of products and services, including home goods, fashion, shoes, accessories, food, care, pet supplies, and more. | Shopping Centers → Local Shopping Centers 26 Economy → Local Economy & Development 721 | home goods 39 voucher 279 shopping center 491 instagram 1216 fashion 2212 food 3872 | |
| willdoomakelaardij.nl | Willdoo Makelaardij | Willdoo Makelaardij is a real estate agency located in Schoonhoven that specializes in selling, renting, and buying properties. | Property Valuation & Appraisal → Regional Real Estate Agents 454 Real Estate → Immobilien 284 | agent 1253 wishes 2717 sale 5930 rental 7257 house 8121 | Krimpenerwaard → Schoonhoven 544 |
| degenkamp-isolatie.nl | Degenkamp Isolatie B.V. | Degenkamp Isolatie is a company specializing in various forms of insulation, including heat, cold, and acoustic insulation, and offers thermal inspections and advice. | Insulation & Glazing → Insulation 1543 | cost 1990 insulation 2448 energy 9075 | Zuidplas → Moerkapelle 213 |
| vanderendebv.nl | Bouw- en aannemingsbedrijf Van der Ende | The website of Bouw- en aannemingsbedrijf Van der Ende from Bergambacht presents the company as a comprehensive general contractor specializing in new construction, maintenance, and commercial construction, operating in the Randstad region and focused on delivering high-quality projects for various clients. | Architecture → Architectural Services 1006 Project Management → Construction Management 1038 | housing corporation 424 new construction 2672 maintenance 20093 | Almere → Almere City 934 |
| jvbergambacht.nl | JVB – Jeu de Boules Vereniging Bergambacht | The website of JVB – Jeu de Boules Vereniging Bergambacht provides information to members, potential members, and visitors about the association, its activities, rules, members, and contact details. | Team Sports → Boules 159 | boules 38 clubhouse 784 tournament 2476 sponsors 2642 region 5412 member 10154 | |
| bedrijfsbouwpartners.nl | Bedrijfsbouw Partners | Bedrijfsbouw Partners is a construction company specializing in the design and construction of office buildings and commercial real estate. | Commercial Property → Business Parks 324 Construction Companies → Residential Construction 1013 | office buildings 31 business park 372 real estate 4981 construction 7421 collaboration 16036 | Hoeksche Waard → Heinenoord 123 |
| vanreeuwijkbv.nl | Van Reeuwijk B.V. | Van Reeuwijk B.V. is a company specializing in various demolition and construction-related services. | Building & Materials → Demolition Services 317 | drill 303 asbestos 387 demolition 1144 renovation 13849 | |
| bedrijvenadressen.nl | www.bedrijvenadressen.nl | The website ‘Companies & Directories’ is a directory that presents local businesses and contact information by municipality. | Office & Workspace → Business Directories 421 | municipality 6837 | Reimerswaal → Yerseke 262 |
| destelling.nl | De Stelling | De Stelling offers various spaces for storage and business, including garage boxes, office units, and business units in Gouda and Bergambacht. | Office & Workspace → Office Space 1292 | self storage 20 business unit 129 garage box 138 space 3846 price 8328 | South-Holland → Gouda 3521 |
| gemeentehuisvesting.nl | GemeenteHuisvesting | GemeenteHuisvesting is a knowledge platform focused on developments and innovations impacting the work environment of municipal organizations regarding workspace. | Energy → Heat Generation 66 Management & Consulting → Consultants 444 | operation 480 workplace 1046 innovation 4659 municipality 6837 sustainability 18451 | Land van Cuijk → Mill 342 |
| witvlietmeubelen.nl | Witvliet Meubelen | Witvliet Meubelen is an interior construction and furniture maker that creates custom interiors and furniture for private and business clients. | Interior → Furniture 7454 Crafts → Woodworking 1109 | wood 4153 interior 8093 furniture 8751 design 27202 | |
| leukeauto.nl | Leukeauto.nl | Leukeauto.nl is an automobile dealership based in Bergambacht that offers used cars and financing options. | Loans & Credit → Auto Loans 242 Leasing → Auto Lease 30 | used car 825 showroom 4883 finance 5341 car 10865 | |
| okkrimpenerwaard.nl | Ondernemerskring Krimpenerwaard | The Ondernemerskring Krimpenerwaard is an organization that connects and strengthens entrepreneurs in the Krimpenerwaard region, with the goal of representing their material and immaterial interests. | Local Economy & Development → Regional Development 296 Associations & Groups → Business Associations 1018 | policy 2149 region 5412 network 11123 event 45199 | Krimpenerwaard → Schoonhoven 544 |
| jagtstoffeerderij.nl | Van der Jagt Stoffeerderij | Van der Jagt Stoffeerderij is a upholstery workshop specializing in restoring and renewing interiors of cars, furniture, boats, campers, and caravans. | Upholstery & Fabrics → Upholsterers 165 Personal & Household → Household Services 1050 | upholstery 673 boat 2980 interior 8093 furniture 8751 car 10865 | Zuidplas → Moordrecht 332 |
| tandartsbergambacht.nl | Tandartspraktijk Bergambacht | The website of Tandartspraktijk Bergambacht provides information about the practice, treatments, team members, and contact details. | Dentistry → Implantology 304 | oral hygiene 256 prevention 1763 dentist 2514 treatment 21203 | |
| pbfk.nl | Praktijk Bekken Fysiotherapie Krimpenerwaard | The website of Praktijk Bekken Fysiotherapie Krimpenerwaard offers physiotherapy focused on pelvic problems, lower back pain, and pelvic floor dysfunction for both men and women. | Physiotherapy → Pelvic Physiotherapy 137 Health → Pregnancy & Childbirth 4222 | pelvic 26 pelvic floor 117 pain complaints 125 | Krimpenerwaard → Schoonhoven 544 |
| loodgieter-bergambacht.nl | Loodgieter Bergambacht | Loodgieter Bergambacht is a local plumber offering 24/7 service and various plumbing services in Bergambacht and surrounding areas. | Regional News → Province of North Brabant 63 Home Improvement → Plumbing 2733 | plumber 1210 rate 2606 warranty 4701 | |
| neetnetworks.nl | Neet Networks B.V. | Neet Networks is a company specializing in datanetworks, prioritizing customer needs and offering services like installation, consulting, design, and certification. | Networking → Network Installation 130 | data network 90 fiber optic 279 measurement 731 certification 3380 consulting 3639 design 27202 | |
| stigterinterieur.nl | Stigter Interieur | Stigter Interieur is a home interior specialist based in Schoonhoven offering advice and helping customers furnish their homes with flooring, window coverings, and furniture. | Bedroom → Bedroom Furniture 151 Interior → Window Coverings 1026 | closet 93 window coverings 1213 bed 1384 floor 4781 home 7976 interior 8093 | Krimpenerwaard → Schoonhoven 544 |
| buitenkans.nl | Buitenkans Aankoopmakelaars | Buitenkans Aankoopmakelaars is a property purchasing agency specializing in assisting clients with buying homes and land plots in rural areas. | Property Sales → Buying a House 872 Property Finance → Buying 254 | dream house 59 buyer 233 plot 1051 advisor 1055 property 7406 | Netherlands → Utrecht 48901 |
| krimpenerwaardintercultureel.nl | Krimpenerwaard Intercultureel | Krimpenerwaard Intercultureel (KIC) is an organization that helps asylum seekers integrate into the Krimpenerwaard community and feel at home. | Social Organization → Integration Organizations 37 Language Learning → Language Courses 769 | asylum seekers 96 community 7931 | Krimpenerwaard → Schoonhoven 544 |
| lekgoed.nl | Lekgoed BV | The website showcases real estate projects and services, with a focus on new construction and the renovation of existing properties. | Commercial Property → Commercial Space 489 Commercial Property → Industrial Space 18 | unit 405 real estate 4981 | Hoeksche Waard → 's-Gravendeel 200 |
| abcontainers.nl | AB Containers B.V. | AB Containers is a company that provides container rental, waste removal, and demolition services. | Building & Materials → Demolition Services 317 Waste Management → Container Rental 368 | roll container 45 demolition 1144 waste 1312 groundwork 1348 container 1709 | South-Holland → The Hague 19898 |
| rodenburgbeauty.nl | Rodenburg Beauty Schoonheidssalon Bergambacht | Rodenburg Beauty Schoonheidssalon Bergambacht is a multi-faceted beauty and wellness salon offering a wide range of products and services, including perfumes, cosmetics, pharmacy items, wellness treatments, and accessories. | Household & Cleaning → Household Goods 1642 Medical Care & Services → Cosmetic Medicine 1065 | perfume 534 cosmetics 648 wellness 1561 treatment 21203 | |
| vodavi.nl | Vodavi | The website of Vodavi is an online platform for a specialized installation company based in Bergambacht, focusing on providing installation services and products in the areas of security, telephony, audio, and WiFi networks. | Security Systems → Security Technology 399 Radio & Communication → Telecommunications 1361 | alarm 377 telephony 494 audio 934 wifi 1372 security 6655 network 11123 | |
| bakkerijblanken.nl | Bakkerij Blanken | Bakkerij Blanken is a family-run bakery located in Bergambacht, Stolwijk, and Lopik, selling a variety of breads and pastries, as well as lunch and catering for special occasions. | Bakery & Food Production → Bread 765 Supermarkets & Grocery → Food Stores 1058 | pastries 946 bread 1622 history 7286 | Krimpenerwaard → Stolwijk 232 |
| casteleijnbroodenbanket.nl | Casteleijn Brood en Banket | The website of Casteleijn Brood en Banket presents a bakery and tearoom in Bergambacht that offers artisan bread, pastries, and chocolates, as well as seasonal products, with a focus on tradition and family history. | Pastry → Cakes 826 Chocolate → Chocolatiers 96 | seasonal products 26 tea room 58 bakery 718 chocolate 911 pastries 946 bread 1622 | |
| hairandmorebergambacht.nl | HAIR & more Bergambacht | The website of HAIR & more Bergambacht showcases a hair salon and make-up artist offering personal styling, color services, and make-up services. | Makeup → Makeup Artists 733 | stylist 476 makeup 1477 salon 5541 appointment 13510 | |
| svfbergambacht.nl | SVF Bergambacht | The SVF Bergambacht website provides financial support and advice to individuals and diaconies, primarily focused on addressing financial problems and offering stability. | Financial Assistance → Debt Support 76 | debt 717 financial 855 administration 6587 education 13471 | South-Holland → Hardinxveld-Giessendam 534 |
| hospicekrimpenerwaard.nl | Stichting Hospice Krimpenerwaard | Hospice Krimpenerwaard is a foundation aiming to create a ‘near-home’ environment for people in the Krimpenerwaard who cannot spend their final days at home, providing loving and caring support. | Palliative & End-Of-Life Care → Hospice 123 | hospice 168 foundation 6678 construction 7421 house 8121 care 12338 | Krimpenerwaard → Krimpen aan de Lek 193 |
| vaneijkbergambacht.nl | J. Van Eijk Constructie | J. Van Eijk Constructie is a steel construction company that manufactures and installs various metal structures, fences, and accessories. | Garden → Fences 824 Construction → Building & Materials 19449 | gate 499 stair 815 metal 1090 steel 1177 fence 1814 repair 14576 | |
| blankenafbouw.nl | Blanken Afbouw | Blanken Afbouw is a company specializing in finishing and plastering work, focusing on renovation projects and new construction. | Construction Companies → Plasterers 843 Finishing & Trades → Interior Finishing 98 | finish 747 plaster 2175 new construction 2672 renovation 13849 | |
| 2date.nl | Commercive B.V. | The 2Date.nl website is a comparison site that enables users to compare dating websites in the Netherlands based on various criteria, including target audience, wishes, and locations. | Social Media → Dating 1644 Websites → Comparison Sites 869 | preference 66 | Maastricht → Maastricht-Southeast 113 |
| miniopslagkrimpenerwaard.nl | Miniopslag Krimpenerwaard | The website of Miniopslag Krimpenerwaard offers temporary storage space and storage boxes for rent, targeting both private and business customers in the Krimpenerwaard region. | Logistics → Storage 1170 | storage space 388 box 1982 storage 2446 space 3846 quote 12863 | Krimpenerwaard → Krimpen aan de Lek 193 |
| vanoosteromvanleeuwen.nl | Van Oosterom & Van Leeuwen Administratieve Dienstverlening | Van Oosterom & Van Leeuwen Administratieve Dienstverlening is an administrative office based in Bergambacht that provides financial administration, accounting, and tax filing services. | Accounting → Administrative Offices 96 Administrative Support → Business Operations 1156 | tax 2100 account 5781 administration 6587 | |
| opslagwaddinxveen.nl | Opslag Waddinxveen | Opslag Waddinxveen offers self-storage rental for individuals and businesses, emphasizing competitive prices and convenient access. | Logistics → Storage 1170 | unit 405 storage 2446 security 6655 rental 7257 | Alphen aan den Rijn → AWZI Alphen a/d Rijn 358 |
| damesmodeplus.nl | Elenora’s XL Fashion | Eleonora’s XL Fashion is a women’s clothing store in Bergambacht specializing in fashionable clothing and accessories for women in sizes 42 to 56 (often referred to as ‘plus size’ or ‘large sizes’). | Women’s Clothing → Plus Size 121 | plus size 29 store 3901 clothing 9443 accessories 12975 | |
| dejonginterieurbouw.nl | Jan de Jong Interieurbouw B.V. | Jan de Jong Interieurbouw is a company based in Bergambacht that designs and manufactures custom furniture and interiors. | Interior → Furniture 7454 Finishing & Trades → Interior Construction 502 | cabinet 1730 interior 8093 furniture 8751 design 27202 | Pijnacker-Nootdorp → Pijnacker 788 |
| mevrouwlingerie.nl | Mevrouw Lingerie | Mevrouw Lingerie is a lingerie boutique and online shop offering a wide range of lingerie, nightwear, swimwear, and undergarments for women and men. | Retailers → Specialty Stores 11 Underwear → Lingerie 471 | nightwear 160 lingerie 488 online shop 1310 store 3901 sale 5930 brand 17737 | |
| wovenwithlove.nl | Woven With Love | The website Woven With Love is a women's clothing boutique located in Bergambacht, offering exclusive clothing focused on quality, style, sustainability, and fair fashion. | Women’s Clothing → Boutique 139 Clothing → Second-Hand Clothing 74 | styling advice 96 women's clothing 108 boutique 133 webshop 8648 brand 17737 | |
| cafeensuite.nl | Cafe en Suite | Cafe en Suite is a combination of a lunchroom and a fashion store, located in Bergambacht, where visitors can have lunch, enjoy coffee and pastries, and simultaneously shop. | Cafes & Lunch → Lunch Spots 237 Economy → Retail & Commerce 9941 | lunchroom 312 staff 3405 coffee 3838 menu 13856 | |
| deknegtkaasennoten.nl | De Knegt Kaasspeciaalzaak | De Knegt Kaasspeciaalzaak is a shop in Bergambacht that sells nuts, fresh cheese, and wine. | Dairy → Cheese 530 Dairy & Cheese → Delicatessens 617 | dip 49 nuts 417 cheese 1205 wine 4476 assortment 7799 | |
| vandriel-nl.nl | Van Driel Transport | Van Driel Transport is a transportation company specializing in one-way container transport and offers logistics solutions for container transport across Europe. | Transportation Services → Container Transportation 181 Freight & Logistics → International Transportation 576 | chassis 72 europe 289 truck 1412 container 1709 transport 6105 | South-Holland → Rotterdam 25048 |
| verstopping-gouda.nl | Rioleringsbedrijf Gouda | The website of Rioleringsbedrijf Gouda offers rioolservice (drainage services), unclogging services, and other pipe repair services in Gouda and surrounding areas. | Water Management → Sewers 25 Personal & Household → Service Industry 376 | unclogging 244 sewer 246 drainage 1322 region 5412 | Oudewater → Papekop 27 |
| blomzonweringen.nl | Blom Zonweringen | Blom Zonwering is a specialized sun shading company providing custom shading solutions and installation services. | Interior → Window Coverings 1026 Household & Cleaning → Home Services 1321 | sunshade 356 showroom 4883 installation 13742 | Krimpenerwaard → Schoonhoven 544 |
| mtsolutions.nl | MT Solutions | MT Solutions provides custom interior solutions, including lighting plans, floors, window coverings, and steel doors. | Agriculture → Agricultural Technology & Innovation 743 Technology → Smart Home & Automation 1146 | steel door 85 lighting plan 200 led lighting 332 window coverings 1213 floor 4781 | Overbetuwe → Heteren 236 |
| totalbootcamp.nl | Total Bootcamp | The website of Total Bootcamp presents and promotes the organization of bootcamp classes in the Schoonhoven region and surrounding areas, aimed at improving participants' fitness, strength, and endurance. | Group Class → Bootcamp 208 | bootcamp 497 exercise 706 participant 1934 class 2076 | Krimpenerwaard → Krimpen aan de Lek 193 |
| loonbedrijfdenboer.nl | Loonbedrijf den Boer | Loonbedrijf den Boer is a construction company specializing in groundwork, demolition, pile driving, paving, and drainage services. | Land Development & Earthworks → Site Preparation 23 Building & Materials → Demolition 687 | pile driving 15 demolition 1144 groundwork 1348 paving 1942 equipment 4143 | Altena → Werkendam 399 |
| ardkorevaar.nl | Ard Korevaar personenschade | The website of Ard Korevaar personenschade and letselschade is an online platform providing expert advice and guidance on personal injury claims to clients in various regions. It aims to provide customer satisfaction and a personalized approach. | Criminal Law → Personal Injury 771 | dossier 248 personal injury 428 legal assistance 537 charity 700 claim 702 | Alphen aan den Rijn → Boskoop 652 |
| autorijschooldunnewold.nl | Autorijschool Dunnewold | The website of Autorijschool Dunnewold from Stolwijk offers information and services for obtaining a driving license B, including driving lessons, driver training courses, theory exam materials, and an online shop. | Driving & Vehicle → Vehicle Training 553 | driver training 20 ris method 21 theory exam 97 driving license 402 online shop 1310 driving lessons 2453 | Krimpenerwaard → Berkenwoude 62 |
| a-vastgoedzorg.nl | A-vastgoed Zorg | A-vastgoed Zorg is a company specializing in the management of real estate specifically geared towards residential care facilities. | Palliative & End-Of-Life Care → Elderly Care 1061 Physiotherapy → Geriatric Physiotherapy 30 | elderly care 128 seniors 904 housing 4378 real estate 4981 | Bodegraven-Reeuwijk → Waarder 68 |
| hoogerbrug-groep.nl | Hoogerbrug Bouwbedrijf | The website of Hoogerbrug Bouwbedrijf describes the company as a builder of relationships that works with clients on real estate projects, with the client's wishes at the center and an accommodating approach followed. | Construction Companies → Residential Construction 1013 | construction company 824 relationship 4205 real estate 4981 sustainability 18451 | |
| schoonheidssalonexclusief.nl | Exclusief Skinstore & Salon | Exclusief Skinstore & Salon is a beauty salon in Bergambacht specializing in personalized skincare and treatments. | Science → Medical Sciences 97 Medical Care & Services → Cosmetic Medicine 1065 | scan 790 skin 2518 plan 2566 salon 5541 treatment 21203 | |
| infra-techniek.nl | Infra-Techniek B.V. | Infra Techniek is a pavement and concrete milling company that offers support for the maintenance of infrastructure and provides pavement processing sets and cleaning services. | Civil & Infrastructure → & Waterways 96 Civil & Infrastructure → Road Construction 481 | infrastructure 1460 equipment 4143 | |
| houtvisiebv.nl | Houtvisie B.V. | Houtvisie is a specialist in sustainable woodworking, providing wood import, processing, construction, and execution for various projects. | Garden → Decking 44 Wood & Timber → Wood 1035 | processing 334 sustainable 739 wood 4153 construction 7421 | |
| kruiswijkcontainer.nl | Kruiswijk Groep BV | The Kruiswijk Container website in Bergambacht offers the possibility to quickly and easily rent containers for various types of waste, with a focus on good service and competitive prices. | Waste Management → Waste Processing 96 Waste Management → Container Rental 368 | rent 981 waste 1312 container 1709 price 8328 | |
| osmosepunt.nl | ANDERS | OsmosePunt in Bergambacht offers a service for tapping osmose water for spotless cleaning of windows and other surfaces. | Maintenance & Services → Glass Maintenance 371 | osmose water 13 payment 1389 water 2501 app 4595 | |
| vignoble.nl | Huidverzorgingsinstituut Vignoble | Huidverzorgingsinstituut Vignoble offers personalized and natural skincare treatments and massages. | Cosmetics → Natural Cosmetics 254 | skin type 229 natural 235 skincare 1972 relaxation 3968 massage 7646 treatment 21203 | Krimpenerwaard → Schoonhoven 544 |
| stefanderuitervof.nl | Hoveniersbedrijf Stefan de Ruiter VOF | Hoveniersbedrijf Stefan de Ruiter VOF offers garden design, landscaping, maintenance, and renovation services in the Netherlands, with a focus on creating a pleasant and attractive garden for the client. | Garden Maintenance → Gardeners 685 Agriculture → Horticulture & Floristry 1404 | landscaping 1529 paving 1942 plant 4509 garden 13129 maintenance 20093 design 27202 | Krimpenerwaard → Schoonhoven 544 |
| kcdeschakel.nl | Kerkelijk Centrum ‘De Schakel” | Kerkelijk Centrum ‘De Schakel’ is an event location in Bergambacht, Krimpenerwaard, offering rental of halls for various occasions, from business meetings to family gatherings and events. | Venues → Halls 419 Culture → Religion 8327 | hall 1786 catering 6456 event 45199 | |
| galajurken-in.nl | Galajurk Winkel | The website presents a gala dress shop and offers information about the location, opening hours, and customer base. | Fashion → Evening Wear 16 Context 161394 | gala dresses 17 accessories 12975 | Pijnacker-Nootdorp → Pijnacker 788 |
| denederlandsezoutbank.nl | The Nederlandse Zoutbank | The Nederlandse Zoutbank is a specialist in the procurement, transport, storage, and delivery of salt, aiming to ensure the safety and continuity of salt supplies. | Logistics → Storage 1170 Construction → Civil & Infrastructure 3453 | salt 150 packaging 2236 storage 2446 network 11123 | Beekdaelen → Nuth 223 |
| uitlaatservicekrimpenerwaard.nl | Hondenuitlaatservice Krimpenerwaard | Hondenuitlaatservice Krimpenerwaard offers a dog walking and dog snack service in the Gouda, Krimpenerwaard, and Krimpen a/d IJssel region. | Dog Care → Dog Walking Service 356 Family → Pet Services 54 | field 527 game 2807 snack 2916 dog 5483 | Krimpenerwaard → Krimpen aan de Lek 193 |
| geleijntransport.nl | Geleijn Transport | Geleijn Transport is a transportation company with a long history specializing in the transport of various goods, including shipping containers and loose bulk products. | Transportation Services → Refrigerated Transport 226 | container 1709 driver 1832 route 3425 relationship 4205 transport 6105 | Amsterdam → West 777 |
| nieuwveldschilders.nl | Nieuwveld Schilders | Nieuwveld Schilders is a painting company based in Bergambacht offering painting, wall finishing, and glazing services to individuals, businesses, and government organizations. | Insulation → Glazing 188 Maintenance & Repair → Facility Services 671 | glazing 482 painter 740 paint 8747 quote 12863 | |
| gospelkoorelim.nl | Gospelkoor Elim | The website of Gospelkoor Elim provides information about the gospel choir, including the agenda, members, contact details, and a registration form. | Choir → Gospel Choir 150 Social Organization → Religious Organizations 1069 | choir 3123 agenda 4374 concert 4409 member 10154 music 13170 | Ede → Ederveen 195 |
| josgym.nl | JOSGYM | The JOSGYM website offers personal training and nutrition advice in Bergambacht and surrounding areas, aiming to help individuals get fit and enjoy sports. | Personal Development → Motivation 434 | fun 241 motivation 894 nutrition 4935 goal 4974 training 28133 | |
| werkenbijcasteleijn.nl | Casteleijn Stroopwafels B.V. | The website presents job vacancies and provides information about the company and its culture. | Bakery & Food Production → Bread 765 Pastry → Waffles 17 | corporate culture 29 stroopwafel 76 employee 4429 vacancy 6598 | |
| bcbluesky.nl | Badminton Club Blue Sky Bergambacht | The website of Badminton Club Blue Sky Bergambacht provides information about the association, its activities, members and events, and offers opportunities to become a member or visit the club. | Combat → Badminton 702 | badminton 453 youth 3126 match 3471 membership 10442 | |
| slobsite.nl | Bouwkundig Tekenburo Slob | The website is a bureau offering architectural drafting and consulting services, primarily for private and business clients. | Architecture → Architectural Services 1006 Architecture & Design → Building Consulting 314 | architectural 20 drafting 308 drawings 1329 application 3377 consulting 3639 | Buren → Maurik 162 |
| tillytollenaar.nl | Pianodocent | The website of Pianodocent, owned by Tilly Tollenaar, offers piano lessons located in Bergambacht, initially established in 1981. It is a platform where individuals, particularly children, can learn to play the piano. | Instrument → Piano 572 Music Education → Piano Lessons 317 | classical 16 music school 115 conservatory 237 piano 820 lesson 5154 | South-Holland → Gouda 3521 |
| logopedieschoonhoven.nl | Logopediepraktijk Schoonhoven and Bergambacht | The website of Logopediepraktijk Schoonhoven and Bergambacht provides information about speech therapy, the offered treatments, and contact details for clients with problems related to voice, speech, language, hearing, and swallowing. | Childcare → Language Development 574 Mental & Emotional Well-Being → Speech Disorders 81 | swallowing 129 speech 532 speech therapy 540 voice 1090 language 2016 treatment 21203 | Krimpenerwaard → Schoonhoven 544 |
| stichtingtanmar.nl | Stichting TanMar Pedagogische Dienstverlening | Stichting TanMar offers pedagogical services, including a livable environment, respite care, and outpatient support, aimed at young people and adults with various challenges. | Social Services → Youth Work 353 Youth Development → Youth 1033 | living group 15 future 404 situation 655 youth 3126 care 12338 | |
| blaubemiddeling.nl | BLAU Bemiddeling | BLAU Bemiddeling is a platform that connects public sector professionals with organizations seeking assignments. | Jobs → Vacancies 1099 Government & Administration → Public Sector 319 | duration 46 post 140 advisor 1055 assignment 1121 region 5412 | Barneveld → Kootwijkerbroek 256 |
| jacobskerstbomen.nl | B. Jacobs Kerstbomen | The website of B. Jacobs Kerstbomen offers a selection of Christmas trees and provides information on types, maintenance, and contact details. | Christmas → Christmas Trees 162 | lights 155 christmas tree 322 tree 1879 maintenance 20093 | |
| loodgieterlekkerkerk.nl | Loodgieter Lekkerkerk | The website Loodgieterlekkerkerk.nl provides emergency service and free quotes for plumbing work, drain cleaning, leak repairs, and roof maintenance in and around Lekkerkerk, aiming to offer a reliable and skilled solution for all plumbing problems. | Home Improvement → Plumbing 2733 | blockage 965 leak 1204 plumber 1210 roof 3662 quote 12863 | Molenlanden → Nieuw-Lekkerland 188 |
| loodgieterbergambacht.nl | Loodgieter Bergambacht | The website Loodgieterbergambacht.nl provides emergency plumbing services, blockage removal and roof maintenance in Bergambacht and surrounding municipalities, emphasizing reliability, transparency, and quick response times. | Plumbing → Drain Cleaning 745 Maintenance & Repair → Plumbers 879 | blockage 965 leak 1204 plumber 1210 rate 2606 roof 3662 | Molenlanden → Groot-Ammers 158 |
| loodgieterammerstol.nl | Loodgieter Ammerstol | The website Loodgieter Ammerstol provides emergency service and free quotes for plumbing, drain cleaning, and roofing maintenance in and around Ammerstol. The goal is to be a reliable and fast plumber for the local population. | Repair → Plumbing Repair 47 Installation & Repair → Water Installation 81 | blockage 965 leak 1204 plumber 1210 roofing 2806 quote 12863 | Molenlanden → Ottoland 41 |
| afvalcontainers-randstad.nl | Steehouwer Hoveniers | The website Afvalcontainers-Randstad.nl provides specialized waste removal services for soil, green waste, clean rubble, and other waste streams in the Randstad region, with a focus on environmentally friendly processing and customized solutions. | Logistics → Transportation 1102 Environment → Waste Management 2680 | green waste 22 removal 267 soil 930 waste 1312 container 1709 | Lansingerland → Bergschenhoek 568 |
| daansontbijtservice.nl | Daans Catering | Daans Catering is an breakfast service that delivers fresh breakfasts, lunch buffets and snacks to private individuals and businesses in various regions, including Gouda, Alphen aan den Rijn and Nieuwerkerk aan den IJssel. | Accommodation → Breakfast 364 Catering → Buffets 277 | buffet 1747 breakfast 1822 snack 2916 catering 6456 | Lansingerland → Bleiswijk 579 |
| hogendoornadvies.nl | Hogendoorn Advies | Hogendoorn Advies is a consultancy firm offering construction and sustainability advice for both residential and commercial projects. | Legal → Construction Law 150 Legal & Permits → Construction Advice 289 | construction advice 188 stable 768 housing 4378 sustainability 18451 | |
| trenddoor.nl | Trenddoor B.V. | Trenddoor is a specialist in access technology, providing delivery, installation, repair, and maintenance services for various doors, gates, and access control systems for businesses and private individuals. | Doors → Garage Doors 248 Security → Access Control 253 | access control 350 garage door 365 door 2210 repair 14576 maintenance 20093 | Almere → Almere City 934 |
| zeepdispensershop.nl | Zeepdispensershop | The website Zeepdispensershop is an online store that sells a wide assortment of soap dispensers, parts, and mounting materials. | Advertising → Lettering 569 Household & Cleaning → Household Goods 1642 | soap dispenser 10 mounting 448 part 5044 | |
| besttaxi.nl | E.E Best Taxi Service | The website of E.E Best Taxi Service provides taxi and transportation services, including taxi to Schiphol, business transportation, airport service, and transport to other airports. | Logistics & Transportation → Travel Arrangements 133 | airport 789 taxi 2090 transportation 2851 reservation 3373 price 8328 quote 12863 | Eindhoven → Strijp 527 |
| bloemistservice.nl | Bloemenbezorging.nl | The website offers a service to deliver flowers, bouquets, and flower arrangements in the Netherlands. | Delivery → Flower Delivery 210 Gifts & Occasions → Flower Shops 776 | florist 57 roses 214 bouquet 1147 flowers 3248 shop 6483 | Vijfheerenlanden → Ameide 97 |
| bnbthebarnhouse.nl | Banning Family | The Barnhouse website presents a charming cottage located in Bergambacht, a renovated cow stable converted into a comfortable accommodation for two people. | Hotels → Country Houses 172 Accommodation → Cottages 298 | meadow 75 cottage 299 farmhouse 878 internet 1678 bedroom 2051 terrace 4847 | South-Holland → The Hague 19898 |
| boekenwinkel-gids.nl | Bookshop Guide | The website Bookshop Guide provides an overview of bookstores in various provinces of the Netherlands. | Directories → Websites 3473 Context 161394 | town 126 bookstore 149 directory 176 province 518 | Zwartewaterland → Genemuiden 405 |
| boetiekvintique.nl | Boetiek Vintique | Boetiek Vintique is a vintage shop that sells secondhand women's clothing, shoes, and accessories with a focus on sustainability and style. | Context 161394 | coffee 3838 atmosphere 5591 clothing 9443 accessories 12975 brand 17737 sustainability 18451 | |
| bouwburovink.nl | Bouwburo Vink | Bouwburo Vink is an independent construction advice agency based in Gouda that supports various building projects, from new construction to renovation. | Project Management → Construction Supervision 364 | construction supervision 187 construction advice 188 quote 12863 renovation 13849 | The Hague → Scheveningen 1625 |
| dhadvocatuur.nl | De Haas Advocatuur & Mediation | De Haas Advocatuur & Mediation is a law firm specializing in personal and family law. | Family → Alimony 70 Law → Family Law 1413 | situation 655 court 999 lawyer 2683 mediation 2787 family 6462 | |
| dokterelectro.nl | Dokter Electro | Dokter Electro is an electrician offering emergency electrical work, installations, repairs, and maintenance. | Lighting & Electrical → Utilities 388 | panel 868 electrical 1414 home 7976 installation 13742 repair 14576 maintenance 20093 | Lelystad → City Center 15 |
| dutchteamsecurity.nl | Dutch Team Security | The website of Dutch Team Security offers security services including surveillance, object security, and event security. | Security & Surveillance → Security 3251 Industry → Industrial 1987 | surveillance 192 risk 2896 security 6655 event 45199 | Nissewaard → Simonshaven 46 |
| eenhandjenodig.nl | DigiWaard | Handje Nodig provides computer assistance, maintenance, and security services to individuals and businesses in the Krimpenerwaard and Gouda region. | Computer Hardware & Peripherals → Computer Stores 281 | internet 1678 computer 1969 data 5872 security 6655 software 8291 | Krimpenerwaard → Krimpen aan de Lek 193 |
| fiscalistkaart.nl | Fiscalistkaart BV | The website Fiscalistkaart provides an overview of Dutch fiscalists and facilitates finding a suitable fiscalist. | Websites → Professional Websites 17 Software → Online Services & Platforms 735 | fiscalist 10 compare 582 search 1027 quote 12863 | Goeree-Overflakkee → Middelharnis 340 |
| floreathoveniers.nl | Floreat Hoveniers | Floreat Hoveniers is a landscaping company in Schoonhoven that offers garden design, landscaping, maintenance, and renovation services. | Outdoor & Garden → Landscape Companies 339 | plan 2566 showroom 4883 communication 10162 quote 12863 garden 13129 | Krimpenerwaard → Schoonhoven 544 |
| gjvn.nl | Graaf Jan van Nassauschool | The website of the Graaf Jan van Nassauschool in Gouda presents the school, its vision, team, programs, and important information for parents and students. | Elementary Schools → Christian Primary Schools 342 Education & Youth → Local Institutions 106 | bible 1276 student 7623 school 7856 education 13471 | Krimpenerwaard → Gouderak 103 |
| gouda-glaszetter.nl | Glaspunt B.V. | Glaspunt B.V. is a glass fitter company based in Gouda that provides 24-hour glass repair and glass installation services. | Insulation → Glazing 188 Exterior Works → Glass Fitting 112 | glass fitter 32 glass damage 135 window 2030 glass 2919 quote 12863 | Oudewater → Papekop 27 |
| goudmakelaardij.nl | GOUD Makelaardij | GOUD Makelaardij is a real estate agency offering homes for sale and rent in Midden-Brabant. | Property Agents & Brokers → Regional Agents 352 | plot 1051 agent 1253 result 1902 bedroom 2051 property 7406 | Altena → Hank 113 |
| grillroompizzeriaamon-bergambacht.nl | Eetcafé Amon Bergambacht | Eetcafé Amon Bergambacht is an online restaurant where customers can view the menu and place online orders. | Fast Food → Fries 949 Quick Bites → Snack Bar 580 | salad 2444 fries 2753 drink 5191 dish 5936 order 6912 menu 13856 | |
| groothandel-nederland.nl | groothandel-nederland.nl | This website provides information about wholesalers, including their function and activities. | Commerce → Wholesale 1855 | enterprise 101 wholesaler 225 flow 263 goods 666 supplier 1725 | Achtkarspelen → Harkema 113 |
| haagsmatrading.nl | Haagsma Trading Company | Haagsma Trading Company is a company specializing in the supply of heavy-duty wheels and wheels for various industrial applications. | Tools & Equipment → Industrial Tools 244 Bicycles & Wheels → Wheels 19 | wheel 746 | |
| hippischwonen.nl | Hippisch Vastgoed | This website provides an overview of equestrian properties in the Netherlands and Belgium. | Property Finance → Buying 254 Office & Workspace → Business Directories 421 | objects 426 province 518 listings 525 real estate 4981 property 7406 price 8328 | Land van Cuijk → Oeffelt 96 |
| hovenierverkade.nl | Hovenier Verkade | Hovenier Verkade is a landscaping company that offers garden design, maintenance, and renovation services. | Garden Maintenance → Garden Improvement 33 | quote 12863 garden 13129 renovation 13849 maintenance 20093 | Zuidplas → Nieuwerkerk aan den IJssel 557 |
| jobofo.nl | Johann Borst | The website of Johann Borst showcases a portfolio of photography focusing on nature and animals, with a particular emphasis on birds and raptors. | Nature & Landscape → Nature Photography 482 Animals → Birds 470 | bird 922 album 1495 animal 2908 nature 9094 photography 9503 | Krimpenerwaard → Schoonhoven 544 |
| kostentuinman.nl | Kosten Tuinman | The website ‘Kosten Tuinman’ provides an overview of gardening services in various regions of the Netherlands. | Office & Workspace → Business Directories 421 | gardener 299 | Emmen → Nieuw-Amsterdam 149 |
| kruidenboterkruiden.nl | kruidenboterkruiden.nl | The website describes the history, ingredients, and sales channels of a unique herb butter mix, originally started in a café and now sold in supermarkets and online. | Local & Regional Focus → Local Businesses 1077 Sandwiches & Salads → Appetizers 40 | packaging 2236 store 3901 vacation 4234 recipe 5142 | |
| mariellebutter.nl | Paard & Coach Marielle Butter | Paard & Coach Marielle Butter offers guidance and coaching through the use of horses. | Coaching → Horse Coaching 339 Outdoor → Horse Riding 941 | insight 628 session 1791 growth 4054 horse 4337 coach 25810 | Krimpenerwaard → Schoonhoven 544 |
| michaelashair.nl | Michaela’s Hair@Home | The website of Michaela’s Hair@Home is a personal hair salon offering services to residents of Bergambacht, Schoonhoven, and Lekkerkerk, with a focus on a relaxed atmosphere and professional results. | Hair Education → Hair Products 612 | hair coloring 114 hair products 301 cut 926 hairdresser 1372 | Krimpenerwaard → Schoonhoven 544 |
| oosterhoef30.nl | Kleurrijk NVM Makelaars & Taxateurs | The website of Kleurrijk NVM Makelaars & Taxateurs presents a property for sale in Bergambacht, providing detailed information about the location, features, layout, and amenities. | Houses → Semi-Detached Houses 751 Houses → Townhouses 632 | living area 349 agent 1253 property 7406 garden 13129 | South-Holland → Rotterdam 25048 |
| renssenklusbedrijf.nl | Renssen Klusbedrijf | Renssen Klusbedrijf is a handyman service that provides a wide range of services in the Bergambacht and surrounding area. | Maintenance & Repair → Skilled Trades 220 Household & Cleaning → Home Services 1321 | handyman 836 carpentry 2218 paint 8747 renovation 13849 maintenance 20093 | Krimpenerwaard → Schoonhoven 544 |
| rijschoolboutique.nl | Rijschool Boutique | Rijschool Boutique is a driving school that offers lessons for various driving license categories and specializes in driving, motorcycle and scooter lessons. | Traffic Management → Traffic 589 | driving skills 16 driving license 402 driving lessons 2453 instructor 3126 | Krimpenerwaard → Schoonhoven 544 |
| rijschoolmara.nl | Rijschool Mara | Rijschool Mara’s website offers driving lessons in various areas and focuses on personalized attention and a positive learning experience. | Driver & Vehicle → Driver’s License 1625 | practice book 21 ris 41 driver’s license 438 driving lessons 2453 instructor 3126 | Krimpenerwaard → Schoonhoven 544 |
| rijschoolmaraya.nl | Rijschool Maraya | Rijschool Maraya in Gouda offers driving lessons in the region and surrounding areas, with various packages and options. | Driver & Vehicle → Driver’s License 1625 | driving license 402 exam 2120 driving lessons 2453 instructor 3126 package 6112 | Alphen aan den Rijn → Boskoop 652 |
| siloservice.nl | Silo Service de Langen | Silo Service De Langen is a company that offers service and repair of silos and polyester products. | Plastics → Manufacturing 7708 Agriculture → Agricultural Technology & Innovation 743 | silo 96 polyester 101 pipe 695 repair 14576 maintenance 20093 | |
| stellingbeveiliging.nl | Stelling Beveiliging & Telecommunicatie | The website Stelling Beveiliging offers security solutions and advice for homes, shops, and offices. | Security → Security Systems 971 | alarm 377 plan 2566 risk 2896 shop 6483 security 6655 home 7976 | |
| tcbergambacht.nl | Tennisclub Bergambacht | The website of Tennisclub Bergambacht provides information about membership, activities, competitions, court availability, and events, focusing on tennis in Bergambacht. | Sport Facility → Tennis 2078 | tennis 836 court 999 competition 4759 lesson 5154 membership 10442 event 45199 | |
| trouwborstbv.nl | Trouwborst Konstrukties BV | Trouwborst Konstrukties BV is a specialist in the production and supply of lead balcony feeders and rainwater drainage systems. | Metalworking → Stainless Steel Fabrication 161 Garden → Fencing 307 | bracket 57 | |
| vanwurmond.nl | Van Wurmond Administratiekantoor | Van Wurmond Administratiekantoor offers bookkeeping, administrative, tax advisory, and payroll administration services to SMEs and self-employed entrepreneurs. | Company & Business → Individuals 827 | payroll administration 979 bookkeeping 1319 tax advice 1522 administration 6587 | South-Holland → Capelle aan den IJssel 1616 |
| vuurwerkbergambacht.nl | Van Eijk Vuurwerk | The website of Van Eijk Vuurwerk presents a fireworks shop with both a physical store and a webshop, and offers the possibility to purchase or order fireworks. | Party Supplies → Fireworks 258 | identification 76 fireworks 413 store 3901 webshop 8648 | |
| zz-people.nl | ZZ People B.V. | ZZPeople is a service provider specializing in placing production and logistics personnel, agricultural and green personnel, groundwork specialists, and cleaners, primarily for construction and industrial business owners. | Land Development & Earthworks → Earthmoving 643 | business owner 60 personnel 1084 assignment 1121 communication 10162 network 11123 | |
| iphonereparatiekrimpenerwaard.nl | iPhone Reparatie Krimpenerwaard | The website provides iPhone and tablet repair services in the Krimpenerwaard region. | Computer → Computer Repair 898 Repair → Mobile Phone Repair 1012 | ipad 404 iphone 662 device 698 screen 1438 battery 1751 repair 14576 | Krimpenerwaard → Krimpen aan de Lek 193 |
| stichtevents.nl | Sticht Events | Sticht Events is a catering company that provides mobile fry trucks for various occasions, including parties and larger events. | Catering → Mobile Catering 87 | fry truck 38 guest 1334 drink 5191 package 6112 event 45199 | |
| smartphonereparatiekrimpenerwaard.nl | Smartphone Repair Krimpenerwaard | The website Smartphone Repair Krimpenerwaard offers professional repair services for smartphones and tablets, with locations in Krimpenerwaard and surrounding areas. The goal is to be a reliable and specialist provider for smartphone and tablet repairs in the region. | Electronics & Components → Mobile Phones 1186 Electronics & Components → Tablets 191 | technician 815 tablet 998 smartphone 1344 appointment 13510 repair 14576 brand 17737 | Krimpenerwaard → Lekkerkerk 244 |
| ceritransport.nl | Ceri Transport | Ceri Transport in Bergambacht is a transportation company specializing in the transport of hazardous materials and related services. | Specialized Transport → Tank Transport 30 | tank container 17 hazardous materials 22 germany 185 certification 3380 transport 6105 | |
| snackbar-denuyl.nl | Snackbar Den Uyl | The website of Snackbar Den Uyl Bergambacht provides the opportunity to order food online for takeaway or delivery, including a menu and customer reviews. | Fast Food → Fries 949 | fries 2753 snack 2916 reviews 3172 sandwich 4098 menu 13856 | |
| zwanenpartners.nl | Van der Zwan and partners | Van der Zwan and Partners is a tax and administrative advisory firm serving the Schoonhoven region. | Taxation → VAT 266 Accounting → Bookkeeping 1230 | filings 32 financial statement 321 tax advice 1522 administration 6587 | Krimpenerwaard → Schoonhoven 544 |
| adriaanmeerkerk.nl | Meerkerk Melkvee Zorg en Loonbedrijf | Meerkerk Melkvee Zorg en Loonbedrijf is a family business that combines dairy farming, agricultural services, and a care farm. | Livestock → Dairy Farming 671 Community → Social Issues & Welfare 28159 | agricultural services 38 dairy farm 129 day activities 137 earthmoving 233 care farm 246 cow 596 | |
| jhdistributie.nl | JH Distributie | JH Distributie is a distribution company that provides local newspaper distribution services in the Krimpenerwaard region. | Marketing → Direct Mail & Distribution 286 Local News → Municipal News 153 | printed materials 17 district 371 newspaper 396 | Bodegraven-Reeuwijk → Reeuwijk 531 |
| ansichtopnederland.nl | ansichtopnederland.nl | The website provides an overview of places in the Netherlands. | Context 161394 | place 242 province 518 region 5412 | Hollands Kroon → Barsingerhorn 40 |
| kwog.nl | Kruiswijk Woudenberg Verhuur | The website of Kruiswijk Woudenberg Verhuur presents a rental offer for residential and commercial spaces in various locations, including Schoonhoven, Bergambacht and Gouda, and provides information on project development and investment in real estate. | Rental Properties → Student Housing 182 Commercial Property → Commercial Space 489 | business hall 23 student housing 34 garage box 138 commercial space 245 apartment 5088 | Krimpenerwaard → Schoonhoven 544 |
| alleschoenenwinkels.nl | AlleSchoenenwinkels.nl | The website AlleSchoenenwinkels.nl provides an overview of all shoe stores in the Netherlands, including their opening hours, addresses and contact details. | Clothing & Accessories → Shoe Stores 441 | search function 273 map 801 address 901 shoes 2699 opening hours 2953 | South-Holland → Rotterdam 25048 |
| stal-lammerts.nl | Stal Lammerts | Stal Lammerts is a horse breeding and sales company specializing in jumping horses. | Animal Husbandry → Horse Farms 174 Apparel → Equestrian 2319 | jump 92 breed 1744 horse 4337 video 6714 | |
| remij.nl | Remij b.v. | Remij is a company specializing in the reuse of waste materials and the creation of new valuable materials within a circular economy. | Sustainable Construction → Circular Construction 80 Building & Materials → Demolition 687 | waste material 34 reuse 100 demolition 1144 | |
| blauwlichten.nl | blauwlichten.nl | This website presents a list of fire departments (Brandweerkorpsen) in the Netherlands. | Emergency Services → Fire Department 138 | netherlands 1376 | Hof van Twente → Diepenheim 200 |
| peethoogendoornkaas.nl | Peet Hoogendoorn Kaas | The Peet Hoogendoorn Kaas website showcases a family-run cheese business with over 150 years of history. The website offers a variety of cheeses, including renowned brands and regional cheeses, through various channels such as markets, a country store, and online ordering. | Dairy → Cheese 530 | cheese 1205 market 2772 production 4582 | Hoeksche Waard → Strijen 236 |
| joyworshipband.nl | Joy! | The website of Joy! presents this musical band that, driven by a passion for God and music, performs at various occasions, including church services, events, and weddings. | Church & Religious → Gospel Music 31 Religious & Spiritual → Religious Events 131 | crowdfunding 246 band 2977 church 3439 performance 7586 music 13170 event 45199 | Krimpenerwaard → Schoonhoven 544 |
| mourikassurantien.nl | Mourik Assurantiën, Administraties, Adviezen & Belastingen | Mourik Assurantiën, Administraties, Adviezen & Belastingen is a firm that offers a range of financial services to individuals and businesses. | Governance → Law 14133 Financial Services → Entrepreneur Advice 62 | taxes 500 bookkeeping 1319 insurance 6359 administration 6587 | |
| bo-bestrating.nl | Bo’s Bestrating | Bo’s Bestrating is a company offering paving and garden design services in the province of South Holland. | Garden Maintenance → Gardeners 685 Garden → Paving 1003 | streetwork 112 fence 1814 paving 1942 | |
| opslagbijdeboer.nl | Opslagbijdeboer.nl | Opslagbijdeboer.nl offers affordable storage space in and around Bergambacht, with flexible rental terms and a personal approach. | Logistics → Storage 1170 | flexibility 996 storage 2446 rental 7257 | Krimpenerwaard → Schoonhoven 544 |
| e-chopperkrimpenerwaard.nl | E-chopper rental Krimpenerwaard | The website, E-chopper rental Krimpenerwaard, offers the opportunity to rent e-scooters and fatbikes in the Krimpenerwaard, with a focus on green and relaxing tours. | Electric Vehicles → Electric Scooters 108 Tourism → Regional Tourism 242 | e-scooter 53 scooter 1236 reservation 3373 route 3425 | |
| holistic-harmony.nl | Holistic Harmony | The website of Holistic Harmony is a naturopathic therapy practice located in Bergambacht, Krimpenerwaard, offering holistic treatments. | Alternative Medicine → Naturopathy 1097 | haptonomy 121 drainage 1322 energy 9075 | |
| rttransport.nl | R&T Transport B.V. | The website of R&T Transport describes a family-owned transport company offering services throughout Europe, with a focus on flexibility and supporting various clients. | Construction Machinery → Crane Rental 135 | transport service 18 fleet 1351 truck 1412 trailer 1624 transport 6105 | |
| schijfdata.nl | SchijfData.nl | The website SchijfData.nl offers data recovery, computer upgrade, and data destruction services, primarily in the region of Gouda and Bodegraven-Reeuwijk. | IT → Data Recovery 19 | data destruction 43 data recovery 84 drive 428 backup 494 | Zuidplas → Moerkapelle 213 |
| verkuilkaas.nl | Verkuil Kaashandel V.O.F. | The website of Verkuil Cheese Shop presents weekly offers of cheese, nuts, and other treats, and provides information about the locations where the cheese shop can be found. | Dairy → Cheese 530 Produce & Vegetables → Vegetables 1070 | vacuum 95 nuts 417 cheese 1205 market 2772 | Krimpenerwaard → Krimpen aan de Lek 193 |
| mgraveland.nl | M. Graveland Bouw | M. Graveland Bouw is a construction company specializing in new construction, renovation, insulation, and carpentry work, with a focus on concrete construction and monolithic floors. | Building & Materials → Concrete 390 Insulation & Glazing → Insulation 1543 | concrete construction 24 carpentry 2218 insulation 2448 new construction 2672 renovation 13849 | |
| uitvaartbergambacht.nl | Uitvaart Bergambacht | Uitvaart Bergambacht is an end-of-life care provider in Bergambacht that arranges and cares for complete funerals. | Funeral Services → Funeral Arrangement 486 | undertaker 28 burial 406 cremation 615 farewell 1109 funeral 2477 | |
| huismanbouwentimmerwerken.nl | Huisman Bouw- en Timmerwerken | Huisman Bouw- en Timmerwerken is a construction and carpentry company based in Lekkerkerk, Netherlands, that offers renovation and building services in the surrounding area. | Building & Materials → Carpentry & Joinery 830 | carpentry 2218 renovation 13849 | Krimpenerwaard → Krimpen aan de Lek 193 |
| paso-geluidsinstallaties.nl | Vodavi bv | Paso Geluids- & Omroepinstallaties offers installation and supply of audio and broadcast equipment, as well as emergency evacuation systems, with a focus on quality and good value for money. | Technology → Audiovisual & Media 688 Technology → Smart Home & Automation 1146 | evacuation system 11 audio system 40 | |
| vanderzwaal.nl | Van der Zwaal B.V. | The website of Vanderzwaal.nl offers educational pathways and support to educational institutions, focused on improving processes, preventing early school leaving, and addressing teacher shortages. | Special Needs & Support → Support Education 234 Research & Academia → Educational Development 354 | career orientation 14 project leadership 85 process guidance 86 pathway 447 collaboration 16036 | Katwijk → Katwijk aan Zee 616 |
| hoveniersbedrijfweltevree.nl | Hoveniersbedrijf Weltevree | Hoveniersbedrijf Weltevree is a landscaping company specializing in garden maintenance, ranging from garden design and construction to ground work and property boundaries. | Garden → Fences 824 Environment → Environmental Technology 712 | property boundary 10 garden maintenance 462 garden design 964 groundwork 1348 portfolio 6854 | De Fryske Marren → Echtenerbrug 24 |
| jaapvermeulen.nl | Timmer- en Aannemingsbedrijf Jaap Vermeulen | Timmer- en Aannemingsbedrijf Jaap Vermeulen is a construction company offering various building projects, from renovations to new builds, with a customer-focused approach. | Construction Companies → Construction Contractors 536 Building & Materials → Carpentry & Joinery 830 | extension 1941 carpentry 2218 new construction 2672 renovation 13849 | |
| vijzelbedrijfvandam.nl | Vijzelbedrijf Van Dam | Vijzelbedrijf Van Dam is a company specializing in the straightening of leaning buildings. | Garden → Garden Sheds 400 | shed 630 buildings 898 home 7976 | Garmerwolde → Lageweg 12 |
| campagne.zorgpartners.nl | Zorgpartners Midden-Holland | Zorgpartners Midden-Holland is a care organization providing care for elderly individuals with dementia, brain injuries, or physical limitations, both in traditional and innovative settings. | Neurology → Dementia 509 Health → Mental & Emotional Well-Being 23704 | colleague 378 home care 827 home 7976 care 12338 | Alphen aan den Rijn → Boskoop 652 |
| eijk.echtebakker.nl | Arjan van der Eijk, De Echte Bakker | The website of ‘De Echte Bakker’ is an online shop and a presentation of a bakery with locations in Gouda, Bergambacht and Haastrecht, which sells and delivers artisan bread and baked goods. | Dairy → Cheese 530 | specialty 229 bakery 718 bread 1622 webshop 8648 | Krimpenerwaard → Haastrecht 193 |