Business & Educational Software Solutions

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳module ⁹⁶¹	Business & Educational Software Solutions	This compilation features platforms and applications designed to streamline business operations, encompassing areas like project management, logistics, and customer relationship management. Many entries provide e-learning resources and training programs, catering to professional development in fields such as healthcare, finance, and technology.

961 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
rhmodules.nl	RHmodules	The website offers a collection of free modules designed to enhance Synthedit's functionality.	Programming Languages → C ²³ Digital Design & Graphics → Graphics ⁸⁸	dsp ¹³ meter ⁷⁶ grid ⁸⁵ text ²⁴⁶⁷
rockzolid.nl	RockZolid	RockZolid offers various modules such as puzzle modules and mangrove roots, allowing users to further expand their aquarium decorations.	Hobbies → Aquariums ²⁴⁸ Gardening → Aquatic Plants ¹²	backdrop ⁴⁶ aquarium ³²⁰ stone ⁷²⁴ decoration ⁴⁰⁸⁵	North-Holland → Purmerend ²⁶²⁰
wiseeagle.nl	Wise Eagle	The website primarily focuses on developing and offering e-learning modules.	Prevention → First Aid ¹⁰⁷⁰ Online Courses → E-Learning ⁶⁰⁶	emergency response ⁴⁵ e-learning ⁵⁸⁰ first aid ⁶⁰⁸
dehaanadviseur.nl	De Haan adviseur	De Haan adviseur offers various modules, including a maintenance module.	IT Services & Consulting → Information Technology ³⁷⁶³ Insurance & Risk → Risk Management ¹⁰⁶⁰
keuzethemas.nl	The Kabelfabriek	The website is built around extensive lesson modules that cover various topics.	Secondary Education → HAVO ⁸¹ Software Development & Engineering → Programming ⁵¹⁹	internet of things ¹⁸ usability ⁵⁷ algorithm ¹⁴¹ database ¹¹⁵³ game ²⁸⁰⁷
eloo.nl	eLoo	The various modules (DOT, BOOT, SET, Analysis module) offer specific functions for education-related tasks.	Business & Management → Educational Management ³⁷⁵ Technology & IT → Educational Innovation ²²⁵	observation ²⁴⁸ analysis ¹⁶¹⁵ school ⁷⁸⁵⁶ education ¹³⁴⁷¹
poliskraker.nl	Poliskraker	The website offers various modules that compare terms, such as the CAO module and the Cyberrisk module.	Insurance & Risk → Risk Management ¹⁰⁶⁰	cao ²³⁷ advisor ¹⁰⁵⁵ subscription ³²⁸⁷ insurance ⁶³⁵⁹
quinie.nl	Quinie	The website offers a range of custom-built modules for use in modular synthesizer systems, primarily focusing on buffering and signal routing functionality.	Computer → Computer Hardware ⁷¹⁵ Electronics & Components → DIY Electronics ¹⁷	rack ⁵³ signal ¹²⁹ diy ⁴⁴³ music ¹³¹⁷⁰
leerbeterschilderen.nl	Esther	The website offers several modules, ranging from a basic module to a follow-up module, focused on developing skills in portrait painting.	Training → Online Training ³⁴³ Galleries & Exhibitions → Art Routes ²¹⁵	video ⁶⁷¹⁴ course ¹⁴⁷²⁸
marktronics.nl	MarkTronics	The MT ignition modules are MarkTronics' main product and are described with their technical specifications and benefits.	Audio → Components ⁴⁸⁹ Transportation → Automotive Technology ³¹⁵	spark ²⁷
altenabike.nl	Altena Bike B.V.	The OPUS 3 module is a conversion kit that can be simply attached to an existing two-wheeled bicycle.	Cycling → Bicycle Accessories ⁷⁷ Bicycles & Wheels → Bicycles ¹⁴⁶⁶	tricycle ⁴¹ dealer ⁷⁵⁷ assembly ¹⁷³³ bicycle ²⁸³⁸ price ⁸³²⁸
perfectswitches.nl	Perfect Switches	The website sells modules that can be combined with switches and boxes.	Electronics & Components → Smart Home ³³	switch ¹⁴⁰ aluminum ¹¹⁹⁷ wifi ¹³⁷²
blueandme.nl	AUTOMOTIVE ELECTRONICS	The website focuses on the repair of Blue and Me modules.	Maintenance & Services → Auto Repair Services ⁷⁹⁴ Medical Care & Services → Diagnostics & Testing ³⁴⁸	fiat ⁴⁹ alfa romeo ⁶⁷ repair ¹⁴⁵⁷⁶
dfmsupport.nl	DFM Expo Support	The greenscreen module includes essential accessories such as lights and a tripod, and can be rented or purchased.	Business & Professional → Trade Shows ⁹⁵¹ Events → Event Support & Services ¹¹⁶	greenscreen ⁴³ trade show ⁹⁹ presentation ¹⁷⁸⁵ training ²⁸¹³³
octolabs.nl	Octolabs	Modules are pre-programmed components that can be added to OpenCart webshops to add functionality.	Education & Training → Database Management ²⁹⁰ Programming Languages → PHP ⁴⁰⁰	opencart ¹³ database ¹¹⁵³
doorapi.nl	DoorAPI	The website describes various modules, such as the Access, Ticketing, Identity, and Tracking Modules, which work together to provide a comprehensive access control solution.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	access control ³⁵⁰ identity ¹⁰²⁸ integration ¹⁴⁵¹ ticket ²⁷⁸⁵
gerbster.nl	Gerbrand Sterrenburg	The website provides detailed information on various electronic modules utilized within Eurorack systems, including VCOs, VCFs, and VCAs.	Instrument → Synthesizers ²⁷ Technology → Electronics & Components ¹¹²⁶¹
gpwebtech.nl	GP WebTech	The company develops both small and larger PrestaShop modules, tailored to the customer's needs.	E-Commerce → E-Commerce Platforms ⁴¹⁰ Web Technologies & Services → Web Development ²⁴⁸⁸	prestashop ⁴² synchronization ⁴² e-commerce ⁷³⁸ connection ⁴⁰⁰⁷ performance ⁷⁵⁸⁶
wetenschapslijn.nl	NVSHA Wetenschapslijn	The website offers a series of modules with different learning goals, including formulating research questions and scientific writing.	Curriculum & Resources → Curriculum ¹⁵³ Education → Pedagogy & Methods ²⁹⁴⁴	abstract ¹⁰⁸ educator ¹¹⁴
sharepointmodules.nl	Microsoft Solutions Partner	The website focuses on the diverse functionalities and benefits of the offered SharePoint Modules.	Business Software → Productivity Tools ⁴¹⁶ Business Services → Human Resources ⁵⁰⁵⁶	document management ⁶⁶ microsoft 365 ⁴³⁰ collaboration ¹⁶⁰³⁶
beroepskeuzeacademie.nl	Register BKA	The website offers a wide range of modules, including a new module on psychodiagnostics, which are offered via e-learning.	Vocational Training → MBO ⁶⁹⁰ History → Social Sciences ¹⁰⁷⁸⁶	psychodiagnostics ¹² register ³⁶² study ⁷²⁰ career ²⁵¹³ training ²⁸¹³³
tinymodule.nl	N.V. Tiny Module	The Tiny Module is a relocatable living unit that adapts to the environment and the wishes of the resident.	Sustainable Living → Sustainable Housing ¹⁸⁷ Property Location & Neighborhood → Residential ⁸⁵¹	dwelling ¹¹⁸ shape ¹⁷⁶ path ⁴⁶⁶ environment ⁴⁸⁷³
patientplus.nl	PatientPlus	The website offers a collection of e-health modules designed to improve healthcare delivery.	Patient Services & Rights → Patient Engagement ¹² Online Services → E-Health ⁶⁹	decision-making ¹⁵² symptoms ⁵⁵⁸ patient ⁴⁰⁸² care ¹²³³⁸
stoutfusion.nl	Stout Lighting	The FLAI module is the base of the lighting system and can be combined with various support systems.	Lighting → LED Lighting ⁵⁷⁴	hook ⁸⁰ battery ¹⁷⁵¹ light ⁵¹⁴⁸
lizzit.nl	Lizzit	Lizzit offers various modules that users can choose based on their needs.	Business Software → Marketing Software ⁹⁰ Web Development → Content Management Systems ⁵⁰²	communication materials ³¹ files ²⁹⁰
focusone.nl	FocusOne	FocusOne consists of several Excel modules, each with specific functionalities.	Data Management → Data Integration ¹⁰ Technology → Software Solutions ²¹⁵	exact ⁴² database ¹¹⁵³ report ⁴⁵⁵¹ article ⁶⁰⁰⁰ quote ¹²⁸⁶³
wp-portal.coopcollege.nl	Coop College	The Coop College offers a variety of modules, focused on different aspects of the work of Coop employees.	Vocational Training → MBO Education ²⁴	agf ²⁴ bread ¹⁶²² flowers ³²⁴⁸ training ²⁸¹³³
calculerenreserveren.nl	CalculerenReserveren.nl	CalculerenReserveren.nl offers various modules tailored to the needs of different businesses.	Business Software → Online Tools ³⁹⁶ Customer Relations → Customer Relationship Management ²³⁸	plasterer ²⁵⁹ painter ⁷⁴⁰ reservation ³³⁷³ quote ¹²⁸⁶³	Flevoland → Almere ⁷⁷⁶⁵
stembureauportal.nl	TSA Verkiezingen bv	The stembureauportal is divided into two modules: Self-Service and Stemhulp.	Political Processes → Elections ¹¹⁹ Technology → Software Solutions ²¹⁵	attendance ²² bureau ¹⁰³ functionality ⁴¹⁷ municipality ⁶⁸³⁷ communication ¹⁰¹⁶²
ple4win.nl	Expert Design Systems	The software incorporates various modules, including soil, non-linear, and check modules, to provide comprehensive pipeline analysis capabilities.	Information Technology → Data Management ⁸²⁷ Construction → Civil & Infrastructure ³⁴⁵³	wizard ¹⁴ pipeline ²⁰⁴ visualization ⁶²¹ soil ⁹³⁰ analysis ¹⁶¹⁵
free-learning.nl	Free Learning	Free Learning provides a diverse collection of modules on various topics in healthcare.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰	accreditation ¹⁸⁰ e-learning ⁵⁸⁰ healthcare ²³¹⁶ knowledge ³⁵²⁸
kiesopmaat.nl	Kies op Maat	Kies op Maat offers students the opportunity to follow specific modules, which are then assessed and potentially included in their main program.	Student Life → Students ³⁵²	minor ¹⁹ sap ¹²⁰ college ¹²² university ⁵⁹³	North-Holland → Amsterdam ⁴¹²⁵³
steamvidz.nl	Techni Science	The modules are structured in chapters with a specific time investment, focused on developing concrete skills.	Primary Education → Learning Materials ⁸⁹ Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	learning path ⁷⁸ robotics ²⁸¹ teacher ²⁸⁹⁰ technology ⁶⁸¹⁶ education ¹³⁴⁷¹
magleds.nl	Magleds	The LED modules are designed to easily upgrade existing Maglite flashlights without any modifications.	Retail & Commerce → General Online Stores ¹⁴ Technology → Electronics & Components ¹¹²⁶¹	lead ¹¹⁹⁵ warranty ⁴⁷⁰¹ ship ⁵¹⁰³
msg-denieuwewaterweg.nl	Modelspoor Groep De Nieuwe Waterweg	The website describes different modules, including Bend Modules and Steel Industry Modules, which are developed by the group.	Model Building → Model Railroading ²⁷³	model railroad ³¹ trains ¹⁴⁷	Rotterdam → Hillegersberg-Schiebroek ⁴⁰⁴
hagenaarcarware.nl	Hagenaar Carware	The website offers services for learning, cloning, and programming various modules and option codes in BMWs and Minis.	Transportation → Automotive Technology ³¹⁵ Transportation → Automotive Electronics ⁷⁶	retrofit ²⁶ ecu ⁵⁹ bmw ³⁴⁴ software ⁸²⁹¹ repair ¹⁴⁵⁷⁶
psychotherapie-generiekemodule.nl	WE.MAKE.LEARNING.WORK.	The ‘generic psychotherapy module’ is the central focus of the website and offers e-learning materials.	Online Courses → E-Learning ⁶⁰⁶ Training → Online Training ³⁴³	e-learning ⁵⁸⁰ audience ⁹⁰¹ question ²²⁶¹ account ⁵⁷⁸¹
ardussystems.nl	Ardus Systems	Ardus ERP is modular, allowing organizations to use only the modules they need.	Business Software → ERP Systems ¹⁰⁰⁷ Nature Conservation → Water Management ¹¹³⁸	quotation ²⁵³ erp ³⁶³ item ¹¹²⁵ administration ⁶⁵⁸⁷
careoffice.nl	CareOffice	The services are divided into five modules, which users can select individually.	Business Software → Accounting Software ⁹⁸⁴ Health → Medical Care & Services ²⁹⁴⁶¹	backoffice ¹¹⁴ staff ³⁴⁰⁵ marketing ⁷¹⁰⁷ strategy ⁹³⁷⁹
airbagmodule.nl	AIRBAGMODULE.NL	Almost all airbag modules from various brands and models can be repaired.	Road Services → Automotive ¹⁸⁷⁶⁴	repair ¹⁴⁵⁷⁶
cpd-elearning.nl	Medicom Medische Uitgeverij B.V.	The website offers over 200 elearning modules on various psychiatric topics, such as child psychiatry and forensic psychiatry.	Medical Care & Services → Psychiatry ⁷⁵⁶ Disease & Treatment → Medicine ¹⁰¹⁷	psychiatry ⁹¹ certificate ¹⁰³⁶ podcast ³³²⁸
exotec.nl	Exotec.nl	The webshop sells standard modules specifically designed to automate production processes.	Industrial → Industrial Automation ¹⁰⁴²	lift table ¹¹ production ⁴⁵⁸² webshop ⁸⁶⁴⁸
supersnelaandeslag.nl	N.V. [geen informatie op de website]	The website offers custom modules for onboarding employees, designed to quickly and effectively deliver the right information.	Web Design → Content Management ²⁹³ Recruitment → HR Services ³³⁸⁴	onboarding ⁷⁸ worker ¹⁴² texts ¹²¹⁸ image ²⁶⁰⁵ color ⁴¹⁵⁹
tridax.nl	Tridax Software	Cashmaster can be expanded with various modules, including a rental module, e-commerce module, and customer module.	Business Software → SMB Software ¹² Resources → Databases ³⁴⁸	inventory ¹⁶¹³
millennialmodules.nl	Millennial Modules	The training is structured into six individual modules, each focused on a specific aspect of burnout prevention.	Corporate Training → Employee Development ¹³ Human Resources → Employee Development ⁷⁶²	millennials ¹³ time management ⁹⁹ boundaries ⁵⁴⁶ burnout ¹⁶¹⁴ training ²⁸¹³³
wilmarinfo.nl	Wilmar	The software package consists of various modules, such as cash register, webshop, rental, and inventory.	Business Software → Retail Software ⁵⁶	cash register ⁷⁰ bicycle shop ⁹⁹ inventory ¹⁶¹³ software ⁸²⁹¹ webshop ⁸⁶⁴⁸
e-trailer.nl	E-Trailer	The website offers various modules that can be added to the E-Trailer system to increase functionality.	Caravans → Caravan Storage ¹⁴⁵ Mobile & Wireless Communication → Mobile Apps ⁵³⁴	water tank ¹⁹ tire pressure ²⁷ app ⁴⁵⁹⁵
go5.nl	GO.5	Customers can choose from many modules, such as a webshop module or newsletter tool.	Web Design → Website Builders ⁸⁸⁸	package ⁶¹¹² security ⁶⁶⁵⁵ design ²⁷²⁰²	Netherlands → Groningen ²³⁷³⁴
onderwijstuin.nl	De Onderwijstuin	Digital modules and lesson modules are offered to support teachers and present learning content in an accessible way.	Primary Education → Educational Materials ⁷¹¹ Education → Pedagogy & Methods ²⁹⁴⁴	digital platform ¹⁴ learning materials ²³⁹ lesson package ²⁴⁸ education ¹³⁴⁷¹ training ²⁸¹³³
korfbalassist.nl	KorfbalAssist	The website contains various functionality modules, such as a volunteer module and ClubTV, specifically developed for korfball.	Team Sports → Korfbal ⁴⁰⁶ Software Development & Engineering → Content Management Systems ¹⁷	korfball ⁷⁵ hosting ³¹²⁵
de-checkers.nl	The Checkers	The website offers a series of modules focused on supporting young people.	Training → Communication Skills ¹⁷²	signals ¹⁰⁵ certificate ¹⁰³⁶ conversation ¹⁸²⁸ tool ³⁹⁰⁷
digiscantechniek.nl	Techniek Nederland	The website includes several modules, including those for Wkb, administration, and supply chain collaboration.	Software Development & Engineering → Digitalization ²⁷⁶ Online & Digital → Digital Services ¹⁰⁰⁸	digitalization ⁷⁵⁷ report ⁴⁵⁵¹ data ⁵⁸⁷² software ⁸²⁹¹
psylearning.nl	PsyLearning	The modules are specifically designed for professionals in mental healthcare.	Health → Mental & Emotional Well-Being ²³⁷⁰⁴	mental healthcare ⁶⁹
shoppum.nl	Maakum	The webshop module, Shoppum, is provided by Maakum and offers various functionalities for managing an online store.	E-Commerce → Webshop Software ⁶⁹ Software Development & Engineering → Web Applications ¹⁰⁰⁵	store ³⁹⁰¹ webshop ⁸⁶⁴⁸	North-Holland → Amsterdam ⁴¹²⁵³
deonlinegeboortestudio.nl	Online Birth Studio	The website contains various modules, such as 'Better Labor,' which provides practical tips and exercises.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	question ²²⁶¹ tips ²⁷⁸⁹ partner ⁴²⁷² video ⁶⁷¹⁴ course ¹⁴⁷²⁸
mastercitydeveloper.nl	Erasmus University Rotterdam	The program is structured around six different modules, each with a specific theme.	Study Programs → Master Programs ⁵⁸	urban development ⁷⁰ collaboration ¹⁶⁰³⁶
justcarmen.nl	JustCarmen	The website’s primary offerings are custom modules designed to extend the functionality of Webtrees websites.	Web Design → Themes ²⁴⁰ Patient Services & Rights → Patient Engagement ¹²	theme ⁴⁰¹⁵
fleximaal.nl	Fleximaal	The software is based on ready-made modules that are easy to configure and integrate.	Technology → Software Solutions ²¹⁵ Software Development & Engineering → Custom Software ³⁰⁵	saas ¹³¹ customization ¹⁷²³ application ³³⁷⁷ software ⁸²⁹¹
zoektoolinbusiness.nl	ThiemeMeulenhoff	The InBusiness method consists of more than 450 flexibly deployable modules.	Economy & Finance → Economics ¹¹¹⁵ Vocational Training → MBO ⁶⁹⁰	email ¹⁰¹² topic ¹²³⁸ education ¹³⁴⁷¹
stuurwijs.nl	Stuurwijs	The website offers various modules, including quarterly reporting and spend analysis, for diverse business processes.	Enterprise Solutions → Business Systems ⁹¹ Administrative Support → Business Operations ¹¹⁵⁶	avg ¹⁴⁵ business operations ³¹⁰ risk ²⁸⁹⁶ report ⁴⁵⁵¹ education ¹³⁴⁷¹
modulemakers.nl	ModuleMakers	ModuleMakers designs and produces various types of modules for building technology, including WKO modules and ceiling modules.	Building & Construction → Sustainable Building ¹⁰⁰⁴ Legal & Permits → Building Technology ³⁸⁵	adaptability ³⁰ efficiency ³³⁶ customization ¹⁷²³ technology ⁶⁸¹⁶ sustainability ¹⁸⁴⁵¹
smarttrade.nl	Troublefree	The software consists of various modules, such as an inventory module and an invoicing module.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Retail Software ⁵⁶	pos ⁵³ automation ²⁶⁸² package ⁶¹¹² software ⁸²⁹¹
twentschevoetbalschool.nl	Twentsche Voetbalschool	Various technique and goalkeeper modules are available.	Sports Activities → Football ⁴¹⁴⁴ Sports & Fitness → Sports Programs ³⁶⁷	football school ⁵⁰ goalkeeper ⁶² academy ⁵⁹³ technique ²¹⁵⁷ training ²⁸¹³³	Overijssel → Twente ²⁵⁷⁸
dagelijksleren.nl	DagelijksLeren	The website offers a range of modules targeting specific educational needs, including math, vocabulary, and spelling.	Educational Resources → Digital Learning Resources ²⁷ Language Learning → Language Skills ⁵⁷	student ⁷⁶²³ software ⁸²⁹¹ training ²⁸¹³³
zusterkat.nl	Zuster Kat	The website offers a selection of e-learning modules that care professionals can use to improve their knowledge and skills.	Nursing & Support → Nursing ⁵³⁶ Online Courses → E-Learning ⁶⁰⁶	online learning ²² accreditation ¹⁸⁰ caregiver ¹¹⁶⁷ knowledge ³⁵²⁸ care ¹²³³⁸
voltane.nl	Voltane	Voltane offers a range of modules that can be implemented to support various business needs and optimize existing processes.	Business Software → Invoicing ¹⁰⁴ Business Software → CRM ⁷⁶⁴	invoicing ²⁹² crm ⁵⁹¹ integration ¹⁴⁵¹
ez-mix.nl	Intermix Management B.V.	The website utilizes various modules, including a Google module, a communication module, and a customer management module, to optimize online presence.	Business Software → ERP Systems ¹⁰⁰⁷ Education & Training → Database Management ²⁹⁰	product information ¹³ reference ³³² database ¹¹⁵³	South-Holland → Sliedrecht ⁸⁶³
treetrader.nl	Gouwe Computers	TreeTrader offers expandable modules, including a purchasing module and an offer module, for extra functionality.	Business Software → Accounting Software ⁹⁸⁴ Agriculture → Horticulture & Floristry ¹⁴⁰⁴	invoice ⁷⁹⁵ inventory ¹⁶¹³ sale ⁵⁹³⁰
vakdiplomanodig.nl	Vakdiplomanodig.nl	The courses are modular, allowing participants to flexibly choose which components they want to follow.	Road Services → Road Transport ⁴⁰⁰ Freight & Logistics → Trucks ⁸⁹⁹	transport company ⁴⁸ diploma ⁷⁹⁵ license ¹²⁸⁸ exam ²¹²⁰ course ¹⁴⁷²⁸
academiereflect.nl	Academie Reflect	The website is structured around modules that address specific aspects of letting go.	Mindfulness → Relaxation Techniques ⁶⁸ Adult & Continuing Learning → Professional Training ¹²²⁴	letting go ²⁵ belief ³²⁸ course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰
werkend-nederlands.nl	Werkend Nederlands	‘Werkend Nederlands’ consists of various modules specifically tailored to different industries and skill levels.	Language → Dutch ⁵⁶⁰ Language Learning → Language Education ⁴²⁷	pronunciation ³⁰ vocabulary ¹³³ industry ¹⁷⁸⁰ employee ⁴⁴²⁹
digiraf.nl	Digiraf	Digiraf creates custom modules for Magento 2 to extend its functionality and tailor it to specific client needs, like shipping and payment modules.	Software Development & Engineering → App Development ¹⁰⁸⁴ Software Development & Engineering → Programming ⁵¹⁹	node.js ¹⁴ react native ¹⁷ react ¹¹²
elo-bridge.nl	ELO BridgeBond	The courses are divided into modules, which can be followed individually or as a series.	Card Games → Bridge ¹⁸⁶ Online Courses → E-Learning ⁶⁰⁶	elo ¹¹ bridge ⁵⁵⁷ education ¹³⁴⁷¹ course ¹⁴⁷²⁸
vanrationaargevoel.nl	Rebecca Sopacua	The website offers various modules with spiritual guidance.	Transportation → Automotive Technology ³¹⁵ Manufacturing & Industrial → Mechanics ³⁹	alignment ¹⁹⁹	South-Holland → Leiden ⁷⁰⁸⁹
teamscout.nl	TeamScout	The software offers various modules, such as the 'Player' module and the 'Team' module, which provide specific functionalities.	Sports Activities → Football ⁴¹⁴⁴ Education → Sports Management ¹⁰⁰	player ⁶⁷⁸ license ¹²⁸⁸
nvr-nascholingen.nl	NVR	Each course consists of modules that users can flexibly follow and pause.	Body & Movement → Rheumatology ⁴⁴ Research & Academia → Medical Education ¹⁸³	mri ⁴⁵ case study ⁵⁶ presentation ¹⁷⁸⁵ course ¹⁴⁷²⁸
mbomarketing.nl	MBOMarketing.nl	The online learning methods consist of various modules with chapters.	Online Courses → E-Learning ⁶⁰⁶ Vocational Training → MBO Education ²⁴	curriculum ²⁷⁷ e-commerce ⁷³⁸
installwise.nl	InstallWise	The website uses a modular learning concept, breaking down learning objectives into small, manageable modules.	Building & Construction → Sustainable Building ¹⁰⁰⁴ Adult & Continuing Learning → Professional Training ¹²²⁴	circuit breaker ¹⁵ infrared ⁸⁹ installation ¹³⁷⁴² training ²⁸¹³³
particle.nl	Particle	Standard modules are developed in collaboration with ambulance services and can be linked to other systems.	Software Development & Engineering → App Development ¹⁰⁸⁴ Technology → Software Solutions ²¹⁵	roster ⁴⁷ employee ⁴⁴²⁹ software ⁸²⁹¹	Friesland → Harlingen ⁹⁷⁸
assupport.nl	AS Support	The website offers various modules, including mortgage modules, secure file sharing, and digital newsletters, aimed at improving efficiency and generating leads.	Business Software → Document Management ³²⁸ Financial Services → Advisory Firms ²²²	digital tools ⁴¹ efficiency ³³⁶ lead ¹¹⁹⁵ office ²⁸⁹⁸
ovas.nl	OVAS Solutions	OVAS Connect consists of various modules, such as relationship management, accounting, and adoption management.	Business Software → CRM ⁷⁶⁴ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	relationship management ⁴⁸ crm ⁵⁹¹ account ⁵⁷⁸¹ software ⁸²⁹¹
renset.nl	Renset	Renset modules are robust, lightweight, and capable of handling high power requirements, utilizing patented technology for safety and durability.	Horticulture & Floristry → Supplies ⁷² Metalworking → Machines ³⁰⁷	power station ²⁰ connect ⁷¹ capacity ²⁸² battery ¹⁷⁵¹ equipment ⁴¹⁴³	South-Holland → Delft ⁵³⁰⁹
laluna-learningadventures.nl	La Luna Learning Adventures	The website offers various modules focused on enrichment education for primary school students.	Education & Training → Educational Software ²⁷⁴ Primary Education → Learning Resources ¹²⁹	evaluation ²²⁴ assignment ¹¹²¹ student ⁷⁶²³ story ⁸²⁸⁵ education ¹³⁴⁷¹	Limburg → Maastricht ⁶⁰⁰⁸
hortitime.nl	HortiTime	HortiTime is built from various modules, which can be selected individually and affect the price.	Project Management → Time Tracking ⁸⁴	leave ⁸⁴ time tracking ¹²⁶ document ¹⁶⁷⁸ planning ¹⁹⁶⁹
appyourstore.nl	Digital Value Marketing	An Appyourstore module is a software component that provides specific functionality, in this case, for managing webshops and online catalogs.	Web Design → Website Builders ⁸⁸⁸ E-Commerce → Webshop Software ⁶⁹	core business ³³ webshop ⁸⁶⁴⁸
larnitech.nl	Larnitech Nederland BV	The website presents various modules, such as DIN-Rail modules, Servers and CAN-bus switches, which are essential for the functionality of the Smart Home System.	Automation & Control → Automation ¹⁴⁹⁴ Audio → Components ⁴⁸⁹	sensor ⁴⁸² dealer ⁷⁵⁷	Gelderland → Nijmegen ⁹³⁸⁴
offsys.nl	Offsys	The software is based on combining various modules, providing flexibility.	Business Software → Invoicing ¹⁰⁴ Business Software → CRM ⁷⁶⁴	portal ⁵⁹¹ crm ⁵⁹¹ software ⁸²⁹¹
plansheet.nl	Plansheet BV	Plansheet can be expanded with various modules, such as a budgeting module.	Business Software → Scheduling Software ⁵² Business Software → CRM ⁷⁶⁴	budgeting ¹⁷⁴ scheduling ²⁶¹ capacity ²⁸²
modularsynthesizers.nl	MODSOUND	The website offers a wide variety of Eurorack modules, encompassing various functionalities for modular synthesizer systems.	Instrument → Synthesizers ²⁷	synthesizer ⁶⁷ cable ⁷³² case ¹¹⁵³	South-Holland → The Hague ¹⁹⁸⁹⁸
timorozendal.nl	Timo Rozendal	Timo Rozendal designs and creates his own Eurorack modules, offering them as complete PCB/panel sets for purchase.	DIY → Electronics ²⁴ Technology → Electronics & Components ¹¹²⁶¹	instagram ¹²¹⁶
psychotherapie-nascholing.nl	Tijdschrift voor Psychotherapie	The e-learning modules cover various aspects of psychotherapy, including treatment, diagnosis, and ethics.	Online Courses → E-Learning ⁶⁰⁶ Driver & Vehicle → Continuing Education ⁴⁵⁴	e-learning ⁵⁸⁰ points ⁶¹² psychotherapy ⁹¹¹
workmotiv.nl	Motivaction	The tool is built from 10 different modules that can be customized to the user's needs.	Business Software → HR Software ⁶⁴⁹	department ²⁶⁹ results ³⁹⁵⁴ employee ⁴⁴²⁹ research ⁸⁹⁶⁷
gogeo.nl	Provincie Gelderland	GoGeo offers interactive modules that make the subject matter more accessible.	Artificial Intelligence → Applications ⁵²⁷ Vocational Training → MBO ⁶⁹⁰	vr ²⁴⁹ energy ⁹⁰⁷⁵ education ¹³⁴⁷¹ sustainability ¹⁸⁴⁵¹
ortello.nl	Ortello	The platform provides various e-learning modules about radiotherapy.	Online Services → Platforms ⁵³⁷ Health → Medical Care & Services ²⁹⁴⁶¹	radiotherapy ²⁴ institute ¹⁰⁸ colleague ³⁷⁸ e-learning ⁵⁸⁰	North-Brabant → Eindhoven ¹¹⁸⁴⁵
ipronto.nl	Ipronto Communications B.V.	The software is built around modular applications that can be combined to meet specific business needs.	Residential Construction → Modular Construction ⁴²	modularity ²³ industry ¹⁷⁸⁰ automation ²⁶⁸² software ⁸²⁹¹
adviestoolestateplanning.nl	Adviestool Estateplanning	Several modules are available within the Adviestool software.	Business Software → Scheduling ²⁹ Inheritance Law → Wills ²⁰⁰	estate planning ⁹³ inheritance ³⁵⁴ will ⁵¹⁰ software ⁸²⁹¹
pbsopleidingen.nl	PBS Opleidingen	The website offers various Baransu Shiatsu modules, focusing on specific areas of the body.	Alternative Medicine → Shiatsu ⁸³⁰ Education → Adult & Continuing Learning ⁶⁵¹⁰	masterclass ⁴¹⁹ shiatsu ⁵⁷⁸ puzzle ⁸¹¹ health ⁶³⁶⁶ training ²⁸¹³³	Amsterdam → Driemond ⁵⁷
kastmodule.nl	Kastmodule	The website supplies complete cabinet modules custom-made for IKEA PAX cabinets, focusing on tailored solutions.	Storage → Cabinets ⁶¹² Kitchen → Custom Furniture ⁴⁷³	ceiling ⁶²⁷ cabinet ¹⁷³⁰ door ²²¹⁰ price ⁸³²⁸ accessories ¹²⁹⁷⁵
modelspoorelektronica.nl	Modelspoorelektronica	Modules, such as the Pendelautomaat and the Keerlus, are essential components for automating model building projects.	Hobbies → Model Building ¹⁰⁰⁷	diorama ⁷¹ light ⁵¹⁴⁸
marrigt.nl	BeTheme	The website utilizes various modules, including service, portfolio, and blog sections, to enhance functionality.	Web Design → Themes ²⁴⁰	wordpress theme ²⁷ user experience ²³⁵ theme ⁴⁰¹⁵	Friesland → Southwest-Friesland ⁴¹⁹⁴
grieksonline.nl	GrieksOnline	The content is organized into different modules, catering to beginners and advanced learners.	Websites → Educational Websites ¹⁷⁸ Language Learning → Language ¹⁶⁸⁹	alphabet ²⁷ greek ⁴² grammar ¹¹⁷ exercises ¹⁰⁵⁸
opencartstore.nl	Dymago	The website sells a wide range of modules that extend the functionality of OpenCart webshops.	E-Commerce → E-Commerce Platforms ⁴¹⁰	opencart ¹³ payment methods ¹⁵⁹ theme ⁴⁰¹⁵ report ⁴⁵⁵¹	Zaanstad → Zaandam ²⁷⁴⁰
jxta.nl	Juxta	Juxta designs and builds various modules, such as container homes, office containers, sanitary boxes, and camping boxes.	Recreational Vehicles → Caravans ⁸²⁰ Family Fun → Camping ³³¹²	sanitary ⁷⁵⁰ sauna ¹¹⁷⁵ container ¹⁷⁰⁹ camp ²⁴⁶⁶ housing ⁴³⁷⁸
mototronixwebwinkel.nl	MotoTroniX	The website offers various modules, such as alarm light modules and headlight dimmer modules, to solve various problems on motorcycles and improve visibility.	Parts → Motorcycle Parts ⁴⁸⁸ Car Care & Detailing → Automotive Accessories ⁵⁶⁸	switches ⁶⁸ headlight ⁸² lights ¹⁵⁵
hybrideaccuspecialist.nl	Hybrid Battery Specialist	During the repair process, defective modules are replaced with tested modules.	Commercial Vehicles & Trucks → Delivery Vans ³⁶ Electronics & Components → Batteries ³⁷⁶	pickup ⁷³⁶ battery ¹⁷⁵¹	North-Brabant → Breda ⁹⁰⁰³
tolerantielespakket.nl	Stichting 21 maart Gouda	The program includes various modules on inclusion and respect.	Social Issues & Welfare → Social Issues ¹⁸⁵⁴⁴ Education → Pedagogy & Methods ²⁹⁴⁴	discrimination ¹¹⁶ diversity ⁴⁹² education ¹³⁴⁷¹
titantask.nl	Titantask	The website offers various modules, specifically designed for restaurants, stores, and supermarkets.	Business Software → POS Systems ¹⁰¹	omnichannel ³⁷
lmesh.nl	LMesh	LMesh offers various hardware modules like the BLE Module and Mini LoRa, supporting low-energy communication standards.	Virtual & Augmented Reality → Internet of Things (IoT) ¹⁰⁵	iot ¹⁸³ hardware ⁹⁴¹ monitor ¹⁰⁶³ security ⁶⁶⁵⁵ software ⁸²⁹¹
horecatrainingholland.nl	Marketing Training Holland	Customers can order their own module, tailored to their specific needs.	Training → Corporate Training ¹³³¹ Online Courses → E-Learning ⁶⁰⁶	e-learning ⁵⁸⁰ scan ⁷⁹⁰ consultancy ²⁵⁹⁶ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵
verticale-tuin-maken.nl	Verticale Tuin Maken	The website sells various modules (Vertical Wall, Module, Corner Module) that can be stacked on top of each other to create a vertical garden.	Garden → Artificial Plants ⁷³ Gardening → Vertical Gardens ¹⁵	vertical garden ²¹ substrate ¹⁶⁴ food ³⁸⁷² plant ⁴⁵⁰⁹	Gelderland → Druten ⁵⁹⁰
apotheekmonitor.nl	Maarn Consult	The Apotheekmonitor consists of five standard modules plus optional modules.	Business Software → Management Software ¹⁴⁶ Pharmaceuticals & Medical Products → Pharmacies ¹⁰²⁹	pharmacy ⁷⁰² policy ²¹⁴⁹
artiestonline.nl	Artiestonline	The website provides a variety of proven modules, such as a news module or photo gallery, which can be easily added.	Online Marketing → Website Management ³⁶⁹ Online Services → Platforms ⁵³⁷	lightspeed ¹⁰ cms ⁶¹³ social media ³³⁴²
baseweb.nl	BaseWeb	BaseWeb offers various modules, such as a mailing module and an invoicing module.	Online Marketing → Website Management ³⁶⁹ Business Software → CRM ⁷⁶⁴	email ¹⁰¹² administration ⁶⁵⁸⁷ appointment ¹³⁵¹⁰
dbkwaliteit.nl	De Brabander Kwaliteitsmanagement	The Q-Module is a system of modules for quality system structure	Bakery & Food Production → Agribusiness ⁶⁴ Management → Quality Management ⁹⁰⁹	quality system ⁴⁹ audit ⁶²² risk ²⁸⁹⁶ training ²⁸¹³³
ma-ed.nl	ma-ed	The website is structured around modules that cover specific skills and concepts.	Software Development & Engineering → App Development ¹⁰⁸⁴	ux/ui ³⁶ wordpress ³⁵⁵¹ webdesign ⁴⁰⁹²
magnex.nl	Magnex	The track uses ‘modules’ that create surprising effects by moving the ball.	Toys → Educational Toys ²¹² Technology & IT → STEM Education ²⁴	effect ¹⁵⁴ ball ²⁸⁶ track ⁴¹⁶ student ⁷⁶²³ collaboration ¹⁶⁰³⁶
panartis.nl	Panartis	Panartis specializes in the development of online modules for specific subjects.	Business Support & Advisory → Advisory ⁴¹³ Events & Hospitality → Planning ⁶⁶³	presentation ¹⁷⁸⁵ review ¹⁸⁸⁸ education ¹³⁴⁷¹
powersp00n.nl	Persoonlijke Hogeschool Rotterdam	The project aims to parse and store the modules in a database so that users can plan their schedules.	Education & Training → Database Management ²⁹⁰ Resources → Databases ³⁴⁸	code ⁵⁰⁹ database ¹¹⁵³ schedule ²⁶²⁴
restica.nl	Restica	Restica contains 8 modules that cover various aspects of the hospitality industry.	Business Software → Hospitality Software ³⁹	scheduling ²⁶¹ cost ¹⁹⁹⁰ reservation ³³⁷³ package ⁶¹¹²
lijmsite.nl	NLT	The NLT module serves as the basis for the information on the website.	Adhesives & Sealants → Adhesives ¹⁴³ Primary Education → Educational Materials ⁷¹¹	glue ¹⁶² attachment ²⁰⁸ education ¹³⁴⁷¹
makelaars-software.nl	Makelaarssoftware BV	The website contains various modules that brokers can use, such as the new construction module.	Property Agents & Brokers → Realtors ³⁴¹ Software → Real Estate Software ¹⁰⁰	property value ⁶³ broker ⁹⁰² mortgage ⁴⁵⁶⁴ software ⁸²⁹¹
regelkasten.nl	Regelkasten.nl	Modules are extensions that enhance the functionality of controllers.	Automation & Control → Automation ¹⁴⁹⁴ Technology → Electronic Goods ⁸⁴	controller ²³⁹ wordpress ³⁵⁵¹
krachtvansynergie.nl	Intermix	The website describes various modules, including a communication and customer management module.	Business Software → Business Process Management ³³³ Business Software → ERP Systems ¹⁰⁰⁷	synergy ⁶⁶ webshop ⁸⁶⁴⁸
me-learning.nl	Woody's Holding B.V.	The website offers a series of seven interactive e-learning modules.	Online Courses → E-Learning ⁶⁰⁶ Training → Online Training ³⁴³	medical specialist ²⁴ scenario ²⁸¹ crm ⁵⁹¹
startcms.nl	DogIT	The website contains various modules, such as a newsletter module, form module, and webshop module.	Web Design → Content Management ²⁹³	preview ²⁵ template ⁷⁴² image ²⁶⁰⁵
svhbakkerstalent.nl	SVH	Teachers can create individual learning modules that fit their curriculum.	Online Courses → Learning Platforms ¹⁰⁶	learning platform ³⁴ lesson program ⁷¹ e-learning ⁵⁸⁰ student ⁷⁶²³
homedna.nl	ECI Software Solutions	HomeDNA offers various modules specifically focused on different phases of construction projects, such as sales and quality.	Business Software → Project Management Software ⁶⁵ Construction & Engineering → Construction Software ⁵⁷	sale ⁵⁹³⁰ collaboration ¹⁶⁰³⁶
thisisnotrocketscience.nl	Bopp & Steve	The website’s core product is the Eurorack module, designed for electronic music production and experimentation.	Popular → Electronic Music ⁵⁰⁵ Technology → Electronics & Components ¹¹²⁶¹	launch ⁴⁴ synthesizer ⁶⁷	Amsterdam → Ruigoord ¹⁶
finconnect.nl	FinConnect	The platform offers diverse modules for various financial processes.	Business Software → ERP Systems ¹⁰⁰⁷ Business Software → CRM ⁷⁶⁴	form ⁶⁷⁹ administration ⁶⁵⁸⁷
dentallect.nl	Bohn Stafleu van Loghum	Dentallect offers a wide range of e-learning modules.	Online Courses → E-Learning ⁶⁰⁶ Vocational Training → MBO ⁶⁹⁰	skills ¹¹⁰⁵ practice ⁹⁰⁸⁹ course ¹⁴⁷²⁸
fuzefield.nl	FuzeField	The website describes various learning modules that users can choose themselves.	Primary Education → Educational Materials ⁷¹¹ Technology & IT → Educational Technology ³⁸⁰	level ⁴⁹⁴ game ²⁸⁰⁷
digitalepoli.nl	Digitalepoli	Various social and interactive modules are available to connect patients with each other.	Online Services → E-Health ⁶⁹ Health → Medical Care & Services ²⁹⁴⁶¹	healthcare provider ⁴⁷⁴ patient ⁴⁰⁸² communication ¹⁰¹⁶²
ikwilonlineleren.nl	IkWilOnlineLeren	The learning modules are interactive and consist of videos, questions, and animations.	Online Courses → Learning Platforms ¹⁰⁶ Technology & IT → Educational Technology ³⁸⁰	assessment ¹²⁰⁵ report ⁴⁵⁵¹ course ¹⁴⁷²⁸ brand ¹⁷⁷³⁷
kobalt-it.nl	Kobalt IT	The software consists of various modules that users can select based on their needs.	Education & Training → Educational Software ²⁷⁴ Business & Management → School Administration ⁶⁹	time tracking ¹²⁶ tutoring ⁷⁷² software ⁸²⁹¹	Bernheze → Heeswijk-Dinther ³²²
kunstelo.nl	Stichting Passend Onderwijs	The website includes lesson modules for different subjects, enabling students to practice actively.	Educational Resources → Online Learning ¹⁶ Technology & IT → Educational Technology ³⁸⁰	subject ²⁰³ assessment ¹²⁰⁵ school ⁷⁸⁵⁶	Gulpen-Wittem → Gulpen ²⁶¹
spikkl.nl	Spikkl	Spikkl modules, available for PHP, NodeJS, and WooCommerce, simplify API integration.	Development & Programming → APIs ³²	github ¹⁰⁸ requests ¹⁹⁷ api ²⁷⁶
ifra.nl	Webbureau IFRA	The company develops various functional modules for WordPress websites, such as online sales and reservation systems.	Web Design → Website Maintenance ²⁸⁷ Online Marketing → Website Management ³⁶⁹	wordpress ³⁵⁵¹ webdesign ⁴⁰⁹²
meshlink.nl	Meshlink B.V.	The platform is built with modules, customizable to fit each association's needs.	Business Software → Management Software ¹⁴⁶ Initiatives & Projects → Local Initiatives ¹⁰⁰¹	light ⁵¹⁴⁸ association ⁸⁵⁶²
mondial-it.nl	Mondial-IT	Mondial-IT develops and integrates various modules for different systems and platforms, such as webshops and ERP systems.	Web Development → CMS ⁵¹⁶ Online & Digital → Digital Services ¹⁰⁰⁸	llm ²² drupal ⁸⁰ ai ²¹⁸¹ application ³³⁷⁷
digiscanbouw.nl	Bouwend Nederland	The tool includes three different modules that explore specific aspects of digitalization.	Data Analysis → Business Intelligence ¹⁰⁰² Software Development & Engineering → Digitalization ²⁷⁶	digitalization ⁷⁵⁷ report ⁴⁵⁵¹
gisib.nl	gisib BV	The Gisib system offers various modules, such as process modules, planning modules and inspection modules, to support specific needs.	Investing → Asset Management ³¹⁸ Applications → Business Applications ¹¹⁰	asset management ³¹⁵ integration ¹⁴⁵¹ data ⁵⁸⁷² software ⁸²⁹¹
sound-force.nl	SoundForce	SoundForce produces a diverse range of modules, such as filters and oscillators, for use in modular synthesizer systems.	Computer → Computer Hardware ⁷¹⁵ Electronics & Components → DIY Electronics ¹⁷	synthesizer ⁶⁷ diy ⁴⁴³
0100dev.nl	0100Dev	The company’s core service is developing software modules for various integrations with different platforms.	Software Development & Engineering → App Development ¹⁰⁸⁴ Manufacturing & Industrial → Hardware Development ²⁰	iot ¹⁸³ hosting ³¹²⁵	Geldrop-Mierlo → Geldrop ⁷⁹⁴
drankjeminder.nl	Drankje Minder	The website provides a free 5-day module with valuable tips and information on stopping alcohol consumption.	Mental & Emotional Well-Being → Addiction ⁴⁹³ Disease & Treatment → Alcohol Abuse ¹²	alcohol ¹⁵⁰ retreat ¹⁶³⁸ life ²⁶⁷³ tips ²⁷⁸⁹ story ⁸²⁸⁵
study247.nl	Study247	The online modules are developed by Study247 and cover relevant topics.	Online Courses → E-Learning ⁶⁰⁶ Specialty Medicine → Occupational Medicine ¹²⁹¹	vca ²⁸³ feedback ⁵¹⁵ certificate ¹⁰³⁶ course ¹⁴⁷²⁸
smildeflexacademy.nl	Royal Smilde	New employees are requested to complete the offered modules.	Corporate Training → Safety Training ⁷⁴⁵ Online Courses → E-Learning ⁶⁰⁶	contact person ²⁴³ e-learning ⁵⁸⁰ employee ⁴⁴²⁹
vendit.nl	Vendit BV	The company offers complete software with industry-specific modules.	Automation & Control → Automation ¹⁴⁹⁴ E-Commerce → E-Commerce Platforms ⁴¹⁰	omnichannel ³⁷ cash system ⁶⁹ e-commerce ⁷³⁸ automation ²⁶⁸²
amsystems.nl	AMSYSTEMS	The modular design of the MLP allows for easy expansion of build size without compromising layer time or beam perpendicularity.	Manufacturing → 3D Printing ⁵⁶⁵ Optics & Imaging → Optics ³⁷	prism ¹⁰ resin ⁷⁹ laser ⁸⁶⁸
leerkracht-academie.nl	LearningRocKs	The academy provides modules that schools can learn and apply.	Web Design → Content Management ²⁹³ Human Resources → Talent Management ⁵³⁷	role ²³⁴ academy ⁵⁹³ registration ⁴³⁶⁶
sdbwebshop.nl	SDB Webshop	The e-learning modules are developed for professionals in different healthcare facilities.	Online Courses → E-Learning ⁶⁰⁶ Online Courses → Learning Platforms ¹⁰⁶	healthcare ²³¹⁶ knowledge ³⁵²⁸ employee ⁴⁴²⁹ course ¹⁴⁷²⁸
assistent.nl	Assistent Automatisering	The Assistent package is expandable with various modules, allowing it to be adapted to the specific needs of the insurance advisor.	Business Software → CRM ⁷⁶⁴ Software Development & Engineering → Custom Software ³⁰⁵	customer portal ¹⁴¹ helpdesk ¹⁹⁴ crm ⁵⁹¹ integration ¹⁴⁵¹ package ⁶¹¹²
haarlemschaakt.nl	Haarlem Schaakt	The website offers two modules: 'Learn to Play Chess' for beginners and 'Get Better at Chess' for advanced players. Both modules are designed to help players improve their skills.	Board → Chess ⁴⁶⁸	practice book ²¹ chess ²¹⁶ lesson ⁵¹⁵⁴ coach ²⁵⁸¹⁰
tipsentoolsvwe.nl	VWE Automotive	The website describes various modules within Mijn VWE, which provide functions such as vehicle registration and advertising management.	Car Dealerships → Online Car Sales ⁴⁴ E-Commerce → Marketplaces ¹⁰⁵³	marktplaats ⁵⁷ rdw ²⁶³ advertisement ¹⁷⁰⁷ advertising ²³⁰² vehicle ³⁷⁴³
continuprocesverbeteren.nl	ProMISe	The platform offers a diverse set of modules designed to address specific operational needs.	Operations Management → Process Improvement ⁶⁶ Industrial → Industrial Automation ¹⁰⁴²	continuous improvement ²³ roi ⁶¹ quality management ¹⁶⁹
go21.nl	GO21	GO21 provides educational modules for schools, developed by experts.	Primary Education → Educational Materials ⁷¹¹ Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	learning pathway ⁴⁴ digital literacy ⁶⁸ society ¹³⁷⁶ technology ⁶⁸¹⁶ school ⁷⁸⁵⁶
newtria.nl	SLV	Users can choose between an LED or GU10 module when assembling their NEW TRIA spotlight.	Lighting → LED Lighting ⁵⁷⁴	spotlight ⁸² brochure ¹⁶⁴² customization ¹⁷²³
imaonline.nl	rieemaken.nl	The IMA consists of more than forty modules, each focused on specific workplace risks.	Productivity & Office → Business Tools ¹⁶ Risk Management → Risk Assessment ⁹⁵	survey ³⁷⁰ law ¹³²⁹ report ⁴⁵⁵¹
go2lean.nl	Go2Lean	Users can build their own learning program by choosing individual modules.	Management → Lean Management ²⁶⁷ Online Courses → E-Learning ⁶⁰⁶	lean ¹⁶⁴ coach ²⁵⁸¹⁰ training ²⁸¹³³
fair-huren.nl	Unicat	Unicat has developed a new module called WT69, specifically designed as a mobile repair station or travel camper unit.	Recreational Vehicles → Caravans ⁸²⁰ Trailers & Towing → Trailers ⁶⁵⁰	camper ¹⁵⁹⁶ trailer ¹⁶²⁴ solar panels ⁴⁷⁰¹ workshop ¹⁹³²⁵
mevis.nl	Mevis	Mevis has developed various free online self-help modules that users can work on at their own pace to develop their personal skills.	Social Services → Neighborhood Teams ³³ Social Services → Youth Support ⁵³⁰	neighborhood team ⁴⁵ youth support ¹²⁵ course ¹⁴⁷²⁸	South-Holland → Maassluis ⁹⁸⁸
svhhorecatalent.nl	SVH	The website provides diverse e-learning modules, integrating interactive methods and visual elements for effective knowledge processing.	Training → Corporate Training ¹³³¹ Online Courses → E-Learning ⁶⁰⁶	certificate ¹⁰³⁶ hospitality ³⁴⁹¹ training ²⁸¹³³
hydrauliektraining.nl	HydrauliekTraining.nl	Users can choose and follow individual modules instead of complete courses.	Training → Technical Training ⁹⁸ Online Courses → E-Learning ⁶⁰⁶	pace ⁹² hydraulic ²³⁴ e-learning ⁵⁸⁰ component ⁷¹⁴ course ¹⁴⁷²⁸
e-lia.nl	E-Lia	Setting up learning modules is quick and easy, with a sending time of just seconds.	Online Services → Platforms ⁵³⁷ Communication → WhatsApp ²⁵	microlearning ¹³ whatsapp ³⁸² dashboard ¹³⁷⁴ ai ²¹⁸¹
rainblock.nl	Rainblock	Rainblock modules can be integrated into garden barriers or wall installations.	Outdoor Living → Garden Fencing ³⁹ Nature Conservation → Water Management ¹¹³⁸	rainwater ⁹⁹ garden ¹³¹²⁹
whatsnexxt.nl	Whats Nexxt	Whats Nexxt’s training modules are innovative and human-centered, focused on stimulating teams and individuals.	Coaching → Leadership Coaching ⁵⁵⁷ Management → Team Development ⁶¹⁷	person ⁴⁴⁸ leadership ³⁷²⁴ book ¹¹³⁹⁶ coach ²⁵⁸¹⁰
bpmmodules.nl	BPM Modules	The website offers diverse modules focused on analyzing, redesigning, and implementing processes.	Management → Process Management ³⁰¹	process management ¹³⁸ consulting ³⁶³⁹ training ²⁸¹³³
bpmopleidingen.nl	BPM Opleidingen	The website offers 33 training modules that cover the essence of process management.	Operations Management → Process Improvement ⁶⁶ Training → Corporate Training ¹³³¹	lead time ¹⁹ consultant ⁷⁰⁶ training ²⁸¹³³
audiohotshot.nl	Audiohotshot	The website offers a selection of TAKTExpand synthesizer modules, designed to inspire and support musical creativity.	Retail & Supplies → Specialty Retail ³⁴⁷ Electronics & Components → DIY Electronics ¹⁷	synthesizer ⁶⁷ manual ⁹⁶ shop ⁶⁴⁸³
kleinewoningen.nl	Kleinewoningen	The house consists of modular components.	Real Estate → Project Development ⁶³³ Fabrication & Production → Prefabrication ⁴¹²	factory ⁵²⁶ housing ⁴³⁷⁸ house ⁸¹²¹	Friesland → Leeuwarden ⁶⁰⁶⁸
gezondevolwassene.nl	Claassen Mental Health Services	The workshop covers a specific module on Schematherapy and the Healthy Adult method.	Alternative Medicine → Shiatsu ⁸³⁰ Mental & Emotional Well-Being → Therapy ⁴²⁷⁴	schema therapy ⁷³ therapist ¹⁸⁹⁰ technique ²¹⁵⁷ workshop ¹⁹³²⁵	North-Holland → Amsterdam ⁴¹²⁵³
devitaliteitsacademie.nl	Vitality Academy	The academy offers a wide range of modules focused on improving physical and mental health.	Training → Online Training ³⁴³ Personal Care & Services → Vitality ⁵⁶⁵	workbooks ⁴⁴ sleep ⁷⁴⁶ vitality ¹⁷²⁶ movement ²³⁰⁴ stress ³⁹⁶⁵
frameid.nl	De Onzichtbare Bescherming	Frame-ID consists of a unique identification module that is installed in the bicycle frame.	Information Technology → Cybersecurity ¹⁰⁰⁹ Bicycles & Wheels → Bicycles ¹⁴⁶⁶	database ¹¹⁵³ smartphone ¹³⁴⁴ bicycle ²⁸³⁸ security ⁶⁶⁵⁵
goharmony.nl	Livits	Livits offers various modules that can be added to the base software.	Software Development & Engineering → Software ¹¹⁶⁰⁸	customer story ²³ membership administration ⁴⁴ crm ⁵⁹¹ member ¹⁰¹⁵⁴ communication ¹⁰¹⁶²
rechtshof.nl	Rechtshof	Rechtshof offers specialized legal assistance through various modules, ensuring you receive the specific support you require.	Legal → Specific Legal Areas ³¹ Legal → Legal Aid ⁴²⁰	legal assistance ⁵³⁷ case ¹¹⁵³ lawyer ²⁶⁸³
coachdevuurtoren.nl	Coach De Vuurtoren	The website provides several online modules on HSP, parenting, and relationships, offering practical knowledge and skills.	Education → Pedagogy & Methods ²⁹⁴⁴	hsp ¹⁷⁵ parenting ⁹⁷² coach ²⁵⁸¹⁰ training ²⁸¹³³
argowil.nl	Argowil	The company specializes in module construction, where products are adapted to the specific needs of the customer.	Industrial → Industrial Automation ¹⁰⁴² Administrative Support → Family Businesses ⁶⁶⁴	cable tree ¹⁰ customization ¹⁷²³ assembly ¹⁷³³ production ⁴⁵⁸²	Limburg → Venray ¹⁶⁰¹
grexmanager.nl	Grex	GrexManager includes both standard and optional modules.	Business Software → Project Management Software ⁶⁵ Law → Administrative Law ¹⁰¹⁹	land development ²⁰ financial ⁸⁵⁵ risk ²⁸⁹⁶ report ⁴⁵⁵¹
systeemkeuken.nl	Systeemkeuken	Systeemkeuken offers various modules such as prep, holding and cook modules.	Business → Industry ³⁶⁹⁷⁷	equipment ⁴¹⁴³ kitchen ⁶⁴⁴³
streamstage.nl	Connecting Media	The platform can be expanded with various modules such as chat, polls and quizzes.	Music → Streaming ¹⁷⁰ Event Resources → Online Events ⁶²	install ⁷⁷ livestream ⁴⁷⁸ graphic design ²⁰⁴²
pnowonen.nl	PNO Wonen	The company delivers prefabricated living modules, which are flexible and sustainable, and serve as building blocks for various housing forms.	Sustainable Living → Sustainable Housing ¹⁸⁷ Building & Construction → Sustainable Building ¹⁰⁰⁴	new construction ²⁶⁷² apartment ⁵⁰⁸⁸ sustainability ¹⁸⁴⁵¹	North-Holland → North-Holland North ¹⁰⁰
vrachtwagen-examen.nl	Vrachtwagen -Examen.nl	The website offers practice modules for the various stages of the driver's license, starting with module 1.	Technology & IT → Computer ¹⁷ Driver & Vehicle → Driver’s License ¹⁶²⁵	driver's license ¹²⁸³ truck ¹⁴¹² exam ²¹²⁰
levelzinzicht.nl	Level ZinZicht	The website offers various course modules focused on strategic development and business operations.	Networking & Collaboration → Starting a Business ²⁷⁴ Training → Online Training ³⁴³	passion ⁷⁹² strategy ⁹³⁷⁹ coach ²⁵⁸¹⁰
vitaliteitsbrouwerij.nl	Vitaliteitsbrouwerij	The various modules of the service are aimed at improving different aspects of employee wellbeing, such as nutrition, sports, and sleep.	Human Resources → Employee Development ⁷⁶²	vitality ¹⁷²⁶ employee ⁴⁴²⁹ package ⁶¹¹²
inosoft.nl	InoSoft	The website offers a range of independent modules, each with specific functionalities.	CRM → Customer Management ⁶⁰ Project Management → Time Tracking ⁸⁴	customer management ⁴³ time tracking ¹²⁶ calendar ¹⁵⁵⁶ employee ⁴⁴²⁹
minttech.nl	Mint BV	Mint BV supplies assembled modules, preventing clients from unexpected surprises.	Engineering → Mechanical Engineering ⁷³⁷ Manufacturing & Industrial → Mechanics ³⁹	mechatronics ⁴⁸ mechanic ²⁸² component ⁷¹⁴ electronics ⁹⁷¹	North-Brabant → Nuenen ca ⁹⁰⁶
digidap.nl	GMWconsult	Several modules have been added to the platform, including one for a practice lab.	Business Software → Document Management ³²⁸ Animals → Animal Welfare ¹³⁷²	farmer ⁶⁶¹ document ¹⁶⁷⁸ plan ²⁵⁶⁶ practice ⁹⁰⁸⁹
inburgeringa2.nl	Ad Appel Taaltrainingen	Course takers can choose from different modules, including Module 1 and Module 2, which focus on specific aspects of the language.	Language → Dutch ⁵⁶⁰ Social Services → Integration ⁴³⁸	video course ²² integration ¹⁴⁵¹ book ¹¹³⁹⁶ course ¹⁴⁷²⁸
mijn-in.nl	H. Prins	The website's content is organized into modules, each focused on a specific topic or skill.	Software Development & Engineering → Programming ⁵¹⁹ Curriculum & Resources → Educational Resources ⁴⁰¹	usability ⁵⁷ programming ⁵⁷⁵ database ¹¹⁵³ course ¹⁴⁷²⁸
medicallmanager.nl	MedicallManager	The software consists of various modules, such as document management and time recording.	Business Software → Administrative Software ¹⁵⁸ Software → Healthcare Software ¹⁷⁷	scheduling ²⁶¹ personnel ¹⁰⁸⁴ dashboard ¹³⁷⁴ software ⁸²⁹¹
watch-online.nl	MUSTHAVE webapplicaties	The WATCH hours recording module offers a structured way to manage hours recording.	Project Management → Time Tracking ⁸⁴	implementation ¹⁰²⁹ watch ¹¹⁶⁶ application ³³⁷⁷ video ⁶⁷¹⁴
oomwoneninhetbuitenland.nl	OOM Verzekeringen	Users can choose from various modules to tailor the policy to their needs, creating a fully customized package.	Insurance → International Insurance ¹³ Insurance → Auto Insurance ⁴³⁹	coverage ³⁴⁸ stay ⁷⁰² package ⁶¹¹² insurance ⁶³⁵⁹
changoediagnostics.nl	Changoe Diagnostics	Repairs of FEM/BDC modules are a key service.	Software Development & Engineering → Programming ⁵¹⁹ Medical Care & Services → Diagnostics & Testing ³⁴⁸	diagnostic equipment ³² option ²⁹² programming ⁵⁷⁵ diagnosis ¹⁴⁹⁰ repair ¹⁴⁵⁷⁶
event-dashboard.nl	Event Engineers	The website offers a range of modules, from electricity measurement to traffic monitoring.	Energy → Energy Management ⁵⁰⁴ Energy → Gas ¹⁰⁹	electricity ⁷⁴⁵ water ²⁵⁰¹ data ⁵⁸⁷² event ⁴⁵¹⁹⁹
inkoopperspectief.nl	InkoopPerspectief	The website offers a variety of modules aimed at the development of purchasing professionals.	Construction & Maintenance → Procurement ⁵⁶⁷ Adult & Continuing Learning → Business Knowledge ¹⁰⁸	approach ⁹⁷¹ knowledge ³⁵²⁸ collaboration ¹⁶⁰³⁶
m-learn.nl	M-Learn	The modules are directly applicable and always available, making the learning experience easier.	Training → Corporate Training ¹³³¹ Technology & IT → Digital Learning ¹⁶	mobile ²⁴³ work ³¹²² results ³⁹⁵⁴ employee ⁴⁴²⁹ training ²⁸¹³³	North-Holland → Amsterdam ⁴¹²⁵³
powerxsports.nl	PowerX Marketing	The website offers the ability to create a personalized marketing module, tailored to the specific needs of the gym.	Online Marketing → Lead Generation ⁶⁷⁸ E-Commerce → E-Commerce Platforms ⁴¹⁰	revenue ⁶⁹³ gym ⁶⁹⁹ growth ⁴⁰⁵⁴ marketing ⁷¹⁰⁷ member ¹⁰¹⁵⁴
rappclean.nl	FrisBEE BV	The RappClean app can be expanded with various modules, such as an order module for cleaning supplies.	Enterprise Solutions → Business Software ⁶¹⁵⁶ Project Management → Time Tracking ⁸⁴	kilometer ⁷⁴ hour ³⁶⁵ app ⁴⁵⁹⁵	Zeeland → Vlissingen ¹⁶¹⁴
stellablokpoel.nl	Stella Blokpoel Blended Learning	She specializes in creating interactive e-learning modules, often utilizing tools like Articulate Storyline.	Online Courses → E-Learning ⁶⁰⁶ Technology & IT → Educational Technology ³⁸⁰	learning ⁹²⁰
zijferz.nl	Zijferz Financiele Opleidingen	The website describes various modules that are part of the offered courses, with a start date.	Online Courses → Financial Education ¹⁶² Adult & Continuing Learning → Professional Training ¹²²⁴	financial education ¹¹ job guarantee ¹⁴ certificate ¹⁰³⁶ provider ¹¹¹¹ course ¹⁴⁷²⁸
nvlfcursuskkb.nl	NVLF	Each module of the e-learning addresses a specific aspect of quality circle facilitation, such as the Quality Circle.	Online Courses → E-Learning ⁶⁰⁶ Online Courses → Learning Platforms ¹⁰⁶	circle ²³⁵ e-learning ⁵⁸⁰ test ⁷⁶⁹ theory ⁹⁵⁶
growwithvideoacademy.nl	Grow with video academy	The academy consists of 8 modules that cover various aspects of video marketing.	Primary Education → Educational Materials ⁷¹¹ Online Courses → E-Learning ⁶⁰⁶	workbook ¹⁵⁴ question ²²⁶¹ video ⁶⁷¹⁴
ontdektaiwan.nl	Discover Taiwan	The website offers loose modules that can be combined with hotels to create a personalized trip.	TravelBrands → Tour Operators ³⁶³	taiwan ¹³ hotel ³⁵⁴³ travel ⁷²¹⁰
aretum.nl	Maarn Consult	The Practice Manager consists of six standard modules and offers optional modules that meet the specific needs of the practice.	Business Software → Management Software ¹⁴⁶ Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵	practice manager ¹⁵ clinic ¹⁰⁷⁹
oracle-consultant.nl	Marcel Koolwijk Consultancy B.V.	Marcel Koolwijk Consultancy is specialized in implementing the logistics Oracle E-Business Suite modules.	Business Software → ERP Systems ¹⁰⁰⁷ Logistics → Supply Chain ⁷⁹¹	oracle ⁹⁷ implementation ¹⁰²⁹ consultancy ²⁵⁹⁶ logistics ³²⁵⁷
joomlaupdaten.nl	Zegenrijk	Modules are small programs that add functionality to a Joomla website. Zegenrijk ensures that these modules are up-to-date.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	plugins ¹²³ update ¹⁶³ joomla ¹⁷¹ component ⁷¹⁴	Sint-Michielsgestel → Gemonde ⁸⁵
wftsamengevat.nl	WFT Samengevat	The WFT modules are the individual learning paths offered by the website, such as WFT Basic, WFT Care, or WFT Private Damage.	Online Courses → Financial Education ¹⁶² Testing → Exams ¹⁰⁸	syllabus ¹⁴ wft ²⁴ e-learning ⁵⁸⁰ exam ²¹²⁰
walkabouttribe.nl	Walkabout Tribe	The website provides a series of modules that address various aspects of life and well-being.	Spirituality → Spiritual Development ²⁷⁸	circle ²³⁵ academy ⁵⁹³ profile ¹⁹⁶⁵
verpleegkundemodules.bsl.nl	BSL Media & Learning	The website offers a diverse range of modules to help students learn the required skills.	Online Courses → E-Learning ⁶⁰⁶ Education → Pedagogy & Methods ²⁹⁴⁴	learning platform ³⁴ e-learning ⁵⁸⁰ skills ¹¹⁰⁵ student ⁷⁶²³
helenespork.nl	Get in Place BV	The five modules are designed to identify and tackle specific problems.	Family Activities → Day Trips ⁴¹⁹ Education → Pedagogy & Methods ²⁹⁴⁴	problem ²²¹⁴	Friesland → Terschelling ¹⁰³⁴
swimsys.nl	Swimsys	The system offers a range of modules that automate various processes, such as registration, payments, and scheduling.	Administration & Maintenance → Administration Software ¹² Swimming → Swimming Lessons ²⁷⁶	tester ³¹ swimming school ⁶⁵ swimming lesson ³⁹³
koosvanos.nl	Ginolica	The website offers various modules, such as advertising systems and gallery modules.	Web Development → Content Management Systems ⁵⁰²		North-Holland → Haarlem ⁸⁶⁷⁴
ai-skillslab.nl	AI Skillslabs	The organization provides SCORM and xAPI-compatible training modules for internal training programs.	Training → Corporate Training ¹³³¹ Software Development & Engineering → Artificial Intelligence (AI) ¹⁴²	prompt ⁴⁶ speaker ¹⁴⁸¹ ai ²¹⁸¹ workshop ¹⁹³²⁵
pp-h.nl	Psychologiepraktijk Heijnen	The treatment is structured into various interconnected modules, suggesting a structured and individualized approach.	Software → Medical Software ¹⁷ Medical Care & Services → Diagnostics & Testing ³⁴⁸	diagnostics ⁶⁸⁷ psychotherapy ⁹¹¹ therapy ⁷⁴⁴⁸	Netherlands → Limburg ³¹⁹⁰⁹
addsite.nl	AddSite	The website offers various modules, such as a news and vacancy module.	Online Marketing → Email Marketing ²⁴⁸ Web Development → Content Management Systems ⁵⁰²	cms ⁶¹³ e-commerce ⁷³⁸ webshop ⁸⁶⁴⁸	Heerenveen → De Zanden ²⁹
corpio.nl	Netbasics B.V.	Corpio’s various modules work seamlessly together and offer diverse functionalities.	Management → Process Management ³⁰¹ Management → Quality Management ⁹⁰⁹	quality management ¹⁶⁹ automation ²⁶⁸² software ⁸²⁹¹
1tis.nl	1TIS	The website lists various modules of their software, such as CRM, Booking, and Invoicing.	Business Software → CRM ⁷⁶⁴	bookings ⁵²³ travel ⁷²¹⁰ software ⁸²⁹¹
plechtigheidonline.nl	Plechtigheid Online	The website is based on modules such as music, photos and videos, which integrate into the crematorium's website.	Artificial Intelligence → Applications ⁵²⁷ Medical Care & Services → Palliative & End-Of-Life Care ¹⁶⁶⁹	bereaved families ⁸² funeral director ¹⁵⁰ scheduling ²⁶¹ farewell ¹¹⁰⁹
maakum.nl	Maakum	Maakum websites are extensible with various modules, such as a news module or survey module.	Web Design → Website Builders ⁸⁸⁸ Web Development → Content Management Systems ⁵⁰²	responsive ¹³² domain name ¹²⁰³ hosting ³¹²⁵ package ⁶¹¹²
iasset.nl	iASSET	The system uses a modular design, allowing users to select and deploy individual modules.	Investing → Asset Management ³¹⁸ Urban Planning → Public Space ¹⁸⁸	object ²⁷⁰ asset ⁵⁹¹ inspection ⁴²⁷⁹ data ⁵⁸⁷²	Netherlands → Zeeland ¹⁵⁴⁹³
itv-hogeschool.nl	ITV Hogeschool	The programs consist of different modules and assessments.	Communication → Interpreting ²⁶⁵ Career → Career Development ¹⁰⁷⁰	translator ¹⁶⁹ interpreter ²¹⁷ technology ⁶⁸¹⁶ communication ¹⁰¹⁶²
skorez.nl	Skorez	Nine different modules provide functionality for CRM, email marketing, website management, and more.	Business Software → Marketing Software ⁹⁰ Web Design → Website Builders ⁸⁸⁸	crm ⁵⁹¹ campaign ³⁴²⁸ report ⁴⁵⁵¹
vakwijs.nl	Vakwijs	The modules are self-managed and can be started flexibly.	Adult & Continuing Learning → Professional Training ¹²²⁴ Vocational Training → MBO ⁶⁹⁰	installation technology ²²³ electrical engineering ⁸¹⁷ education ¹³⁴⁷¹ training ²⁸¹³³
dasystems.nl	DAS Registration System	The registration system consists of various modules with functionalities for pathways, activities, and reporting.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸ Software Development & Engineering → Software ¹¹⁶⁰⁸	registration system ¹⁹ social work ¹⁰² pathway ⁴⁴⁷ report ⁴⁵⁵¹
bron-it.nl	Jump Academy	The website provides short and impactful modules for individual training.	Online Courses → E-Learning ⁶⁰⁶ Adult & Continuing Learning → Professional Development ²⁰⁸⁰	path ⁴⁶⁶ subscription ³²⁸⁷
pafin.nl	Pafin	The software is modular, allowing users to select the desired functionality.	Business Software → SMB Software ¹² Business Software → ERP Systems ¹⁰⁰⁷	invoice ⁷⁹⁵ administration ⁶⁵⁸⁷ software ⁸²⁹¹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vrowl.nl	VR Owl	VR Owl's solutions are based on a modular design, providing flexibility and adaptability to specific needs.	Industrial → Industrial Automation ¹⁰⁴² Virtual & Augmented Reality → Virtual Reality ³⁶¹	ar ⁵⁷ onboarding ⁷⁸ vr ²⁴⁹ recruitment ²⁰¹⁵ training ²⁸¹³³
meneerpoulus.nl	MeneerPoulus.nl	The website offers different learning modules for various subjects.	Primary Education → Educational Materials ⁷¹¹ Technology & IT → Educational Tools ³²	syllabus ¹⁴ grade level ¹⁷ physics ⁹³ exam ²¹²⁰	Eindhoven → Woensel-Zuid ⁶⁴
e-commercecompany.nl	Online Solutions B.V.	The website offers the possibility to add various modules to the website or webshop.	Themes → WordPress Themes ¹⁴⁵ Web Design → Website Builders ⁸⁸⁸	online marketing ¹⁰⁸⁵ subscription ³²⁸⁷ webshop ⁸⁶⁴⁸
order-direct.nl	Order-Direct	The software is built upon several modules, which can be selected individually.	Business Software → SMB Software ¹² Business Software → ERP Systems ¹⁰⁰⁷	inventory management ¹³⁸ erp ³⁶³ crm ⁵⁹¹ connection ⁴⁰⁰⁷ software ⁸²⁹¹
derisicoach.nl	Word Risicoach!	The training is divided into four modules, each with different learning activities.	Research & Academia → Educational Development ³⁵⁴ Education → Pedagogy & Methods ²⁹⁴⁴	toolkit ¹⁵⁷
kinderwijstv.nl	Kinderwijs TV	Kinderwijs TV offers a wide range of online modules that childcare professionals can take.	Online Courses → E-Learning ⁶⁰⁶ Technical Services → Technical ⁹⁵⁷	e learning ⁵² learning path ⁷⁸ professionals ¹⁹⁶⁶ community ⁷⁹³¹ course ¹⁴⁷²⁸
gripwerkt.nl	GRIP	GRIP offers 50 modules, focused on improving psychological fitness.	Human Resources → Employee Development ⁷⁶² Human Resources → Absence Management ⁸⁵⁰	grip ¹⁰⁷ scan ⁷⁹⁰ energy ⁹⁰⁷⁵ collaboration ¹⁶⁰³⁶ coach ²⁵⁸¹⁰
mibida.nl	MiBida	The system has over 50 functional modules that can be used to shape care pathways.	Software → Healthcare Software ¹⁷⁷ Online Services → E-Health ⁶⁹	care pathway ³³ patient ⁴⁰⁸² research ⁸⁹⁶⁷
bijkeukenkastvoorjou.nl	Bijkeukenkastvoorjou.nl	Customers can add different modules, such as sinks, to their cabinet design.	Storage → Cabinets ⁶¹² Kitchen → Kitchen Furniture ⁵⁹	kitchen cabinet ²⁹ configurator ²³⁴ storage space ³⁸⁸ color ⁴¹⁵⁹
sep.nl	SEP	SEP offers modules such as SEPflix focused on various skills.	Online Courses → E-Learning ⁶⁰⁶ Government & Administration → Digital Government ⁸⁶	civil servant ³² e-learning ⁵⁸⁰ case ¹¹⁵³ training ²⁸¹³³
mamble.nl	Mamble Easy Web	Individual modules, such as news and photo albums, can be added to expand the website’s functionality.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	cms ⁶¹³ layout ⁸⁹⁹ package ⁶¹¹²
rambo-cms.nl	Rambo-CMS	The website offers various modules, such as a newsletter module and an RSS feed.	Software Development & Engineering → Content Management Systems ¹⁷ Technology → SMB ¹²⁷	php ²⁸² cms ⁶¹³ news ¹⁵²⁹³	Limburg → Echt-Susteren ⁸⁷⁴
farmacieopleidingen.nl	Farmacie Opleidingen	A specialization module is an e-learning with practical exercises that provides participants with extra depth in a specific research area.	Online Courses → E-Learning ⁶⁰⁶ Pharmaceuticals & Medical Products → Pharmacies ¹⁰²⁹	app ⁴⁵⁹⁵ course ¹⁴⁷²⁸ training ²⁸¹³³	Netherlands → Utrecht ⁴⁸⁹⁰¹
logboekenonline.nl	LogboekenOnline	The website offers various modules, such as Legionella Management and Emergency Lighting, to address specific needs.	Law → Environmental Legislation ⁹⁹ Energy → Energy Management ⁵⁰⁴	logbook ⁷⁹ installation ¹³⁷⁴²
tinytags.nl	TinyTags	The company has developed a complete set of modules, which are supported by a user-friendly platform.	Navigation → GPS ⁷⁷ Rental Services → Fleet Management ²⁵⁷	track and trace ²⁴ gps tracker ⁴⁴ tracker ⁵⁹ fleet management ⁹³ app ⁴⁵⁹⁵
brightle.nl	Brightle	Brightle offers both ready-made modules and custom-made modules for adding specific functionalities.	Internet → Forums & Communities ¹⁵⁹⁹ Artificial Intelligence → Applications ⁵²⁷	timeline ¹⁴⁹ branding ⁴⁶¹⁴ community ⁷⁹³¹
code95platform.nl	Code95Platform	The online modules are structured and contain various learning materials, such as reading, viewing and practice.	Transportation → Automotive Technology ³¹⁵	code95 ⁴⁵ refresher course ⁶⁴ training ²⁸¹³³
talt.nl	Vinum Re Nova BV	The test module and punch module are integral components, linking test questions and punches to a lean database.	Software Development & Engineering → App Development ¹⁰⁸⁴ Radio & Communication → Telecommunications ¹³⁶¹	documentation ⁴⁵² testing ⁴⁵⁶ software ⁸²⁹¹
dcs.nl	Digital Card Solutions B.V.	Services are offered in flexible modules, allowing clients to customize functionality according to their needs.	CRM → Customer Management ⁶⁰	demo ³²⁰ application ³³⁷⁷ consulting ³⁶³⁹	North-Holland → Amsterdam ⁴¹²⁵³
g-b-n.nl	Société des Avis Garantis	The module is installed and configured in just a few clicks via the backoffice of the website.	Websites → Comparison Sites ⁸⁶⁹ E-Commerce → E-Commerce Platforms ⁴¹⁰	retailer ³⁷³ reviews ³¹⁷² subscription ³²⁸⁷
kpmb.nl	Stichting KPMB	The website describes different modules within the pest control system.	Control → Pest Control ⁸²⁴ Business & Management → Certification ³⁶⁴	standard ¹⁵⁰ pest ³⁵⁴ certification ³³⁸⁰ environment ⁴⁸⁷³
verenigingnlt.nl	Vereniging NLT	The website provides certified modules that schools can use to create a program for the NLT subject.	Business & Management → Educational Management ³⁷⁵ Curriculum & Resources → Curriculum ¹⁵³	conference ⁷⁶³ teacher ²⁸⁹⁰ student ⁷⁶²³ membership ¹⁰⁴⁴²
become-it.nl	Suite MKB	Suite MKB offers over 60 different modules that businesses can select and configure.	Business Software → Accounting Software ⁹⁸⁴	business software ³¹ customer portal ¹⁴¹ domain name ¹²⁰³ integration ¹⁴⁵¹ account ⁵⁷⁸¹
leerjegroen.nl	VBNE	The content is divided into short, manageable e-learning modules.	Online Courses → E-Learning ⁶⁰⁶	natuurmonumenten ¹⁴ e-learning ⁵⁸⁰
ecodim.nl	EcoDim	EcoDim offers a wide range of dim modules	Lighting → LED Lighting ⁵⁷⁴	dimmers ³⁸ protocol ²³⁷ light ⁵¹⁴⁸	Gelderland → Doetinchem ²⁷⁰⁶
cierpa.nl	Cierpa Software	Cierpa Software provides various specific modules, such as Cierpa Kaizen, Cierpa OEE and Cierpa Quality, aimed at different aspects of process optimization.	Management → Process Management ³⁰¹	improvement ²⁸⁴ methodology ³³² software ⁸²⁹¹
vitris.nl	VITRIS Glassoftware	The software package can be expanded with various modules to support specific needs.	Business Software → Order Management ²² Technical Services → Glass Industry ¹⁴	price calculation ¹² quotation ²⁵³ production ⁴⁵⁸²
aviar.nl	Aviar	The platform boasts a large library of hyper-realistic, interactive training modules covering various procedures.	Air Services → Aviation ⁴⁴⁴ Software Development & Engineering → Software ¹¹⁶⁰⁸	vr ²⁴⁹ device ⁶⁹⁸ subscription ³²⁸⁷ safety ⁵⁸¹⁹ training ²⁸¹³³
taurussoft.nl	TaurusSoft B.V.	TaurusSoft provides a range of modules including order, transport, and warehouse management.	Data Analysis → Business Intelligence ¹⁰⁰² Technology → Software Solutions ²¹⁵	software development ³⁵⁸ dashboard ¹³⁷⁴ collaboration ¹⁶⁰³⁶	Haarlemmermeer → Schiphol-Rijk ⁷²
vakcommunitylevenlangontwikkelen.nl	Vakcommunity Leven Lang Ontwikkelen	The website contains various online modules designed to cover specific knowledge areas.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰	agenda ⁴³⁷⁴ community ⁷⁹³¹ news ¹⁵²⁹³
gildesoftware.nl	Gilde Software	Various modules are available, such as invoicing, logistics, and project administration, to support the company’s specific needs.	Business Software → ERP Systems ¹⁰⁰⁷ Management → Business Optimization ¹⁹⁵	cloud ¹⁵²⁷ account ⁵⁷⁸¹
secureatwork.nl	N/A	The website presents various modules, such as the 'Golden Tenant', which form the basis of their services.	Business Software → Productivity Tools ⁴¹⁶ Software → Productivity & Office ¹²⁰³	tenant ⁹²⁰ automation ²⁶⁸² security ⁶⁶⁵⁵
acq.nl	AcQ International	AcQ’s offerings include a range of standards-based modules used in various industries.	Computer Science → Embedded Systems ¹⁴¹ Robotics & Automation → Aerospace ⁶³	prototype ⁶⁰³ electronics ⁹⁷¹ application ³³⁷⁷ design ²⁷²⁰²
prototypeshop.nl	PrototypeShop	Various electronic modules are available, such as ESP-01 ESP8266 WiFi modules.	Technology → Hardware ¹⁵ Electronics & Components → Arduino ¹⁹	arduino ¹²³ 3d printing ³³² home automation ³⁷⁶ sensor ⁴⁸² board ³⁴³⁸
melba.nl	Melba	Melba offers various modules, including the MELBA SL module and the IDA, used to analyze work behavior.	Employment & Labor → Labor Market ⁵⁸⁰ Vocational Training → Technical Education ²¹⁵	employment opportunities ¹³ job ²⁷⁹⁵ course ¹⁴⁷²⁸
wft-premium.nl	Financiële Instellingen BV	Users can access various Wft modules for training and study.	Nonprofits → International Development ⁴²⁰	wft ²⁴ institution ²⁴⁵ loan ⁸³² supervision ¹¹⁸⁴ exam ²¹²⁰
webshophettalentenlab.nl	Het TalentenLab en De Positieve School	Modules last 3 hours and cost €930, while a training day (6 hours) costs €1860.	Support → School Support ¹⁷¹ Driver & Vehicle → Continuing Education ⁴⁵⁴	mindset ⁷⁸² workshop ¹⁹³²⁵ training ²⁸¹³³	North-Brabant → Breda ⁹⁰⁰³
plegan.nl	Stichting Plegan	The website provides details on specific modules within the courses, such as the youth health care module.	Nursing & Support → Nursing ⁵³⁶	anthroposophy ⁹² nursing ³⁷⁵ care ¹²³³⁸ course ¹⁴⁷²⁸ training ²⁸¹³³
lic.nl	L.I.C. Software Development B.V.	The software is built on a variety of modules, each focused on a specific process.	Business Software → ERP Systems ¹⁰⁰⁷ Building & Materials → Concrete ³⁹⁰	3d ¹³¹ calculation ⁶⁵⁷ report ⁴⁵⁵¹ production ⁴⁵⁸² administration ⁶⁵⁸⁷
muziekwenskaart.nl	VOF Basisidee	The audio module is a separate component that can be used for various purposes.	Retail Solutions → Merchandising ⁴⁵	audio ⁹³⁴ message ²²⁶⁰ design ²⁷²⁰²
douaneopleidingen.nl	Douaneopleidingen Nederland	The website provides a selection of modules that cover specific aspects of customs laws and regulations.	Freight & Shipments → Customs ¹²⁸ Education → Adult & Continuing Learning ⁶⁵¹⁰	course ¹⁴⁷²⁸
uslights.nl	USLights	The lights are installed using small modules that are mounted in the car.	Transportation → Automotive Technology ³¹⁵ Software Development & Engineering → Software ¹¹⁶⁰⁸	effect ¹⁵⁴ visibility ⁵⁹⁰ order ⁶⁹¹²
mkb-logic.nl	MKB-Logic	The platform offers various modules, such as invoicing, purchasing and project registration.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Financial Software ¹⁵¹	crm ⁵⁹¹ invoice ⁷⁹⁵ inventory ¹⁶¹³ report ⁴⁵⁵¹ account ⁵⁷⁸¹
businessinnovationprogramfood.nl	Business Innovation Program Food	The program is structured into five modules, each focused on a specific aspect of business development.	Business Strategy → Business Development ⁷³⁰ Management → Process Management ³⁰¹	business case ⁷⁹ objective ⁴¹⁵ idea ²³⁶⁷ coach ²⁵⁸¹⁰
digi-process.nl	N.V. SoftwareBedrijf	The website offers diverse software modules that work together.	Business Software → Office Software ⁵⁵	growth ⁴⁰⁵⁴ software ⁸²⁹¹
flairscholing.nl	Flair Scholing	The courses consist of several modules, including triage, medical technical skills and computer skills.	Vocational Training → MBO ⁶⁹⁰ Driver & Vehicle → Continuing Education ⁴⁵⁴	learning process ⁸⁹ internship ⁶⁹⁴ course ¹⁴⁷²⁸	Hoogeveen → Fluitenberg ³⁷
apktoets.nl	Elearn-Academy	The online training courses are divided into clear modules.	Business Strategy → Business Development ⁷³⁰ Transportation → Automotive Technology ³¹⁵	workbook ¹⁵⁴ exam ²¹²⁰ training ²⁸¹³³	Westland → 's-Gravenzande ⁵⁹⁹
epass-online.nl	Epass-Online	The system can be expanded with various modules, such as a cash register system and a sports tracker system.	Business Software → Membership Management ¹⁵	cash register ⁷⁰ member ¹⁰¹⁵⁴ membership ¹⁰⁴⁴²
curavista.nl	Curavista	Curavista.health offers medical monitoring for 80 care pathways through a variety of modules that support patient engagement and self-management.	Software → Medical Software ¹⁷ Medical Care & Services → Digital & Telehealth ⁷⁹⁹	monitor ¹⁰⁶³ dashboard ¹³⁷⁴ patient ⁴⁰⁸² data ⁵⁸⁷²	South-Holland → Rotterdam ²⁵⁰⁴⁸
reducept.nl	Reducept	Reducept offers two specialized modules: Reducept Education and the Reducept Method.	Physical Therapy → Pain Therapy ⁹³⁶ Virtual & Augmented Reality → Virtual Reality ³⁶¹	educator ¹¹⁴ vr ²⁴⁹ pain ¹⁹¹⁹ research ⁸⁹⁶⁷ education ¹³⁴⁷¹
vdlindustrialmodules.nl	VDL Industrial Modules	VDL Industrial Modules develops and produces high-quality mechatronic modules.	Industrial Equipment & Services → Machine Building ⁶⁶⁵ Logistics → Supply Chain ⁷⁹¹	machine ³⁷²⁷ production ⁴⁵⁸²
martijnackermans.nl	Vakatelier	The courses are divided into modules to structure the learning material clearly.	Painting → Decorative Painting ⁶⁰ Arts → Decorative Arts & Crafts ⁸²⁵	wood imitation ¹¹ lime ³⁹ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵
dicocarwash.nl	DICO Carwash BV	The website offers various individual modules, such as sprayers and brushes, for the customization of wash systems.	Tools & Equipment → Cleaning Equipment ¹⁹⁴ Road Services → Automotive ¹⁸⁷⁶⁴	project guidance ²⁶ youtube channel ³⁵ cash system ⁶⁹	Gelderland → Nijmegen ⁹³⁸⁴
fred.nl	Sitewise Webmedia B.V.	Fred consists of different modules that customers can select and customize the system to meet their specific needs.	Business Software → Management Software ¹⁴⁶ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	client portal ³⁰ document ¹⁶⁷⁸ relationship ⁴²⁰⁵ account ⁵⁷⁸¹	Gelderland → Nijmegen ⁹³⁸⁴
emlicht.nl	EM Licht B.V.	LED modules are offered for various applications and brands.	Lighting → Industrial Lighting ⁴⁰ Lighting → LED Lighting ⁵⁷⁴	street lighting ¹⁴ emergency lighting ¹⁷⁶ lead ¹¹⁹⁵ battery ¹⁷⁵¹ light ⁵¹⁴⁸
stichtingsquare.nl	Stichting sQuare	The organization develops modular offerings that are centered around practical work experience and 21st-century skills.	Vocational Training → MBO ⁶⁹⁰ Business & Management → Educational Foundations ⁵⁴	square ⁸⁷ cooperation ⁴³³ innovation ⁴⁶⁵⁹
doodgewoonbespreekbaar.nl	STEM Foundation	The STEM offering is built around various modules that align with each other.	Adult & Continuing Learning → Professional Training ¹²²⁴ Medical Care & Services → Palliative & End-Of-Life Care ¹⁶⁶⁹	stem ⁴³ trajectory ⁵⁵⁶ caregiver ¹¹⁶⁷ awareness ¹⁷³⁵ connection ⁴⁰⁰⁷
blendingforces.nl	Blending Forces	The company offers various individual modules that can be combined to create a customized program.	Business Software → HR Software ⁶⁴⁹ Human Resources → Employee Engagement ¹³³	engagement ²³⁹ change management ⁵³¹ collaboration ¹⁶⁰³⁶
c-trak.nl	C-TRAK	The system consists of various modules, varying in shape and function.	Model Building → Model Railroading ²⁷³	model railroad ³¹ track ⁴¹⁶ layout ⁸⁹⁹
human-error.nl	Human Error Rotterdam	Specifically Eurorack modules, a popular modular synthesizer, are also repaired.	Music → Instrument ²⁸⁵⁰ Building & Construction → DIY ¹⁰⁰⁷	synthesizer ⁶⁷ assessment ¹²⁰⁵ instrument ¹²⁹⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
vermobv.nl	Vermo B.V.	Vermo B.V. offers complete assemblies/modules, including manufacturing, procurement, assembly and logistics.	Manufacturing → Industrial Manufacturing ¹⁵⁰ Wood & Furniture → Manufacturers ¹⁵⁵	component ⁷¹⁴ machine ³⁷²⁷ relationship ⁴²⁰⁵ production ⁴⁵⁸²	North-Brabant → Eindhoven ¹¹⁸⁴⁵
loonstraorgelverhuur.nl	Loonstra Orgelverhuur	The Hauptwerk and Sweelinq modules provide access to unique sounds from famous organs throughout Europe.	Instrument → Organ Building ⁴⁵ Property Rentals → Rental ¹¹⁶⁹	organ ⁶³³ speaker ¹⁴⁸¹ concert ⁴⁴⁰⁹ transport ⁶¹⁰⁵ event ⁴⁵¹⁹⁹	Rijssen-Holten → Rijssen ¹⁰⁴⁸
centrumvoorarbeidsmarktinnovatie.nl	Centre for Labour Market Innovation	The course consists of six modules covering various aspects of work.	Economy & Finance → Economics ¹¹¹⁵ Training → Corporate Training ¹³³¹	agility ¹⁷⁰ stakeholder ⁴³¹ course ¹⁴⁷²⁸	Utrecht Hill Ridge → Doorn ⁶¹⁵
thuisleefgroep.nl	Thuisleefgroep	The platform contains various modules that promote the independence of citizens.	Healthcare & Medical → Healthcare Technology ¹⁹¹ Online & Digital → Digital Services ¹⁰⁰⁸	citizen ¹⁸⁴ dashboard ¹³⁷⁴ software ⁸²⁹¹
raadvoor2026.nl	Raad voor 2026	The website is structured around modules that address specific aspects of the election preparation.	Local Politics → Municipal Elections ⁸⁸	election program ⁸⁵ tips ²⁷⁸⁹	Netherlands → Gelderland ⁶⁷⁰¹⁵
taijitao.nl	Taiji Tao & Qigong Opleidingen	The website offers various deepening modules and workshops, focusing on deepening knowledge and skills in Taiji-Qigong.	Training → Spiritual Training ⁵⁰	shop ⁶⁴⁸³ newsletter ⁶⁵⁰⁴ course ¹⁴⁷²⁸
emplus.nl	EMplus	EMplus offers specialized modules aimed at providing focused training in Emergency Medicine.	Driver & Vehicle → Continuing Education ⁴⁵⁴ Research & Academia → Medical Education ¹⁸³	course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰ training ²⁸¹³³
santec.nl	Santec System Services	The modular server consists of several functionally separate modules that are completely automatically managed.	IT → System Administration ⁶¹⁰ Technology → IT Solutions ³¹¹	automatic ⁹⁴ mail ¹⁴⁹ server ¹⁰³⁶ storage ²⁴⁴⁶ security ⁶⁶⁵⁵
lpacademy.nl	Language Partners Academy	The website provides both full courses and individual OPT modules, allowing learners to study flexibly.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Adult & Continuing Learning → Professional Training ¹²²⁴	language level ¹⁵ curriculum ²⁷⁷ masterclass ⁴¹⁹ trainer ¹⁹⁶⁶ training ²⁸¹³³
guitarinstitute.nl	Guitar Institute Nederland	The website utilizes modules to structure and individualize the learning process.	Instrument → Guitar ⁵⁷⁶ Music Education → Private Lessons ¹⁵⁶	guitar lesson ³⁰⁶ guitar ¹⁰⁹¹	Leidschendam-Voorburg → Voorburg ¹²³⁴
swiss-color.nl	Swiss Color Netherlands	The website sells hygiene modules and machines specifically designed for the permanent makeup industry.	Eyelash Services → Eyebrows ⁷⁷⁷ Professional Training → Beauty Training ¹⁷⁴	cartridge ¹²⁹ pigment ¹⁴² machine ³⁷²⁷ training ²⁸¹³³
gbor.nl	Groenestein Beheersoftware	The website describes various modules that cover different aspects of public space management.	Applications → Municipal Software ¹³ Urban Planning → Public Space ¹⁸⁸	public space ¹³⁷ road ¹⁹⁰ software ⁸²⁹¹
sandvalley.nl	Sandvalley Training	Each course is divided into modules that students can discuss individually with their study coach.	Vocational Training → MBO ⁶⁹⁰	study coach ¹⁴ study material ²⁵ e-learning ⁵⁸⁰ course ¹⁴⁷²⁸
brabant-engineering.nl	Brabant Engineering	The website describes the development of client-specific mechanical engineering modules.	Engineering → Mechanical Engineering ⁷³⁷ Design & Creative → Business Functions ²¹¹	automation ²⁶⁸² tool ³⁹⁰⁷	Netherlands → North-Brabant ⁷³³⁴¹
leefstijlcoachacademy.nl	LeefstijlCoach Academy	The program is divided into four modules that cover all aspects of lifestyle coaching.	Vocational & Training → Post-HBO Programs ²⁶ Nutrition → Dietetics ⁸¹⁶	lifestyle coach ¹⁹³ professionals ¹⁹⁶⁶
beefeaterbarbecues.nl	BeefEater Benelux	BeefEater is a pioneer in the development of outdoor kitchen modules, complete with functionalities.	Outdoor → Barbecues ⁷⁴⁴	outdoor kitchen ¹³¹ spare parts ¹⁵³ barbecue ¹¹⁷⁵
sustainq.nl	SustainQ	SustainQ offers a calculation module that can calculate multiple energy and heat solution techniques simultaneously.	Energy → Energy Saving ¹¹⁵¹	savings ⁴⁵⁷ calculation ⁶⁵⁷ energy ⁹⁰⁷⁵
cxone.nl	NICE	The CXone solution consists of various modules that can be added flexibly, tailored to the organization’s needs.	Business Software → CRM ⁷⁶⁴ Online Services & Platforms → SaaS ¹⁷¹
flexlivings.nl	Flexlivings	Modules form the basis of the Flexlivings housing concept and can be flexibly coupled and configured.	Sustainable Living → Sustainable Housing ¹⁸⁷ Business Services → Collaboration ⁴⁰⁹	dwelling ¹¹⁸ target group ⁵⁷⁸ collaboration ¹⁶⁰³⁶ design ²⁷²⁰²
quipu.nl	QOSQO	The platform utilizes reusable modules to streamline data management processes and solution generation.	Information Technology → Data Management ⁸²⁷	data migration ²⁹ datawarehouse ⁷⁴ automation ²⁶⁸²
sustainabilitycareerguide.nl	Sustainable Talent	The website is structured around three modules that form the foundation of the training.	Human Resources → Talent Management ⁵³⁷ Education → Career & Guidance ¹¹⁵⁷	network ¹¹¹²³ sustainability ¹⁸⁴⁵¹ coach ²⁵⁸¹⁰
oursolutions.nl	OUR Solutions	The software is equipped with modules that can be activated as needed, allowing users to only use the required functionality.	Business Software → Retail Software ⁵⁶	software ⁸²⁹¹	Gelderland → Brummen ⁷⁸⁹
dmtmodular.nl	DMT Modular	The website features various modules, including Stacked-house Modules and PMC modules, demonstrating the company's product range.	Project Management → Construction Management ¹⁰³⁸ Construction → Building Systems & Services ⁵⁵⁹	modular construction ²⁶ residential ²¹⁶ hospitality ³⁴⁹¹ construction ⁷⁴²¹ sustainability ¹⁸⁴⁵¹
hvbelo.nl	Vidc	The program utilizes a modular structure, allowing participants to tailor their learning experience to their specific needs and interests.	Social Issues → Participation ¹⁰²³ Professional Development → Training Programs ¹²⁹	inclusion ³⁶⁰ diversity ⁴⁹² sport ⁴²²⁸ training ²⁸¹³³
werkenaankennisenvakmanschap.nl	Netherlands Frituriers Centre	The platform offers various e-learning modules, which can be used directly after ordering.	Vocational Training → MBO Education ²⁴	membership ¹⁰⁴⁴² course ¹⁴⁷²⁸	North-Brabant → Veldhoven ¹⁴⁸⁵
crossingpoint.nl	Crossing Point	Modules are available to help Christians grow stronger in life.	Nonprofits → International Development ⁴²⁰	purpose ¹²⁵ identity ¹⁰²⁸ agenda ⁴³⁷⁴ care ¹²³³⁸ training ²⁸¹³³	North-Brabant → Eindhoven ¹¹⁸⁴⁵
aspen-chiptuning.nl	Aspen Chiptuning	Aspen Chiptuning supplies external chip tuning modules.	Automotive → Vehicle Modification & Tuning ¹⁰⁷ Automotive Maintenance → Chiptuning ²²⁹	fuel consumption ³⁴ ecu ⁵⁹ chiptuning ²⁶⁴ car ¹⁰⁸⁶⁵	Westerwolde → Vlagtwedde ¹⁵¹
mijndataomgeving.nl	Libelnet	The website offers diverse software modules that can be integrated to automate business processes.	Enterprise Solutions → Business Systems ⁹¹ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	email marketing ²¹⁰ guest ¹³³⁴ automation ²⁶⁸² book ¹¹³⁹⁶
vedapulse.nl	VedaPulse	The system consists of individual modules that can be chosen separately.	Business Software → Online Tools ³⁹⁶ Medical Care & Services → Diagnostics & Testing ³⁴⁸	heart rate ²⁹ database ¹¹⁵³ diagnosis ¹⁴⁹⁰ treatment ²¹²⁰³
loopbaanenburgerschap.nl	Uitgeverij Eisma Edumedia	The website offers supplementary exercises and assignments for various modules within the ROUTE methodology.	Vocational Training → Secondary Vocational Education ¹⁸⁴ Education → Career & Guidance ¹¹⁵⁷	publisher ⁷⁵⁷ exercises ¹⁰⁵⁸ route ³⁴²⁵
deloopbaanacademie.nl	The Loopbaan Academie	The courses are divided into clear modules with video instructions and practical exercises.	Career → Career Development ¹⁰⁷⁰	exercise ⁷⁰⁶ tips ²⁷⁸⁹ network ¹¹¹²³ course ¹⁴⁷²⁸ training ²⁸¹³³
taojaartraining.nl	Tao Jaartraining	The year program is divided into four online modules, allowing participants to follow the program at their own pace.	Spirituality → Spiritual Development ²⁷⁸ Workshops → Personal Growth ⁷⁷	tao ³⁵ weekend ³⁸³ participant ¹⁹³⁴
dmwebsites.nl	dmwebsites	The various modules offered enable customers to add extra functionalities to their website.	Web Development → Content Management Systems ⁵⁰²	functionality ⁴¹⁷ cms ⁶¹³	Gelderland → Doetinchem ²⁷⁰⁶
breinzorg.nl	BreinZorg	The website offers various modules with information and advice.	Neurology → Dementia ⁵⁰⁹	dementia ⁶⁷⁴ question ²²⁶¹ lifestyle ²⁹¹⁸ research ⁸⁹⁶⁷
ontwerpdeverandering.nl	AO VVT	The e-learning program consists of seven modules that cover different aspects of change.	Coaching → Leadership Coaching ⁵⁵⁷ Online Courses → E-Learning ⁶⁰⁶	workbook ¹⁵⁴ change ²⁵⁸⁰
geldersehockeyvallei.nl	Gelderse Hockey Vallei	The sessions are offered in modules of approximately three months.	Sport Organization → Hockey ⁵⁵⁰ Youth Development → Youth Programs ¹⁰⁹	fun ²⁴¹ hockey ³⁴⁸ participation ¹⁴³⁰ child ¹¹⁵⁶⁶ training ²⁸¹³³	Overbetuwe → Heteren ²³⁶
leren-masseren.nl	OMB Academy	The courses are divided into modules focused on different body parts, such as the back, shoulders, legs, and feet.	Alternative Medicine → Complementary Therapies ⁸⁵⁸ Driver & Vehicle → Continuing Education ⁴⁵⁴	academy ⁵⁹³ massage ⁷⁶⁴⁶ practice ⁹⁰⁸⁹ course ¹⁴⁷²⁸ training ²⁸¹³³
paardencoachacademie.nl	Centrum voor Paardencoaching	The website provides access to various online learning modules.	Online Marketing → Email Marketing ²⁴⁸ Coaching → Horse Coaching ³³⁹	online academy ²⁰ horse coaching ¹²⁹ email address ¹⁴² course ¹⁴⁷²⁸
bbbmasterclass.nl	BBB Masterclass	Each module of the Masterclass focuses on a specific theme, such as self-leadership, chain management, or innovation, and offers a combination of theory and practice.	Project Management → Construction Management ¹⁰³⁸ Health → Pregnancy & Childbirth ⁴²²²	masterclass ⁴¹⁹ innovation ⁴⁶⁵⁹
yarbonederland.nl	V van Vijfeijken Mechanisatie	The Yarbo is based on a modular design, allowing users to choose specific functionalities.	Gardening → Garden Machinery ³¹⁶ Technology → Robotics & Automation ⁸⁶⁰	robot lawnmower ³⁴ garden ¹³¹²⁹
conventus.nl	Conventus	Conventus consists of several intelligent modules that work together to increase efficiency.	Business Software → ERP Systems ¹⁰⁰⁷ Assembly & Production → Assembly ²²⁷	scheduling ²⁶¹ inventory ¹⁶¹³ assembly ¹⁷³³ report ⁴⁵⁵¹ quote ¹²⁸⁶³
personeelsmanager.nl	PersoneelsManager	PersoneelsManager offers various modules specifically designed to automate different HR tasks.	Business Software → HR Software ⁶⁴⁹ Finance & Insurance → SMEs ⁴³³	personnel administration ³⁰ sme ⁴⁶⁶ hr ⁸⁸⁴
dolihelp.nl	Macrorom ICT-services	The software features a range of modules – CRM, HR, Products & Stocks, Finance, and Productivity – tailored to specific business requirements.	Business Software → ERP Systems ¹⁰⁰⁷	crm ⁵⁹¹ hosting ³¹²⁵ subscription ³²⁸⁷
pretect.nl	PRETECT Software Solutions	The software is built from various modules that can be individually selected.	Online Services & Platforms → SaaS ¹⁷¹ Applications → Business Applications ¹¹⁰	software package ⁶⁷ saas ¹³¹ safety ⁵⁸¹⁹ security ⁶⁶⁵⁵
kbwsoftware.nl	Ten Voorde	The software is available in different modules with various functionalities.	Business Software → CRM ⁷⁶⁴ E-Commerce → E-Commerce Platforms ⁴¹⁰	personalized gifts ¹² christmas package ²³ corporate gift ⁴²⁵ crm ⁵⁹¹ software ⁸²⁹¹
ipo-online.nl	IPO-online.nl	The website offers various IPO modules (Phase 1 & 2 or Phase 3 & 4) that serve as building blocks for completing the IPO.	Adult & Continuing Learning → Professional Training ¹²²⁴ Software Development & Engineering → Web Applications ¹⁰⁰⁵	ipo ¹⁰ paramedic ¹⁹ registration ⁴³⁶⁶
modulairebouwsystemen.nl	N.V. (implied)	The website focuses on the use of prefabricated modules produced in a controlled environment and assembled on-site.	Sustainable Construction → Circular Construction ⁸⁰	modular construction ²⁶ cost ¹⁹⁹⁰ construction ⁷⁴²¹ sustainability ¹⁸⁴⁵¹ design ²⁷²⁰²
editsite.nl	Editsite	Users can extend the website with various modules, such as an online store or a forum.	Web Design → Website Builders ⁸⁸⁸ Web Development → Content Management Systems ⁵⁰²	page ⁴²⁷ creativity ²⁵³¹ package ⁶¹¹²
financieringinbalans.nl	Management & Organization in Balance	The website offers various modules focusing on specific aspects of financing.	Secondary Education → VMBO ³³² Secondary Education → HAVO ⁸¹	legal form ⁶⁶ textbook ⁷³ finance ⁵³⁴¹
nutt.nl	Nutt	Nutt offers a wide range of modules designed to automate and optimize various processes within an organization.	Business Software → Productivity Tools ⁴¹⁶ Business Software → Workflow Management ⁶³	learning path ⁷⁸ scheduling ²⁶¹ collaboration ¹⁶⁰³⁶
uxit.nl	UXIT	The software consists of ready-made modules that can be easily added and adapted to a company's processes.	Business Software → Business Process Management ³³³	user experience ²³⁵ supply chain ⁴¹³ automation ²⁶⁸² software ⁸²⁹¹
mindlinkbenelux.nl	MindLINK Benelux	These modules are used in combination with the test method to provide individually appropriate solutions and unlock potential for improvement.	Mental & Emotional Well-Being → Addiction ⁴⁹³ Software Development & Engineering → Software ¹¹⁶⁰⁸	reconstruction ⁸⁹ testing ⁴⁵⁶ vitality ¹⁷²⁶ treatment ²¹²⁰³ coach ²⁵⁸¹⁰
c-mol.nl	C-MOL Nederland B.V.	The software is based on modules that work independently of each other, thereby increasing the flexibility of the configuration.	Storage → Cabinets ⁶¹² Windows & Doors → Windows ²⁹⁹⁹	configuration ³²⁶ software ⁸²⁹¹
kismanlearning.nl	Kisman Learning	The website offers online learning modules developed using tools such as Articulate Storyline and Camtasia.	Online Courses → E-Learning ⁶⁰⁶ Online Courses → Learning Platforms ¹⁰⁶	path ⁴⁶⁶ e-learning ⁵⁸⁰	South-Holland → Gouda ³⁵²¹
eerstehulpkoffer.nl	Unspecified	The first aid kits consist of individual, modular modules.	First Aid → First Aid Supplies ²⁴	first aid kit ⁵⁴ bandage ⁹⁸ kit ⁵²⁶ first aid ⁶⁰⁸ plaster ²¹⁷⁵
online-edelstenen-academie.nl	Online Gem Academy	The website promotes a free module called ‘Embrace Your Grief’.	Spirituality → Spiritual Development ²⁷⁸ Environment → Alternative Spiritual Practices ¹⁵	life path ⁵⁵ gemstone ⁸⁵⁶ awareness ¹⁷³⁵ growth ⁴⁰⁵⁴ course ¹⁴⁷²⁸	South-Holland → Dordrecht ⁴⁵³¹
zzpondersteuning.nl	ZZP Ondersteuning Nederland	The website offers different modules for various support needs.	Health → Medical Care & Services ²⁹⁴⁶¹	regulation ¹³⁵⁰ subscription ³²⁸⁷ administration ⁶⁵⁸⁷ membership ¹⁰⁴⁴² care ¹²³³⁸
maledro.nl	Maledro	Various modules such as sockets and USB chargers are available.	Lighting → LED Lighting ⁵⁷⁴ Electrical Engineering → Switchgear ⁶⁶	dimmer ³⁶ switches ⁶⁸ spot ⁹⁷ home automation ³⁷⁶ set ⁷²⁰
profxbasic.nl	ProfX	The system uses various modules that can be individually turned on or off, allowing users to create a customized package.	Customer Relations → Customer Relationship Management ²³⁸	crm ⁵⁹¹ template ⁷⁴² calendar ¹⁵⁵⁶ relationship ⁴²⁰⁵ quote ¹²⁸⁶³
oub.nl	OUB	The course consists of six modules that are presented in a specific sequence.	Professional Development → Training Programs ¹²⁹ Maintenance & Repair → Industrial Maintenance ⁷³²	transportation ²⁸⁵¹ course ¹⁴⁷²⁸
clientrapportagesschrijven.nl	Psychologie Trainingen BV	The course is divided into four modules, each focusing on a specific aspect of client report writing.	Information Technology → Data Management ⁸²⁷ Online & Digital → Digital Services ¹⁰⁰⁸	certificate ¹⁰³⁶ trainer ¹⁹⁶⁶ report ⁴⁵⁵¹ course ¹⁴⁷²⁸
maintis.nl	Maintis	Maintis is modularly built, allowing users to customize functionality to their needs.	Investing → Asset Management ³¹⁸	asset management ³¹⁵ incident ³³⁵ business processes ⁵⁶⁴ contract ²⁴¹⁵	South-Holland → Sliedrecht ⁸⁶³
methodeom.nl	Methode OM	The content modules provide an overview of the tools and principles of Methode OM.	Sustainability → Cooperatives ⁹⁷⁰	pioneer ⁴²
miyvrey.nl	Miyvrey	Miyvrey offers the possibility to implement open-source or custom modules for web applications, expanding their functional capabilities.	Programming Languages → PHP ⁴⁰⁰ Web Technologies & Services → Web Development ²⁴⁸⁸	laravel ¹⁸² seo ³⁷⁰⁷
b-learning.nl	B-Learning	Hanneke Karssen designs and writes e-learning modules for employees, clients, and consumers.	Education & Training → Educational Software ²⁷⁴ Online Courses → E-Learning ⁶⁰⁶	e-learning ⁵⁸⁰ communication ¹⁰¹⁶² design ²⁷²⁰² training ²⁸¹³³	North-Holland → Haarlem ⁸⁶⁷⁴
opleidingentaal.nl	Opleiding en Taal	The organization offers various types of modules, including masterclasses and customized modules.	Training → Language Training ¹³² Professional Development → Teacher Training ¹⁶⁶	language instruction ¹⁶ school leader ⁵² teacher ²⁸⁹⁰ training ²⁸¹³³
faithgenerationschool.nl	Faith Generation	The website describes 20 unique modules and 100 Bible school lessons, providing a broad foundation in biblical knowledge.	Websites → Educational Websites ¹⁷⁸ Language Learning → Religious Education ³⁴⁵	faith ¹⁰⁹³
appono.nl	Appono Recruitment On Demand	The website presents different modules such as Leadership Module and Project Management Module.	Business Software → Scheduling ²⁹ Human Resources → Talent Management ⁵³⁷	insight ⁶²⁸ assessment ¹²⁰⁵ recruitment ²⁰¹⁵	North-Holland → Huizen ¹⁴¹⁶
arbolab.nl	Arbolab	Various modules are available, including job matching, job carving, and salary value indication.	Online Services & Platforms → SaaS ¹⁷¹ Employment & Labor → Labor Market ⁵⁸⁰	test ⁷⁶⁹ dashboard ¹³⁷⁴
asof.nl	ASOF Software	The system consists of various modules geared towards the specific needs of the sector.	Business Software → Business Process Management ³³³ Environment → Waste Management ²⁶⁸⁰	software package ⁶⁷ waste management ⁸¹ automation ²⁶⁸² registration ⁴³⁶⁶	South-Holland → Waddinxveen ¹⁰⁴⁶
ba9.nl	BA9	The core feature of the BA9 system is its interchangeable modules, enabling personalized customization.	Sport Facility → Golf ¹⁴⁴¹ Technology → Electronics & Components ¹¹²⁶¹	golf bag ¹³ customization ¹⁷²³ storage ²⁴⁴⁶ design ²⁷²⁰²
citygarden.nl	ml creative	The vertical gardens are supplied in standard modules of 1x1 meter, with twenty planting compartments.	Garden → Garden Accessories ⁵⁶⁵ Gardening → Vertical Gardens ¹⁵	vertical garden ²¹ irrigation ²¹⁵ plant ⁴⁵⁰⁹
fysicalc.nl	Fysicalc	Fysicalc offers various modules for specific calculations, such as Rc-value, condensation and infiltration.	Construction & Engineering → Construction Software ⁵⁷ Legal & Permits → Building Technology ³⁸⁵	condensation ¹³ airtightness ⁴⁵ helpdesk ¹⁹⁴ library ⁹⁸⁸
geenkiekjesmeer.nl	GEENKIEKJESMEER	The cheat sheets are divided into modules, starting with basic principles and evolving to more advanced techniques.	Technical Aspects → Tutorials ³²	download ²⁸⁷ camera ¹⁷³³ photography ⁹⁵⁰³
groeienmetsucces.nl	Groeien met Succes	The growth training consists of three modules that offer a structured approach.	Training → Sales Training ⁴³⁷	participant ¹⁹³⁴ growth ⁴⁰⁵⁴ practice ⁹⁰⁸⁹ coach ²⁵⁸¹⁰ training ²⁸¹³³
hassinkbv.nl	Hassink B.V.	Hassink Marine Services is active in the construction of (offshore) modules, a specialized branch of shipbuilding.	Maritime → Shipbuilding ⁵⁶⁸ Maintenance & Repair → Industrial Maintenance ⁷³²	steel construction ¹⁴² shipbuilding ¹⁴⁸ pipeline ²⁰⁴ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	South-Holland → Rotterdam ²⁵⁰⁴⁸
jpmolenaar.nl	Fundamentics BV	The consultancy encompasses various SAP modules, such as Plant Maintenance and Customer Service.	Business Software → ERP Systems ¹⁰⁰⁷ Enterprise Solutions → Enterprise Resource Planning (ERP) ²⁹	sap ¹²⁰ consultancy ²⁵⁹⁶ maintenance ²⁰⁰⁹³
linssensoftware.nl	Linssen Software	The software is built in modules, so users can only activate the necessary functions.	Business Software → Accounting Software ⁹⁸⁴	planner ²³⁷ ride ¹⁰⁷⁵ taxi ²⁰⁹⁰ software ⁸²⁹¹
msvz.nl	Modelspoorvereniging Zeeland	From the beginning, modules have been built according to agreed-upon arrangements, resulting in the formation of different groups of members.	Model Building → Model Railroading ²⁷³	model railway ⁷⁰ member ¹⁰¹⁵⁴
onbezorgdwoningonderhoud.nl	Onbezorgd Woningonderhoud	Through the clear modules, it is easier to quickly switch. This saves quotes and consultation.	Construction & Maintenance → Procurement ⁵⁶⁷ Home Improvement & Services → Home Maintenance ¹⁰⁰²	agreement ¹⁰²⁹ property ⁷⁴⁰⁶ home ⁷⁹⁷⁶ price ⁸³²⁸ maintenance ²⁰⁰⁹³	South-Holland → Lisse ¹⁰⁸⁹
pe1oxp.nl	PE1OXP	The website contains documentation pertaining to baseband and PLL modules, essential for ATV operation.	Radio → Ham Radio ⁴¹ Radio & Communication → Telecommunications ¹³⁶¹	atv ²¹ receiver ⁶⁵ mast ⁸⁰ transmitter ⁹⁶ documentation ⁴⁵²
potentialchasers.nl	PotentialChasers	The website offers 250+ business modules to equip users with the knowledge needed to start an online business.	Online Marketing → Email Marketing ²⁴⁸ Web Development → Content Management Systems ⁵⁰²	resources ³¹⁰ template ⁷⁴² community ⁷⁹³¹ strategy ⁹³⁷⁹
restorativeyoga.nl	Restorative Yoga Nederland	The website offers several modules, including a free mini-course, to introduce participants to Restorative Yoga.	Horses → Horse Care ⁴⁸⁸	restorative yoga ¹⁷ blanket ⁴⁹⁵ course ¹⁴⁷²⁸
smartkickstart.nl	Smartkickstart	There are various online live modules available, which can be implemented directly and focus on increasing digital visibility and sales skills.	Business Strategy → Business Development ⁷³⁰ Software Development & Engineering → Custom Software ³⁰⁵	ambition ⁵⁷⁶ entrepreneurship ¹⁵⁷⁹ goal ⁴⁹⁷⁴ coach ²⁵⁸¹⁰
webking.nl	Voorbeeld inhoud webking	Modules are components that enhance the functionality and appearance of a Joomla website, and can be customized on a per-page basis.	Web Design → Content Management ²⁹³ Software Development & Engineering → Software ¹¹⁶⁰⁸	settings ⁶⁸ joomla ¹⁷¹ cms ⁶¹³ template ⁷⁴² article ⁶⁰⁰⁰
werkkosten.nl	BastionAdvies.nl	The website offers a complete solution consisting of 5 modules, including a Knowledge Session.	Personal Wealth → Pensions ⁸⁵⁶ Human Resources → Employee Benefits ²⁴⁵	employee benefits ³³ cao ²³⁷ implementation ¹⁰²⁹ administration ⁶⁵⁸⁷
yourposhorecakassa.nl	Yourpos	Various modules, such as ECash payments and kitchen ticket systems, are available.	Business Software → Retail Software ⁵⁶ Business Software → POS Systems ¹⁰¹	pos system ⁷⁸ hospitality ³⁴⁹¹ software ⁸²⁹¹ installation ¹³⁷⁴²	Flevoland → Almere ⁷⁷⁶⁵
zekerwebsite.nl	ZekerWebsite	Optional modules, such as photo albums or forms, can be easily added to enhance the functionality of the website.	Web Design → Website Builders ⁸⁸⁸	domain name ¹²⁰³ package ⁶¹¹²
thegardencoach.nl	The Garden Coach	Customers can choose from various modules, such as pruning advice or an extensive planting plan, to further customize the garden design.	Gardening → Garden Advice ⁴⁸	vegetable garden ²²⁶ garden design ⁹⁶⁴
cyberphysicalfactory.nl	Cyber Physical Factory	Modules are connected and communicate with each other, responding to events, forming a complete system.	Artificial Intelligence → Machine Learning ¹⁰² Industrial → Industrial Automation ¹⁰⁴²	robotics ²⁸¹ machine ³⁷²⁷ data ⁵⁸⁷² communication ¹⁰¹⁶²
verhuur365software.nl	Verhuur365software	Verhuur365software offers a range of modules that can be tailored to the specific needs of each rental company.	Business Software → Logistics Software ¹⁰³ Management → Business Optimization ¹⁹⁵	rental company ⁵² efficiency ³³⁶ cost ¹⁹⁹⁰ software ⁸²⁹¹
orangelearning.nl	Orange Learning	Orange Learning delivers e-learning modules, ranging from brief refreshers to comprehensive learning packages.	Online Courses → E-Learning ⁶⁰⁶ Training → Online Training ³⁴³	e-learning ⁵⁸⁰ knowledge ³⁵²⁸ video ⁶⁷¹⁴ training ²⁸¹³³
vera-ict.nl	VerA Vereniging administratie	VerA offers various modules, including relationship management and invoicing, which users can configure.	Business Software → Administrative Software ¹⁵⁸ Accounting → Bookkeeping ¹²³⁰	invoice ⁷⁹⁵ administration ⁶⁵⁸⁷ association ⁸⁵⁶²
esmw.nl	Meks	The theme’s module builder allows for the creation of various website sections and features.	Themes → WordPress Themes ¹⁴⁵ Personal Wealth → Retirement ⁷⁶⁹	retirement ⁴⁰⁶ layout ⁸⁹⁹ investment ²⁰⁷⁰ wordpress ³⁵⁵¹ theme ⁴⁰¹⁵
aqdemie.nl	AQdemie	The website offers modules for various topics and learning objectives.	Primary Education → Educational Materials ⁷¹¹ Curriculum & Resources → General Education ⁴⁴	learning objectives ¹⁶ subject ²⁰³ skills ¹¹⁰⁵ story ⁸²⁸⁵ education ¹³⁴⁷¹
nexsys.nl	NEXSYS shop	The website sells various electronic modules, such as LCD modules, joysticks, and ultrasonic sensors.	Audio → Components ⁴⁸⁹ Electronics & Components → Arduino ¹⁹	arduino ¹²³ sensor ⁴⁸² shopping cart ¹⁵²¹
admedis.nl	Admedis	Admedis includes various modules for diverse functionalities.	Business Software → Accounting Software ⁹⁸⁴ Software → Healthcare Software ¹⁷⁷	bill ¹⁶³ treatment plan ³⁸⁰ agenda ⁴³⁷⁴
agremote.nl	Agremote	The system is built from two modules, each equipped with a screen.	Metalworking → Machines ³⁰⁷ Agriculture → Agricultural Technology & Innovation ⁷⁴³	sensor ⁴⁸² tractor ⁷⁸⁹ machine ³⁷²⁷ communication ¹⁰¹⁶²
sameneenwebsitebouwen.nl	Samen een website bouwen	The website offers additional WordPress course modules for further deepening knowledge.	Web Design → Content Management ²⁹³ Technology & IT → Computer Training ¹⁴⁰	developer ⁴⁰⁶ structure ¹³⁰⁵ wordpress ³⁵⁵¹ course ¹⁴⁷²⁸	Utrecht → Amersfoort ⁸⁰¹¹
startvandaagonline.nl	The media agency	The website offers various modules, such as newsletters and chat features, that can be added to the website.	Web Development → CMS ⁵¹⁶	functionality ⁴¹⁷ design ²⁷²⁰²
ineigenhanden.nl	Balance Theme	The theme utilizes various modules such as slideshows and galleries to enhance content.	Themes → WordPress Themes ¹⁴⁵ Web Design → Website Builders ⁸⁸⁸	track ⁴¹⁶ fitness ²²⁵¹ application ³³⁷⁷ theme ⁴⁰¹⁵ recipe ⁵¹⁴²
jankooistrawebdesign.nl	Jan Kooistra Webdesign	The website offers various modules available for users to provide extra functionality and control.	Online Marketing → Website Optimization ²⁶⁵ Web Development → CMS ⁵¹⁶	cms ⁶¹³ seo ³⁷⁰⁷ branding ⁴⁶¹⁴ webshop ⁸⁶⁴⁸
schrijfjeplan.nl	VuurKracht	The website utilizes various modules to guide users step-by-step through the process of creating a business plan.	Business Strategy → Business Planning ⁹³	business plan ³⁸⁷
factief.nl	Factief	The courses are modular, allowing participants to determine which modules they want to follow.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Human Resources → Talent Management ⁵³⁷	flexibility ⁹⁹⁶ customization ¹⁷²³ knowledge ³⁵²⁸ course ¹⁴⁷²⁸ training ²⁸¹³³
luisterenmetjehart.nl	Raak(t) het hart van de ander	The website offers various modules focused on specific skills and knowledge.	Training → Communication Skills ¹⁷² Religion → Christianity ³⁸³⁹	online platform ³¹ skills ¹¹⁰⁵ workshop ¹⁹³²⁵ training ²⁸¹³³
4-ring.nl	Risic as a Service B.V.	RaaS offers various modules, including a risk steering module and a module for process risk management.	Software Development & Engineering → Agile Methodologies ²¹⁰ Insurance & Risk → Risk Management ¹⁰⁶⁰	value creation ²⁹ agile ⁴¹⁷ risk management ⁵⁴³ risk ²⁸⁹⁶ concept ³³³⁸
demediacademie.nl	The Medi Academy	Training modules cover various areas within healthcare, including resuscitation and medication safety.	Nursing & Support → Nursing ⁵³⁶ Online Courses → E-Learning ⁶⁰⁶	skillslab ¹⁰ e learning ⁵² workshop ¹⁹³²⁵ training ²⁸¹³³
pinksoulacademy.nl	PINK Soul Academy	The academy offers various modules with information and tips on the different colors.	Adult & Continuing Learning → Professional Training ¹²²⁴ Curriculum & Resources → General Education ⁴⁴	self-leadership ²⁵ knowledge ³⁵²⁸ inspiration ⁴⁰⁸¹ color ⁴¹⁵⁹
dekleinegroteman.nl	deKleineGroteMan	A module is a building block of the software designed for a specific machine or task and can be expanded with additional functions.	Industrial → Industrial Automation ¹⁰⁴² Technology → Robotics & Automation ⁸⁶⁰	hmi ²³ plc ⁹⁸
thomduran.nl	Thom Duran	The write-ups document the progress of modules like Malware Analysis.	Student Life → Students ³⁵² Information Technology → Cybersecurity ¹⁰⁰⁹	lab ⁶⁶ cybersecurity ⁶⁸⁸ plan ²⁵⁶⁶
info.corpoflow.nl	CORPOflow	The software consists of various modules, such as sales, rental, and student housing, which can be customized.	Business Software → Workflow Management ⁶³ Homeownership & Management → Housing Corporations ⁴²⁶	workflow ⁴⁰⁷ integration ¹⁴⁵¹ cloud ¹⁵²⁷ connection ⁴⁰⁰⁷
blog.wapnet.nl	Thomas Faddegon	The PSWindowsUpdate module is used to manage Windows Updates from PowerShell.	Software Development & Engineering → Scripting ¹⁷	powershell ⁴⁷ log ⁵⁰ server ¹⁰³⁶
qaanz.nl	Q aan Z	Users can choose from various modules to address specific issues, such as depression or anxiety.	Professional Development → Training Programs ¹²⁹ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	counselor ⁴¹ life ²⁶⁷³ work ³¹²² relationship ⁴²⁰⁵
gopienter.nl	Gopienter	The learning paths are built upon various modules that teach specific skills.	Educational Support → Study Skills ²⁵ Pedagogy & Methods → Learning Methods ¹⁸⁵	study skills ⁷² concentration ¹⁰⁹ quiz ⁷¹⁰ planning ¹⁹⁶⁹
compskill.nl	Compskill B.V.	COMPSKILL offers a suite of compliance modules, including Assessments, Reporting, and Issue Management, designed to streamline compliance processes.	Management → Team Development ⁶¹⁷ Online & Digital → Digital Services ¹⁰⁰⁸	transparency ⁴⁴² trust ¹¹⁴⁷	North-Holland → Amsterdam ⁴¹²⁵³
liasht.nl	Inergy	The website utilizes analysis modules.	Data Analysis → Business Intelligence ¹⁰⁰² Software Development & Engineering → Software ¹¹⁶⁰⁸	complexity ⁵³ analysis ¹⁶¹⁵ technique ²¹⁵⁷ data ⁵⁸⁷²
latijnsvertalen.nl	vertalen.nu	The website uses a handy translation module for translating text.	Language → Latin ⁸⁵ Language Learning → Language Education ⁴²⁷	spelling ¹¹⁴ word ⁵⁶⁷ translation ¹⁵²³ text ²⁴⁶⁷
onlinecursusfilmen.nl	GGTV	The course is divided into five modules, each with specific topics and exercises.	Entertainment → Television ¹¹³⁴ Online & Digital → Digital Services ¹⁰⁰⁸	interview ¹³⁷¹ camera ¹⁷³³ film ³⁰⁰⁷ video ⁶⁷¹⁴ course ¹⁴⁷²⁸
bmd-ams.nl	BMD AMS	The website describes various modules that can be added to the AMS package to expand functionality.	Management → Quality Management ⁹⁰⁹	webinar ⁸⁷⁰ case ¹¹⁵³ app ⁴⁵⁹⁵ blog ¹³³⁹²
breinbaas.nl	Breinbaas	The courses are modularly structured, allowing individual modules to be given separately.	Programming Languages → Python ⁴⁷	python ¹⁶⁷ consultancy ²⁵⁹⁶ course ¹⁴⁷²⁸ training ²⁸¹³³
divvonline.nl	DIVV	The application is built from three modules: general information, asbestos, and fire safety.	Homeownership & Management → Homeowners Associations ⁵⁴⁶ Safety → Fire Safety ¹⁰⁴⁸	web application ⁶⁰⁹ integration ¹⁴⁵¹ real estate ⁴⁹⁸¹
onlinesalesapp.nl	Online Supporter B.V.	The app is adaptable by adding modules, expanding functionality further.	Enterprise Solutions → Business Software ⁶¹⁵⁶	crm ⁵⁹¹ presentation ¹⁷⁸⁵ application ³³⁷⁷ sale ⁵⁹³⁰
yellenge.nl	Yellenge	The platform utilizes more than 20 modules, each offering a specific functionality.	Business Software → Hospitality Software ³⁹ Software → Event Management Software ³⁰	registration ⁴³⁶⁶ app ⁴⁵⁹⁵ event ⁴⁵¹⁹⁹
isy-school.nl	Isy-School B.V.	ISY offers various modules for complete parent communication, which can be customized to meet the school's needs.	Communication → Online Communication ³¹ Technology & IT → Educational Technology ³⁸⁰	teacher ²⁸⁹⁰ parent ⁴³¹⁸ school ⁷⁸⁵⁶ communication ¹⁰¹⁶²	Roermond → Herten ¹³³
club-assistent.nl	Club-assistent	The software package consists of various modules, such as membership management.	Business Software → Management Software ¹⁴⁶	package ⁶¹¹² administration ⁶⁵⁸⁷ volunteer ⁸³⁶⁷ association ⁸⁵⁶² communication ¹⁰¹⁶²
zaalagenda.nl	Zaalagenda B.V.	The website includes several modules, such as billing and accounting integration.	Business Software → Management Software ¹⁴⁶ Software Development & Engineering → Web Applications ¹⁰⁰⁵	invoicing ²⁹² integration ¹⁴⁵¹ reservation ³³⁷³ agenda ⁴³⁷⁴ app ⁴⁵⁹⁵
linqq.nl	Linqq	The website provides various modules for extra functionality, such as delivery and web hosting.	Web Development → CMS ⁵¹⁶ Software Development & Engineering → Content Management Systems ¹⁷	cms ⁶¹³ domain name ¹²⁰³ hosting ³¹²⁵ webshop ⁸⁶⁴⁸
spread-it.nl	Spread-IT B.V.	The software is built with various modules that provide specific functionalities.	Logistics → Inventory Management ¹⁰⁰ Logistics → Supply Chain ⁷⁹¹	workflow ⁴⁰⁷ supply chain ⁴¹³ distribution ¹⁰¹¹
magister.nl	Magister	Magister offers modularly expandable functionalities, such as modules for teaching execution and student guidance.	Business & Management → Educational Management ³⁷⁵	scheduling ²⁶¹ student ⁷⁶²³ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶
stasoftware.nl	Smart Technical Applications	The website describes various modules included in the software.	Construction & Engineering → Construction Software ⁵⁷ Legal & Permits → Building Technology ³⁸⁵	bim ³⁰⁷ inspection ⁴²⁷⁹ software ⁸²⁹¹
parnassys.nl	ParnasSys	The system consists of various modules, such as Parent Communication, which supports diverse functions.	Curriculum & Resources → Educational Information ³³ Software Development & Engineering → Software ¹¹⁶⁰⁸	integration ¹⁴⁵¹ data ⁵⁸⁷² school ⁷⁸⁵⁶ education ¹³⁴⁷¹
atabix.nl	Atabix	In addition to the basic solutions, Atabix delivers a number of standardized modules, such as scheduling systems and record management.	Online Services & Platforms → SaaS ¹⁷¹ Online & Digital → Digital Services ¹⁰⁰⁸	forms ²⁴⁴ portal ⁵⁹¹
vensters.nl	Snel naar	Vensters offers a variety of modules, including a school directory and a dashboard for inclusive education.	Business & Management → Educational Management ³⁷⁵ Pedagogy & Methods → Digital Education ⁵⁶	dashboard ¹³⁷⁴ education ¹³⁴⁷¹
bouwportaal.nl	Bouwportaal	Bouwportaal offers a wide range of modules for various needs.	Business Software → Project Management Software ⁶⁵ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	invoicing ²⁹² hour ³⁶⁵ project management ³⁴²³ account ⁵⁷⁸¹
use-cocoon.nl	Cocoon	The software offers various modules for specific needs, such as managing brand guidelines.	Online Marketing → Marketing Automation ²⁸⁹ Business Software → Marketing Software ⁹⁰	image bank ⁸⁸ files ²⁹⁰ integration ¹⁴⁵¹ communication ¹⁰¹⁶²
facilitor.nl	Facilitor	The modular FMIS system offers flexibility in adapting to the organization’s needs.	Education & Training → Educational Software ²⁷⁴ Management → Process Management ³⁰¹	service management ³⁴ case study ⁵⁶ software ⁸²⁹¹
obsurv.nl	Sweco	Obsurv offers various modules, such as Obsurv training and Obsurv Hosting.	Enterprise Solutions → Business Systems ⁹¹	management system ¹¹⁸ saas ¹³¹ municipality ⁶⁸³⁷	Overijssel → Ommen ¹⁰⁹⁵
optimit.nl	Optimit	Users can create an 'all-in-one' package by selecting the most relevant modules for their business.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	accounting package ⁷⁵ invoicing ²⁹² crm ⁵⁹¹
alleo.nl	Alleo	Alceo offers various modules to optimize employee benefits administration.	Human Resources → Employee Benefits ²⁴⁵ Technology → HR Technology ⁶⁶	demo ³²⁰ benefits ³⁶⁹ employee ⁴⁴²⁹
verbonden.nl	Verbonden	The website offers various modules to customize and expand the online telephone center.	Radio & Communication → Telecommunications ¹³⁶¹ Finance & Insurance → SMEs ⁴³³	number ¹⁹⁹ telephone ²⁰⁹ voip ⁴²⁵ dashboard ¹³⁷⁴ rate ²⁶⁰⁶
coppermine.nl	Coppermine	Coppermine is structured as an open system comprised of flexible modules, providing extensive control over business operations.	Business Software → CRM ⁷⁶⁴ Online Services → Platforms ⁵³⁷	customer portal ¹⁴¹ crm ⁵⁹¹ e-commerce ⁷³⁸ logistics ³²⁵⁷ subscription ³²⁸⁷
svsplus.nl	Emeni Automatisering & Websites	The player tracking system is built from various modules for different needs.	Applications → Sports Software ¹² Sports Activities → Football ⁴¹⁴⁴	player ⁶⁷⁸ match ³⁴⁷¹ administration ⁶⁵⁸⁷ member ¹⁰¹⁵⁴
ramoonus.nl	Ramoonus	The website details the installation of kernel modules.	Web Design & Development → Web Servers ⁵⁸ Operating Systems → Linux ²⁵⁵	header ²⁶ ubuntu ⁶⁸ configuration ³²⁶ installation ¹³⁷⁴²
evalytics.nl	Evalytics	Evalytics generates reports at module level.	Business Software → Education Software ⁴⁷ Risk Management → Risk Assessment ⁹⁵	evaluation ²²⁴ question ²²⁶¹ results ³⁹⁵⁴ report ⁴⁵⁵¹ training ²⁸¹³³
compubase.nl	Compubase	Compubase builds custom modules for the Drupal CMS, expanding and customizing the functionality of websites.	Web Development → Content Management Systems ⁵⁰²	drupal ⁸⁰ google ¹⁹² e-commerce ⁷³⁸	Netherlands → North-Brabant ⁷³³⁴¹
apotheekpartners.nl	Apotheek Partners	The website describes various modules such as 'Clustering' and 'Delivery' that are offered.	Business Software → Document Management ³²⁸ Business Services → Customer Service ¹⁴⁵¹	prescription ⁸⁵⁹ patient ⁴⁰⁸² software ⁸²⁹¹
erfgoedcms.nl	ErfgoedCMS™	The website introduces a new Co-Creation module, allowing the public to contribute to the enrichment of heritage collections.	Monuments → Heritage ⁵²⁶ IT Services & Consulting → Information Technology ³⁷⁶³	terminology ³¹ heritage ⁸¹⁸ collection ⁷⁵⁶⁶
dutchmedialab.nl	Dutch Media Lab	The website offers customizable modules to increase functionality.	Online Services & Platforms → SaaS ¹⁷¹ Web Development → CMS ⁵¹⁶	template ⁷⁴² agency ⁹⁴⁴ lead ¹¹⁹⁵
vanbrug.nl	Van Brug Software	The software is extended with various modules, such as Codex, which customize the functionality as needed.	Industrial Solutions → Professional Software ²⁷ Legal → Notaries ⁸⁴⁸	co-creation ¹³⁴ notary ⁷⁹¹ knowledge ³⁵²⁸ software ⁸²⁹¹ event ⁴⁵¹⁹⁹
welcometomankind.nl	Welcome to Mankind	The course is divided into various modules, including sleep and feeding.	Parenting → Fatherhood ³² Health → Pregnancy & Childbirth ⁴²²²	father ⁹⁴ postpartum ⁴⁶⁴ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹ video ⁶⁷¹⁴
dynamicsite.nl	DynamicSite	The website uses modules that make it easy to add various functionalities, such as online stores.	Online Marketing → Website Management ³⁶⁹ Online & Digital → Internet Services ¹⁰⁰⁴	functionality ⁴¹⁷ maintenance ²⁰⁰⁹³
beasy.nl	BEasy	BEasy uses the latest modules that are continuously updated and where ongoing work is carried out on security.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	speed ⁴⁶¹ cms ⁶¹³
nbis.nl	NBIS	NBIS offers various modules for different needs, such as scanning and inventorying.	Investing → Asset Management ³¹⁸ Energy → Energy Management ⁵⁰⁴	building management ⁵⁴ data ⁵⁸⁷² software ⁸²⁹¹ collaboration ¹⁶⁰³⁶
bokbiz.nl	Atinoz	Users can expand functionality with various paid modules.	Accounting → Bookkeeping ¹²³⁰ Web → Websites ²⁰²⁸	account ⁵⁷⁸¹ administration ⁶⁵⁸⁷
edityourapp.nl	EditYourApp	Special modules for news, photo albums, and slideshows facilitate the creation of mobile content.	Software Development & Engineering → App Development ¹⁰⁸⁴ Software Development & Engineering → Web Applications ¹⁰⁰⁵	operating system ⁵¹ functionality ⁴¹⁷ app ⁴⁵⁹⁵
zorgwijzer.nl	Part of Achmea	Flexible modules offer various options for customizing the health insurance.	Web → Websites ²⁰²⁸ Legal & Financial & Career → Health Insurance ⁵¹⁹	health insurance ²⁸⁷ reimbursement ⁴⁶⁵ comparison ⁵⁴¹ choice ⁸²⁷ review ¹⁸⁸⁸
affiliatefeeds.nl	Unspecified	The site explains modifications to module layouts, requiring users to manually rename and update module settings.	Web Design → Content Management ²⁹³ Online Marketing → Affiliate Marketing ²⁹⁹	joomla ¹⁷¹ migration ³⁴⁹ documentation ⁴⁵² template ⁷⁴²
schuldenknooppunt.nl	Schuldenknooppunt	The platform offers various modules that support specific functions and processes.	Directories → Web Portals ²⁴⁰ Social Issues & Welfare → Social Affairs ⁶⁰¹	web portal ²⁶ data exchange ³⁴ creditor ⁷⁷
netsend.nl	Netsend	ARPA2 Resource ACL Nginx module enforces access rights using ARPA2 ACLs.	Technical → Security ⁴⁰⁸ Legal → Privacy ⁵⁹⁶	vpn ¹⁶⁷ filter ⁴⁸⁷ backup ⁴⁹⁴ database ¹¹⁵³
nemacademy.nl	NEM Academy	The website contains various modules on topics such as transformation guidance and systems thinking.	Mental & Emotional Well-Being → Children ¹⁰⁴⁰	educator ¹¹⁴ continuing education ²⁰¹ passion ⁷⁹² course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰
iamdigital.nl	I.AMDIGITAL	The training programs consist of various modules, covering both the basics of AI and future developments.	Data Science & Analytics → Artificial Intelligence ¹⁸³¹ Software Development & Engineering → Digitalization ²⁷⁶	bootcamp ⁴⁹⁷ digitalization ⁷⁵⁷ ai ²¹⁸¹
xcore.nl	xCore	The platform offers custom subscription modules for e-commerce businesses.	Business Software → Accounting Software ⁹⁸⁴ Business Software → ERP Systems ¹⁰⁰⁷	exact ⁴² connection ⁴⁰⁰⁷ app ⁴⁵⁹⁵
takenvandetoekomst.nl	TNO, HAN Hogeschool, Beeldr	The website offers various modules within the broader approach for employers and employees.	Employment & Labor → Employers ⁶⁰⁸	future ⁴⁰⁴ digitalization ⁷⁵⁷ approach ⁹⁷¹ task ¹⁵⁰⁷
untis.nl	Untis Nederland	Untis can be expanded with various modules, such as Crop Management and Student Schedule.	Business Software → Education Software ⁴⁷ Business Software → Scheduling Software ⁵²	roster ⁴⁷ scheduling ²⁶¹ school ⁷⁸⁵⁶ software ⁸²⁹¹
docsure.nl	Docsure	The software includes various modules, such as Regiewerk, to automate different processes.	Business Software → Project Management Software ⁶⁵ Project Management → Time Tracking ⁸⁴	hour ³⁶⁵ document ¹⁶⁷⁸ administration ⁶⁵⁸⁷ software ⁸²⁹¹
automotivevacaturebank.nl	Automotive Vacaturebank	The AutomaticMatch® module ensures a quick and efficient job search.	Online Services → Job Boards ¹⁰³⁶ Employment & Labor → Employers ⁶⁰⁸	internship ⁶⁹⁴ position ⁸⁷⁵ profile ¹⁹⁶⁵ employer ²³⁸³ job ²⁷⁹⁵	Beek → Maastricht-Airport ⁸¹
lmsystems.nl	LM Systems & LinMotion	With complete linear modules, the company provides a fast and compact solution for customers.	Machinery & Repair → Machinery ¹⁰⁴⁵ Manufacturing & Industrial → Engineering ³⁹¹⁹	spindle ¹⁶
bulbmanager.nl	Ebbers Bloembollen	The program offers optional modules to expand functionality and customize it.	Logistics → Inventory Management ¹⁰⁰	inventory management ¹³⁸ invoicing ²⁹² business processes ⁵⁶⁴
visoft.nl	ViSoft Software	ViSoft offers various modules such as Phototuning and Virtual Reality, which enhance the presentation of products.	Bathroom → Sanitary Ware ⁸⁴⁵ Multimedia & Design → Design Software ¹⁴	sanitary ware ⁶⁶⁹ tile ²⁸⁶⁹ bathroom ³⁷⁸⁴ app ⁴⁵⁹⁵ software ⁸²⁹¹
mijnvolksuniversiteit.nl	MijnVolksuniversiteit.nl	MijnVolksuniversiteit.nl consists of three complementary modules that support the processes of adult education.	Education & Training → Educational Software ²⁷⁴ Online Courses → E-Learning ⁶⁰⁶	administration ⁶⁵⁸⁷ student ⁷⁶²³ software ⁸²⁹¹ course ¹⁴⁷²⁸
online-planning.nl	Online-Planning B.V.	Various modules, such as the timekeeping system and leave requests, facilitate staff management.	Applications → Business Applications ¹¹⁰ Online Services & Platforms → SaaS (Software as a Service) ⁴⁴	rooster ⁴³
goflowapps.nl	goFlowApps	The company offers ready-made FileMaker modules, in addition to custom solutions.	Administration & Maintenance → Database Software ⁵⁰ Technology → SMB ¹²⁷	filemaker ²⁸ business processes ⁵⁶⁴
bizzcounter.nl	Bizzcounter B.V.	Bizzcounter offers various modules, such as online invoicing and project management, which can be easily combined.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Financial Software ¹⁵¹	accounting package ⁷⁵ invoice ⁷⁹⁵ account ⁵⁷⁸¹
kjsoftware.nl	KJ Software	Odoo consists of various modules that offer specific functionalities, such as sales, inventory management, and accounting.	Business Software → ERP Systems ¹⁰⁰⁷ Finance & Insurance → SMEs ⁴³³	odoo ³⁸ erp ³⁶³ crm ⁵⁹¹ software ⁸²⁹¹
mrwebhosting.nl	Mr. Webhosting	The website offers diverse hosting modules, including 'Website Host' and 'Webshop Boost', specifically designed for different needs.	Information Technology → Cybersecurity ¹⁰⁰⁹	data traffic ³⁵ backups ⁸³ ssl ¹³² webhosting ⁹⁴⁸ account ⁵⁷⁸¹
brandware.nl	Brandware	The platform’s scalable design allows users to start with core functionalities and add more modules as their needs evolve.	Business Software → Marketing Software ⁹⁰ Creative & Design Services → Brand Management ⁶²	brand guideline ⁸⁰ template ⁷⁴²	North-Holland → Amsterdam ⁴¹²⁵³
aboeismail.nl	Aboe Ismail	Users can gain knowledge about diverse Islamic topics through modules.	Religious Education → Islamic Education ⁴⁷ Religion → Islam ⁵⁴²	islam ¹⁷² series ⁶⁴⁴ knowledge ³⁵²⁸ lesson ⁵¹⁵⁴ book ¹¹³⁹⁶
opleidingnu.nl	OpleidingNU	The platform offers fully scalable modules that can be flexibly adapted to different training needs.	Training → Corporate Training ¹³³¹ Adult & Continuing Learning → Online Courses ¹⁰²⁰	pedagogy ⁴⁰² brand identity ¹⁴⁵⁷ training ²⁸¹³³
erpportaal.nl	ERP Portaal	The website offers modules for different sectors, such as HR and E-commerce.	Business Software → ERP Systems ¹⁰⁰⁷	business processes ⁵⁶⁴ technology ⁶⁸¹⁶
boukebouwt.nl	Bouke Bouwt	Speech therapists can set customizable modules to align the treatment with the child’s language level.	Educational Innovation → Digital Tools ⁶³ Language → Dutch ⁵⁶⁰	language level ¹⁵ progress ⁷² homework ²²³ game ²⁸⁰⁷
condor.nl	Condor	Condor offers various software modules for specific management tasks such as work order management and contract management.	Homeownership & Management → Homeowners Associations ⁵⁴⁶ Software → Real Estate Software ¹⁰⁰	dashboard ¹³⁷⁴ integration ¹⁴⁵¹ real estate ⁴⁹⁸¹ software ⁸²⁹¹ maintenance ²⁰⁰⁹³
bodembreedacademie.nl	Bodembeheer Nederland, SIKB and KOBO-HO	The learning offer will be expanded with new modules.	Fertilizers & Soil Health → Soil Management ²² Science → Environmental Science ¹⁸⁰	soil ⁹³⁰ professionals ¹⁹⁶⁶ knowledge ³⁵²⁸ course ¹⁴⁷²⁸
nuicart.nl	NuiCart	The webshop modules offer various extra functionalities and integrations.	Business Software → Management Software ¹⁴⁶ E-Commerce → E-Commerce Platforms ⁴¹⁰	functionality ⁴¹⁷ price ⁸³²⁸ webshop ⁸⁶⁴⁸ design ²⁷²⁰²
serioussoap.nl	Serious Soap	The website is divided into different modules, each addressing a specific aspect of elderly care.	Nursing & Support → Nursing ⁵³⁶ Senior & Geriatric → Geriatrics ²³⁰	elderly care ¹²⁸ e-learning ⁵⁸⁰ mobility ¹²⁶⁴ pain ¹⁹¹⁹
academieartemis.nl	Artemis Academy	The program is divided into various modules, including an orientation course and various programs.	Websites → Educational Websites ¹⁷⁸ Vocational & Training → HBO ⁸⁶	academy ⁵⁹³
sitters-electronics.nl	Sitters Electronics	The company uses internal developed modules to avoid repetition and improve the efficiency of the development process.	Computer Science → Embedded Systems ¹⁴¹ Manufacturing & Industrial → Hardware Development ²⁰	application ³³⁷⁷ staff ³⁴⁰⁵ software ⁸²⁹¹ design ²⁷²⁰²
epacbv.nl	EPAC B.V.	The company produces modules, which are part of the automated processes for electronic assembly.	Manufacturing → Electronics Manufacturing ¹⁵ Industrial → Industrial Automation ¹⁰⁴²	programming ⁵⁷⁵ component ⁷¹⁴ assembly ¹⁷³³ production ⁴⁵⁸²	Limburg → Weert ²⁰³⁰
cleantron.nl	Cleantron	Cleantron specializes in the production of lithium-ion battery modules, offering tailored solutions to meet specific customer needs.	Industrial → Industrial Automation ¹⁰⁴² Energy → Battery Technology ²⁷	bms ¹⁸ mobility ¹²⁶⁴ battery ¹⁷⁵¹
cmspecialist.nl	CM Specialist	Various modules, such as Links, Order-Direct, SnelStart and XML Export/Import, simplify business operations for webshops.	Online Marketing → SEO ¹¹²³ E-Commerce → E-Commerce Platforms ⁴¹⁰	webshop ⁸⁶⁴⁸ strategy ⁹³⁷⁹ brand ¹⁷⁷³⁷
klankpraktijk.nl	Klankpraktijk Sylvia Zijlstra	The basic course is divided into four modules, each focused on learning specific sound techniques.	Alternative Medicine → Sound Therapy ²⁸⁹ Adult & Continuing Learning → Self-Development ¹⁹	sound massage ³² singing bowls ¹¹⁹ training ²⁸¹³³
zwincollege.nl	Zwin College	The ZwIN subject consists of modules of 5-6 weeks, in which various skills are addressed.	Support → Student Support ⁴³⁴ Secondary Education → School Communities ²⁶	subject ²⁰³ student ⁷⁶²³ education ¹³⁴⁷¹
apprenticexm.nl	Apprentice	The website supports various modules, including a culture dossier and a personal timeline.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹ Technology & IT → Educational Technology ³⁸⁰	yearbook ⁹⁸ learning environment ²²¹ assignment ¹¹²¹ portfolio ⁶⁸⁵⁴
flowcentre.nl	Flow Centre Nederland	The different modules provide practical tools and strategies to foster flow in various contexts, such as sports and work.	Coaching → Leadership Coaching ⁵⁵⁷ Software → Productivity & Office ¹²⁰³	flow ²⁶³ course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰ training ²⁸¹³³
fadiro.nl	Fadiro	BAS offers various modules to optimize administration.	Themes → WordPress Themes ¹⁴⁵	travel agency ²¹² education ¹³⁴⁷¹
bisharp.nl	Bisharp	The diverse modules of Bisharp offer complete solutions for specific needs within the client organization.	Data Analysis → Business Intelligence ¹⁰⁰² Business → Industry ³⁶⁹⁷⁷	dashboard ¹³⁷⁴ connection ⁴⁰⁰⁷ report ⁴⁵⁵¹ data ⁵⁸⁷²
cultuurensportstimulering.nl	Cultuur- & Sportstimulering NL	The website offers customizable modules for schools and IKC’s.	Social Issues → Participation ¹⁰²³ Primary Education → Educational Materials ⁷¹¹	resident ³²⁴⁵ campaign ³⁴²⁸ municipality ⁶⁸³⁷
safetytriggers.nl	Safety Triggers	The app contains various modules, such as triggers and tasks, helping businesses implement their safety policies.	Business Software → Productivity Tools ⁴¹⁶ Specialty Medicine → Occupational Medicine ¹²⁹¹	trigger ¹¹ toolbox ¹²⁴ checklist ⁴²⁶ dashboard ¹³⁷⁴
diglo.nl	Diglo B.V.	The user chooses the modules they need; for meeting participants, guiding learning processes, and managing finances.	Online Courses → Learning Platforms ¹⁰⁶ Technology & IT → Educational Technology ³⁸⁰	learning program ¹⁸ infrastructure ¹⁴⁶⁰ meeting ²³⁸¹
tabletsalesapp.nl	tabletsalesapp.nl	The application is built with various modules.	Enterprise Solutions → Business Software ⁶¹⁵⁶ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	customer contact ¹³⁰ sale ⁵⁹³⁰ software ⁸²⁹¹
batao.nl	Batao	Batao shares its own modules with clients to improve their webshops.	E-Commerce → Magento ³⁸	magento ¹⁸³ implementation ¹⁰²⁹ webshop ⁸⁶⁴⁸	Gelderland → Nijmegen ⁹³⁸⁴
nivo-media.nl	Nivo-Media	A new module is available for Prestashop to eliminate render-blocking CSS.	Web Design → Website Builders ⁸⁸⁸ Online & Digital → Internet Services ¹⁰⁰⁴	prestashop ⁴² internetmarketing ⁷¹ website development ⁸⁵ seo ³⁷⁰⁷
site-writer.nl	Sitewriter webdesign	Sitewriter offers various modules, such as product presentations and social media integration, which are tailored to the specific requirements of its clients.	Web Development → CMS ⁵¹⁶ Web Development → Content Management Systems ⁵⁰²	domain ¹⁸¹¹ webdesign ⁴⁰⁹²	Gelderland → Apeldoorn ⁶⁹⁹⁶
kleinboek.nl	Code050	Kleinboek offers numerous functionalities through its various developed modules.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Administrative Software ¹⁵⁸	bookkeeping package ¹³ revenue ⁶⁹³ invoice ⁷⁹⁵ dashboard ¹³⁷⁴
bladetmc.nl	Codestream	Modules, such as a guestbook or agenda, are used to add functionality to websites without HTML knowledge.	E-Commerce → E-Commerce Platforms ⁴¹⁰ Web Development → CMS ⁵¹⁶	cms ⁶¹³ hosting ³¹²⁵ software ⁸²⁹¹ webshop ⁸⁶⁴⁸
donorwise.nl	Donorwise	The website is structured around modules that address various aspects of organ donation.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹ Curriculum & Resources → Educational Resources ⁴⁰¹	quiz ⁷¹⁰ donor ⁷⁵⁷ speaker ¹⁴⁸¹
nnvo.nl	Nationale Nautische Verkeersdienst Opleiding	The website offers a wide range of modules aligned with the needs of the maritime sector.	Technical Services → Technical ⁹⁵⁷ Business & Management → Certification ³⁶⁴	qualification ⁹⁶ controller ²³⁹ lock ³⁶⁸ training ²⁸¹³³
hygienecodeonline.nl	Hygienecode Online	Various modules, such as temperature monitoring, are available for additional functionality.	Apps → Business Apps ¹⁰ Food Safety → HACCP ¹⁵	business management ⁵⁰ haccp ⁷⁶ registration ⁴³⁶⁶ app ⁴⁵⁹⁵	North-Brabant → Zundert ⁷⁵⁶
greenmaster.nl	9 Knots Solutions B.V.	The software package consists of various modules, such as inventory and supply management.	Applications → Business Applications ¹¹⁰ Agriculture → Horticulture & Floristry ¹⁴⁰⁴	nursery ⁹²⁶ inventory ¹⁶¹³ report ⁴⁵⁵¹ sale ⁵⁹³⁰ software ⁸²⁹¹
adfactory.nl	AdFactory International	The website utilizes a modular system, encompassing AdFactory, RedaFact, and AdOnline, each offering distinct functionalities.	Business Software → Business Process Management ³³³ Logistics → Inventory Management ¹⁰⁰	workflow ⁴⁰⁷	Gelderland → Arnhem ⁸⁶⁸⁰
sufficio.nl	Sufficio	Sufficio offers a range of modules for environmental, labor, and risk management that directly align with current market and legislation.	Law → Environmental Legislation ⁹⁹ Insurance & Risk → Risk Management ¹⁰⁶⁰	environmental legislation ¹⁰ compliance ⁵⁰⁶ risk management ⁵⁴³ database ¹¹⁵³ report ⁴⁵⁵¹
veiligheidspaspoort.nl	Magenta MMT B.V.	The platform consists of eight different modules.	Applications → Business Applications ¹¹⁰ Community → Government & Administration ¹⁰⁵⁶⁷	safety ⁵⁸¹⁹ data ⁵⁸⁷² software ⁸²⁹¹
nederpelt.nl	Nederpelt Software	Elvy consists of five possible modules, including invoice processing, expense processing and purchasing management.	Technology → SMB ¹²⁷	financial administration ²⁰¹ implementation ¹⁰²⁹ software ⁸²⁹¹	Westland → Wateringen ⁵³⁶
jarda.nl	Dymago	The website offers a variety of free modules to enhance the functionality of the websites built using Jarda CMS.	Web Design → Website Builders ⁸⁸⁸ Online & Digital → Internet Services ¹⁰⁰⁴	cms ⁶¹³ domain name ¹²⁰³ hosting ³¹²⁵ software ⁸²⁹¹
inspin.nl	inSpin websites	inSpin websites offers a specific website building module for plus classes, consisting of a series of lessons.	Online & Digital → Digital Services ¹⁰⁰⁸	application ³³⁷⁷ print ⁵⁵¹¹ technology ⁶⁸¹⁶
e-ol.nl	Efficiency Online	The website offers various modules that can be applied to specific customer needs.	Legal & Administration → Business Support ⁴⁸⁸ Technology → Software Solutions ²¹⁵	framework ²⁸³ customization ¹⁷²³ software ⁸²⁹¹
vastware.nl	Vastgoed Software b.v.	Vastware offers various modules to cover specific PMO needs.	Software → Real Estate Software ¹⁰⁰ Energy → Energy Management ⁵⁰⁴	report ⁴⁵⁵¹ software ⁸²⁹¹
droomloopbaan.nl	Droomloopbaan	The platform utilizes various modules, such as a talent module and a selection matrix, to improve guidance.	Educational Innovation → Digital Tools ⁶³ Business & Management → Educational Management ³⁷⁵	file ⁴⁴⁵ mentor ⁵²⁹ portfolio ⁶⁸⁵⁴ student ⁷⁶²³
shopro.nl	Shopro	The website describes numerous modules, such as a quote module, a customer portal, and a marketing tool.	Online Marketing → Affiliate Marketing ²⁹⁹ E-Commerce → E-Commerce Platforms ⁴¹⁰	integration ¹⁴⁵¹ webshop ⁸⁶⁴⁸
vastgoedflow.nl	VASTGOEDflow B.V.	The software offers various modules specifically tailored to the needs of real estate professionals.	Software → Real Estate Software ¹⁰⁰ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	connection ⁴⁰⁰⁷ real estate ⁴⁹⁸¹ portfolio ⁶⁸⁵⁴ software ⁸²⁹¹	Drenthe → Hoogeveen ²²⁹⁴
caokraker.nl	Poliskraker	A specific module, CAO-kenmerken, offers detailed information on 75 common CAOs for advisors.	Business Software → HR Software ⁶⁴⁹ Employment Law → Employment Contracts ³⁸	cao ²³⁷ api ²⁷⁶ database ¹¹⁵³ data ⁵⁸⁷²
recruitgenius.nl	Recruit Genius	The website describes various modules, such as billing and AI-driven sourcing tools, which simplify the recruitment process.	HR Software → Recruitment Software ⁷⁹	ats ²⁸ data analysis ²¹¹ integration ¹⁴⁵¹ customization ¹⁷²³
voipexpress.nl	VoIP Express	With various modules, phone service can be flexibly adapted.	Telecommunications → VoIP ²⁹⁷ Communication → Telephony ³³⁹	number ¹⁹⁹ telephony ⁴⁹⁴ network ¹¹¹²³
cloudesign.nl	Cloudesign	Modules and plugins can be added to expand the functionality of the website.	Web Development → Content Management Systems ⁵⁰² Online & Digital → Internet Services ¹⁰⁰⁴	backup ⁴⁹⁴ template ⁷⁴² hosting ³¹²⁵ security ⁶⁶⁵⁵
educatetoday.nl	Educate Today BV	The website describes various educational modules developed by Educate Today BV.	Online Courses → E-Learning ⁶⁰⁶ Business & Management → Educational Consulting ⁵⁶¹	learning ⁹²⁰ education ¹³⁴⁷¹ workshop ¹⁹³²⁵
projectcomfort.nl	ProjectComfort B.V.	ProjectComfort offers different functional modules, including information management and financial management.	Business Software → Project Management Software ⁶⁵ Online & Digital → Digital Services ¹⁰⁰⁸	portfolio ⁶⁸⁵⁴
voip4me.nl	Voip4Me	Voip4Me offers various modules that customers can enable and manage via an online management environment.	Telecommunications → VoIP ²⁹⁷	phone number ¹⁴⁰ number ¹⁹⁹ voip ⁴²⁵
workmate.nl	Workmate	The software offers various modules, such as accounting and CRM, which are optimized for the needs of installation companies.	Business Software → Accounting Software ⁹⁸⁴ Business Software → ERP Systems ¹⁰⁰⁷	erp software ²⁹ work order ³² customer portal ¹⁴¹ cloud solutions ²⁸¹ installation ¹³⁷⁴²
engager.nl	Engager	The platform is built from various modules that work together to create a complete digital community.	Technology & Tools → Marketing Technology ³² Social → Social Media ²⁰⁸⁰	community ⁷⁹³¹ event ⁴⁵¹⁹⁹
magiwise.nl	MagiWise	The learning method is divided into three modules.	Primary Education → Mathematics ⁶⁰⁶	math ¹⁵⁹ tablet ⁹⁹⁸ language ²⁰¹⁶ app ⁴⁵⁹⁵ education ¹³⁴⁷¹
freelux.nl	Freelux	The website offers Zigbee modules for seamless integration into smart home systems.	Lighting → Smart Lighting ²¹ Technology → Smart Home & Automation ¹¹⁴⁶	dimmer ³⁶ switch ¹⁴⁰ light ⁵¹⁴⁸ assortment ⁷⁷⁹⁹
hypex.nl	Hypex Electronics	The NCORE x ® Mains Powered Family consists of amplifier modules that utilize advanced power supply technology.	Audio → Audio Equipment ⁵⁴⁷ Manufacturing → Electronics Manufacturing ¹⁵	dsp ¹³ oem ³¹ amplifier ³⁰² technology ⁶⁸¹⁶
megasites.nl	Sander van Veldhoven	The service provider offers various modules within TOPdesk, such as incident management and change management.	Business Software → Accounting Software ⁹⁸⁴ Management → Lean Management ²⁶⁷	environment ⁴⁸⁷³
inm.nl	INM	The teaching is modular.	Professional Education → Legal Education ¹⁰²	notary ⁷⁹¹ legal ⁹³⁷ teacher ²⁸⁹⁰ education ¹³⁴⁷¹ course ¹⁴⁷²⁸
besteoefeningenthuis.nl	besteoefeningenthuis.nl	The program is divided into three modules that offer a structured approach.	Fitness → Home Fitness ⁸⁹ Body & Movement → Exercise ¹⁰⁰⁵	exercises ¹⁰⁵⁸ confidence ¹¹⁶³ fitness ²²⁵¹
campenco.nl	Camp & Co	Camp & Co sells various camper modules, such as awnings and screens, to improve the functionality of the camper.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹	bus ⁸⁹⁴ camper ¹⁵⁹⁶ model ³⁵⁴⁶
vybedrums.nl	Vybe Drums	The website also stocks drum modules, essential components for electronic drum kits.	Music → Instrument ²⁸⁵⁰	cymbal ¹¹ hardware ⁹⁴¹ accessories ¹²⁹⁷⁵
opencircuit.nl	Opencircuit	The site sells motor driver modules and IoT modules	Retail & Commerce → Retailers ⁷⁵⁴ Electronics & Components → Retailers ¹⁰	filament ⁷⁷ arduino ¹²³ kit ⁵²⁶ drone ⁹³⁶ electronics ⁹⁷¹
gameskool.nl	Gameskool	Modules are smaller, separate parts of a larger whole, such as a course on Gamedesign.	Programming Languages → C ²³	programming ⁵⁷⁵ course ¹⁴⁷²⁸
mindonly.nl	Mind Only	The website describes various modules focused on developing specific skills.	Training → Lectures ¹⁷¹ Spirituality → Buddhism ³⁴⁵	buddhism ⁸⁶ masterclass ⁴¹⁹ psychology ⁷⁷⁷ lecture ¹⁶²⁴ course ¹⁴⁷²⁸
topforma.nl	TOPFORMA	TOPFORMA develops educational modules and projects.	Content & Communication → Copywriting Agencies ¹⁹ Primary Education → Educational Materials ⁷¹¹	publisher ⁷⁵⁷ text ²⁴⁶⁷ webdesign ⁴⁰⁹² education ¹³⁴⁷¹
nopulp.nl	No Pulp	The system utilizes ready-made software modules that can be easily adapted.	Business Software → ERP Systems ¹⁰⁰⁷ Logistics → Supply Chain ⁷⁹¹	erp ³⁶³ cloud ¹⁵²⁷ logistics ³²⁵⁷
wolvex.nl	WolveX.nl	The website offers a variety of modular components for building customized mesh networks.	Radio & Communication → Telecommunications ¹³⁶¹ Virtual & Augmented Reality → Internet of Things (IoT) ¹⁰⁵	solar energy ³⁷³ sensor ⁴⁸²
pratenovergezondheid.nl	POG research group of Applied Health Research (TGO) of the UMCG	The website develops and launches new modules focused on specific topics.	Research → Healthcare Research ¹⁸ Patient Services & Rights → Patient Information ¹⁵⁸	patient organization ¹⁶ umcg ²⁵ health ⁶³⁶⁶ research ⁸⁹⁶⁷
creavidesign.nl	CréaviDesign	Supplementary modules, such as webshops and SEO, can be easily added.	Online Marketing → Website Management ³⁶⁹	logo ⁴⁶⁶⁰ course ¹⁴⁷²⁸
isa-power.nl	ISA Power	The website offers various online modules focusing on different aspects of recovery, such as social resilience and self-image.	Mental & Emotional Well-Being → Eating Disorders ¹⁹⁹	eating disorder ⁵⁵ buddy ¹³³ workshop ¹⁹³²⁵ treatment ²¹²⁰³ coach ²⁵⁸¹⁰
modelspoorverenigingdrachten.nl	Modelspoorvereniging Drachten e.o.	Members can build modules according to the Fremo standard, which is an option for people without sufficient space for a full model layout.	Model Building → Model Railroading ²⁷³	membership ¹⁰⁴⁴²	Smallingerland → Drachten ²⁰⁵²
leefmeteczeem.nl	Leef! met eczeem	The training is divided into five modules, each addressed with various media.	Disease & Treatment → Skin Diseases ²⁹	healthcare provider ⁴⁷⁴ training ²⁸¹³³
euchner.nl	Euchner	Euchner introduces new MBM EtherCAT-bus modules with L-coded M12-power connectors.	Manufacturing → Machine Building & Parts ³² Industrial → Industrial Automation ¹⁰⁴²	machine safety ³⁴
otronic.nl	Otronic	Otronic sells electronic modules that are often used when building projects and prototypes.	Audio → Components ⁴⁸⁹ Electronics & Components → Microcontrollers ¹²	microcontroller ⁴⁵ arduino ¹²³ sensor ⁴⁸² kit ⁵²⁶ component ⁷¹⁴	Haarlemmermeer → Hoofddorp ²⁷³⁹
allinx.nl	Allinx	The Odoo software consists of different modules that are designed to work together.	Business Software → ERP Systems ¹⁰⁰⁷	odoo ³⁸ erp ³⁶³ crm ⁵⁹¹ implementation ¹⁰²⁹ software ⁸²⁹¹
mbaopslippers.nl	MBA op Slippers	The course is offered through 5 in-depth modules, focused on practical knowledge and application.	Online Courses → E-Learning ⁶⁰⁶ Training → Online Training ³⁴³	pace ⁹² ice cream ¹⁰⁰⁰ leadership ³⁷²⁴
safetylights.nl	Safety Lights	The website describes the effectiveness of specific modules that enhance visibility.	Safety → Road Safety ³⁶ Transportation → Automotive Technology ³¹⁵	headlight ⁸² visibility ⁵⁹⁰ safety ⁵⁸¹⁹ research ⁸⁹⁶⁷
soon.nl	SOON	The site describes various modules within the training, such as the Ambulatory Mental Health Care module.	Government & Administration → Legislation ⁴³² Research & Academia → Medical Education ¹⁸³	aios ¹⁸ congress ⁵⁰⁰ research ⁸⁹⁶⁷ training ²⁸¹³³
klimapedia.nl	KLIMAPEDIA	The website offers various modules focused on building physics and related fields.	Human Resources → Pension Administration ¹⁰ Vocational Training → Technical Education ²¹⁵	knowledge bank ⁹⁹ publication ²⁰¹⁸ research ⁸⁹⁶⁷
syntri.nl	Syntri	Syntri offers a modular ERP solution, meaning users can select only the modules they need.	Business Software → Business Process Management ³³³ Business Software → ERP Systems ¹⁰⁰⁷	traceability ⁵⁹ erp ³⁶³ manufacturing ³⁹⁶ workflow ⁴⁰⁷ implementation ¹⁰²⁹
provadie.nl	Provadie	Users can purchase extra modules to supplement the functionality of Provadie.	Business Software → Administrative Software ¹⁵⁸	file ⁴⁴⁵ record ¹⁰⁹⁸ task ¹⁵⁰⁷
debaasopinternet.nl	De Baas Op Internet	The lesson program is divided into six modules, each addressing specific aspects of the internet.	Pedagogy & Methods → Project-Based Learning ²¹ Curriculum & Resources → Educational Resources ⁴⁰¹	digital literacy ⁶⁸ internet ¹⁶⁷⁸ data ⁵⁸⁷² child ¹¹⁵⁶⁶
logres.nl	Logres Business Solutions	The website describes various modules within SAP Business One, including CRM, Finance, and Inventory Management.	Business Software → Business Process Management ³³³ Business Software → ERP Systems ¹⁰⁰⁷	consultant ⁷⁰⁶ implementation ¹⁰²⁹ integration ¹⁴⁵¹
easytowork.nl	Easy to Work	The website mentions standard modules like CRM, procurement, and invoicing that can be deployed quickly.	Enterprise Solutions → Business Systems ⁹¹ Software Development & Engineering → Low-Code Development ⁵⁹	integration ¹⁴⁵¹ application ³³⁷⁷ report ⁴⁵⁵¹
site-supply.nl	Site-Supply	The CMS consists of different modules that users can activate.	Web Design → Website Builders ⁸⁸⁸	cms ⁶¹³ database ¹¹⁵³ newsletter ⁶⁵⁰⁴ webshop ⁸⁶⁴⁸
ursem.nl	Ursem Modulaire Bouwsystemen	The website describes and presents modular building units (modules) used for housing construction projects.	Construction Companies → Residential Construction ¹⁰¹³ Construction → Building Systems & Services ⁵⁵⁹	housing ⁴³⁷⁸ production ⁴⁵⁸² construction ⁷⁴²¹ sustainability ¹⁸⁴⁵¹	Amsterdam → Nieuw-West ⁸⁴⁴
kenniscentrumbos.nl	Kenniscentrum B.O.S.	Training modules can be delivered as workshops.	Corporate Training → Internal Training ¹⁰ Business & Management → Administration ²⁰	diploma ⁷⁹⁵ employee ⁴⁴²⁹ finance ⁵³⁴¹ administration ⁶⁵⁸⁷ training ²⁸¹³³
regiogooi.nl	Scouting Regio het Gooi	The website offers information on training modules for leaders and boards.	Youth Organizations → Scouting ¹⁰⁰⁴ Applications → Sports Software ¹²	region ⁵⁴¹²	Gooise Meren → Bussum ²²⁰¹
ktv-kennisnet.nl	KTV Kennisnet	The website offers various lessons modules, recorded by experts in different areas.	Training → Language Training ¹³² Communication → Interpreting ²⁶⁵	hostess ¹⁶⁵ webinar ⁸⁷⁰ course ¹⁴⁷²⁸ training ²⁸¹³³	Gelderland → Nijkerk ³⁶⁰⁸
travelimpact.nl	Travel Impact	Each country has six modules, offering a structured approach to learning about a destination.	Food → Culinary Travel ⁴³ Planning → Travel Planning ⁷¹⁶	country ⁵³⁰ destination ²⁵⁸⁰ travel ⁷²¹⁰ course ¹⁴⁷²⁸
decodershop.nl	Decodershop	A module is a component used in a digital TV system.	Entertainment → Television ¹¹³⁴ Technology → Electronics & Components ¹¹²⁶¹	decoder ¹⁶ phone ¹¹⁶³ radio ¹²⁰⁰ card ¹⁹⁷⁵
ikwildokterworden.nl	Ikwildokterworden.nl	The website introduces a new online module, ‘Decentralized Selection Help,’ to support students’ preparation.	Disease & Treatment → Medicine ¹⁰¹⁷	faculty ⁵³ medicine ⁴³⁵ study ⁷²⁰ forum ¹³⁶²
eenpansgerechten.nl	eenpansgerechten.nl	The website offers various modules with solutions for frequently asked questions.	Internet → Forums & Communities ¹⁵⁹⁹ Food → Cooking & Recipes ³⁹⁸⁹	lottery ²⁰⁷ forum ¹³⁶² recipe ⁵¹⁴² shop ⁶⁴⁸³ community ⁷⁹³¹
colorgems.nl	Colorgems	The Colorgems Chameleon flashlight can be equipped with various lamp heads and UV modules.	Retail & Supplies → Specialty Retail ³⁴⁷ Technology → Electronics & Components ¹¹²⁶¹	uv lamp ¹³ flashlight ⁵⁶
etilex.nl	Etilex	Etilex’s factory hall produces wooden modules for various projects, including row houses.	Real Estate → Project Development ⁶³³ Fabrication & Production → Prefabrication ⁴¹²	facade cladding ³⁸⁴ prefab ⁴¹⁷ packaging ²²³⁶ wood ⁴¹⁵³	West-Maas en Waal → Boven-Leeuwen ⁹⁴
upotential.nl	Upotential	Upotential provides online learning modules to help users optimize their health and potential.	Training → Online Training ³⁴³ Online Courses → E-Learning ⁶⁰⁶	mindfulness ¹⁷⁸⁹ health ⁶³⁶⁶ therapy ⁷⁴⁴⁸ coach ²⁵⁸¹⁰
unitedhope.nl	UcoDiaoCMS	The 'USSP0100' module is identified as a source of errors.	Programming Languages → PHP ⁴⁰⁰ Software Development & Engineering → Content Management Systems ¹⁷	error ⁸⁷ function ²²¹ php ²⁸² cms ⁶¹³ template ⁷⁴²
webbureauholland.nl	Webbureau Holland	The Drupal platform supports an extensive library of 20,000 modules.	Content Management Systems → Drupal ¹⁷ Software → Open Source ²¹⁰	drupal ⁸⁰ hosting ³¹²⁵ maintenance ²⁰⁰⁹³
mechatec.nl	Mechatec BV	Mechatec's machines can be easily expanded with various modules.	Machinery & Repair → Machinery ¹⁰⁴⁵ Lifting Equipment → Transportation Equipment ²⁴⁷	box ¹⁹⁸² logistics ³²⁵⁷ machine ³⁷²⁷	Noordoostpolder → Tollebeek ⁵⁰
software-voorraadbeheer.nl	Silvasoft	The website offers various modules, such as inventory and warehouse management.	Logistics → Inventory Management ¹⁰⁰	warehouse ¹⁰²⁷ dashboard ¹³⁷⁴ inventory ¹⁶¹³ purchase ²²¹²
fytarom.nl	FytArom	Students can further expand their knowledge and skills by taking individual modules.	Alternative Medicine → Aromatherapy ²⁴¹ Products → Natural Products ¹⁸⁴	aromatherapy ³⁰⁵ scent ³³³ essential oil ⁴²⁸ course ¹⁴⁷²⁸
bijnenassurantie.nl	Assurantiekantoor Rien Bijnen	Various modules and tools are available for calculating mortgages and evaluating financial possibilities.	Insurance → Damage Insurance ¹⁸⁴ Personal Wealth → Pensions ⁸⁵⁶	pension ¹⁶⁸² mortgage ⁴⁵⁶⁴ finance ⁵³⁴¹ insurance ⁶³⁵⁹
diviwebsite.nl	Divi Website Builder	Divi offers a diverse selection of modules that can be used to create dynamic and engaging web content.	Web Design → Website Builders ⁸⁸⁸ Web Development → CMS ⁵¹⁶	divi ⁴⁴ template ⁷⁴² theme ⁴⁰¹⁵
jijplus.nl	JijPlus	The website offers a diverse selection of individual modules that users can choose and combine.	Corporate Training → Safety Training ⁷⁴⁵ Management → Human Resources Development ¹²⁴	practical ⁶⁶ e-learning ⁵⁸⁰ logistics ³²⁵⁷ certification ³³⁸⁰ training ²⁸¹³³
elektrocentrale.nl	LED Centrale	LED modules are offered for advertising and specific applications.	Lighting → LED Lighting ⁵⁷⁴	spotlight ⁸² emergency lighting ¹⁷⁶ lead ¹¹⁹⁵ light ⁵¹⁴⁸	Land van Cuijk → Boxmeer ⁸⁶¹
caiqueworkshop.nl	CaiqueWorkshop	The workshop is divided into 26 modules, each covering a specific aspect of Caique care.	Birds → Parrots ⁴⁸	behavior ¹⁷⁷⁹ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵ training ²⁸¹³³
arbeidalsmedicijn.nl	Work as Medicine – The Lab	The ‘Work as Medicine’ module is a central tool to integrate the topic of work structurally into guidance and treatment.	Employment & Labor → Work ³³⁶² Health → Mental & Emotional Well-Being ²³⁷⁰⁴	lab ⁶⁶ work ³¹²²
kaderloos.nl	Kaderloos	The training and workshops are offered in flexible modules, adaptable to specific needs.	Spirituality → Spiritual Development ²⁷⁸	change ²⁵⁸⁰ workshop ¹⁹³²⁵ coach ²⁵⁸¹⁰
ecosim.nl	Ecosim	Ecosim consists of a base software package supplemented with various modules that can be installed and played within the program.	Software → Simulation ⁴⁷ Curriculum & Resources → Educational Resources ⁴⁰¹	simulator ¹⁸⁰ download ²⁸⁷ software ⁸²⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
scantoeristischondernemerschap.nl	Scan Toeristisch Ondernemerschap	There are eight modules available that cover different aspects of the business.	Administrative Support → Business Operations ¹¹⁵⁶ Travel → Tourism ³⁷⁵⁴	holiday park ⁵⁶⁶ insight ⁶²⁸ guest ¹³³⁴ entrepreneurship ¹⁵⁷⁹
kwekerijwesstein.nl	Kwekerij Wesstein	The nursery offers three modules: Day Trade, Garden Center, and Retail, to meet customer needs.	Gardening → Plants ²⁸⁶⁷	fuchsia ¹³ nursery ⁹²⁶ assortment ⁷⁷⁹⁹	Rotterdam → Hoek van Holland ⁵⁴⁰
itpartner.nl	IT Partner B.V.	The software suite comprises a set of innovative modules for Container, RoRo, and General Cargo handling.	Business Software → Logistics Software ¹⁰³ Transportation → Transportation Management ⁷⁰	tos ¹⁷ container ¹⁷⁰⁹
socomec.nl	Socomec Netherlands	Various modules are offered, such as modular UPS systems and additional modules for energy distribution.	Energy → Electrical Energy ³⁶ Technology → Electronics & Components ¹¹²⁶¹	switch ¹⁴⁰ sensor ⁴⁸² software ⁸²⁹¹
leefmetvoedselallergie.nl	Leef! met voedselallergie	The training is divided into six modules, each with specific information and exercises.	Nutrition → Dietetics ⁸¹⁶ Disease & Treatment → Allergies ¹⁵⁷	food allergy ¹¹ reaction ⁷⁶ diagnosis ¹⁴⁹⁰ training ²⁸¹³³
ouderwordenmeteenbeperking.nl	CP Netherlands and SBH Netherlands	A free learning module has been developed to help seniors improve their health and well-being.	Social Services → Seniors ⁸²² Care → Personal Care ⁵⁹²	age ²⁵⁶ resilience ¹⁰⁹¹ pain ¹⁹¹⁹ care ¹²³³⁸
kirami.nl	Kirami	Kirami FinVision® saunas and modules offer unlimited possibilities for garden design and are considered the work of true specialists.	Services → Hot Tubs ¹²⁶ Spa → Saunas ⁹²⁰	hot tub ²⁶⁰ sauna ¹¹⁷⁵ accessories ¹²⁹⁷⁵
systeemgerichtwerkeninsocialeberoepen2edruk.nl	Boom Uitgevers Amsterdam	The content is structured into different modules that cover different aspects of systemic work.	Adult & Continuing Learning → Professional Training ¹²²⁴ History → Social Sciences ¹⁰⁷⁸⁶	exercises ¹⁰⁵⁸ teacher ²⁸⁹⁰ student ⁷⁶²³
praktijkbeoordelaar.nl	MBO raad Techniek en gebouwde omgeving	Three modules with videos, animations, and quizzes form the core of the online learning environment.	Medical Care & Services → Psychiatry ⁷⁵⁶	practitioner ¹²⁷ examination ⁴²⁹
qnect.nl	Kader	Qnect offers various modules such as RI&E, complaint management, and incident management, which are integrated into one platform.	Enterprise Solutions → Business Solutions ²⁴ Insurance & Risk → Risk Management ¹⁰⁶⁰	qhse ¹¹ compliance ⁵⁰⁶ template ⁷⁴² risk ²⁸⁹⁶
e-learning-begeleiding-in-geld.nl	Not Specified	The e-learning course is divided into several modules, such as 'Scarcity and Behavior' and 'Budget in Order'.	Social Issues → Poverty ¹⁸⁰ Online Courses → E-Learning ⁶⁰⁶	course material ¹⁹ poverty ²⁹¹ knowledge base ⁵⁶⁹ webinar ⁸⁷⁰
greenskills.nl	Greenskills	The training programs can be expanded with additional modules to meet specific needs.	Training → Language Training ¹³² Vocational Training → MBO ⁶⁹⁰	bbl ⁵² license ¹²⁸⁸ teacher ²⁸⁹⁰ course ¹⁴⁷²⁸ training ²⁸¹³³
roosterplaats.nl	Roosterplaats	The ‘medewerker toegang’ module (employee access) provides additional features like leave requests and time tracking.	Business Software → HR Software ⁶⁴⁹ Business Software → Scheduling Software ⁵²	scheduling ²⁶¹ employee ⁴⁴²⁹ software ⁸²⁹¹
riemaken.nl	IMA	Users can add specific modules to their RI&E, allowing the tool to be customized to their specific needs and industry.	Risk & Safety → Tools ⁶² Insurance & Risk → Risk Management ¹⁰⁶⁰	ri&e ⁹⁶ action plan ¹³⁸ questionnaire ⁶⁶⁶ risk ²⁸⁹⁶
biobusinessmasterclass.nl	BioBusiness Masterclass	The program utilizes six comprehensive modules to cover all essential aspects of biobusiness, ensuring a thorough understanding of the field.	Investing → Cryptocurrency ⁷⁷⁶ Networking & Collaboration → Starting a Business ²⁷⁴	startup ³⁷⁶ business plan ³⁸⁷ masterclass ⁴¹⁹
kitchr.nl	Kitchr	Kitchr offers various modules, including invoicing and customization options.	Applications → Business Applications ¹¹⁰ Business → Industry ³⁶⁹⁷⁷	scheduling ²⁶¹ technician ⁸¹⁵ software ⁸²⁹¹
vitaopleidingen.nl	Vita Opleidingen B.V.	The Life Science Therapist professional course consists of five modules for which separate exams can be taken.	Alternative Medicine → Shiatsu ⁸³⁰ Adult & Continuing Learning → Professional Development ²⁰⁸⁰	intervisie ⁶⁹ lecture ¹⁶²⁴ therapist ¹⁸⁹⁰ course ¹⁴⁷²⁸	Flevoland → Zeewolde ¹²⁴³
hetdietistischconsult.nl	Boom uitgevers Amsterdam	The website is divided into various modules, such as conversation skills and dietary assessment.	Nutrition → Dietetics ⁸¹⁶ Driver & Vehicle → Continuing Education ⁴⁵⁴	teacher ²⁸⁹⁰ consulting ³⁶³⁹ video ⁶⁷¹⁴ book ¹¹³⁹⁶
jpec.nl	Joost Plugge Engineering	The company has designed completely new modules for several Quad models, demonstrating their adaptability.	Audio → Audio Equipment ⁵⁴⁷ Audio → Amplifiers ¹¹³	amplifier ³⁰² restoration ³⁴¹⁷	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
ecocircus.nl	Ecocircus	It consists of a selection of rental modules from Groeninnovations.	Galleries & Exhibitions → Art Routes ²¹⁵ Environmental Studies → Environmental Education ¹²⁹	circus ¹⁵⁸ ecosystem ²⁶² facility ²⁶¹⁶	Gelderland → Wageningen ¹⁹⁴⁹
modulebaan.nl	Modulebaan.nl	Each participating module must adhere to a certain set of standards to function properly.	Hobbies → Model Building ¹⁰⁰⁷ Internet → Forums & Communities ¹⁵⁹⁹	builder ⁷⁹ forum ¹³⁶² message ²²⁶⁰ member ¹⁰¹⁵⁴
novito.nl	Novito	Novito designs and produces its own modules for the construction of homes, making the construction processes more efficient and faster.	Homeownership & Management → Housing Corporations ⁴²⁶ Renovation & Restoration → Construction Industry ⁴⁹⁹	flexible housing ¹³ factory ⁵²⁶ target group ⁵⁷⁸ housing ⁴³⁷⁸	Twenterand → Vriezenveen ⁴⁸⁷
flytool.nl	IQS-TOOL	The application offers a variety of modules, such as SMS and PFS, to cater to diverse aviation needs.	Law → Environmental Legislation ⁹⁹ Air Services → Aviation ⁴⁴⁴	logbook ⁷⁹ regulation ¹³⁵⁰ safety ⁵⁸¹⁹ data ⁵⁸⁷²
sitetoedit.nl	BROSIS IT	The CMS offers various modules such as webshops and contact forms.	Web Development → CMS ⁵¹⁶ Web Development → Content Management Systems ⁵⁰²	cms ⁶¹³ template ⁷⁴² domain name ¹²⁰³
greenvve.nl	Green Nederland Vastgoedmanagement B.V.	GreenVvE offers tailored support based on specialist modules.	Homeownership & Management → Homeowners Associations ⁵⁴⁶ Energy → Energy Saving ¹¹⁵¹	energy saving ⁵⁹⁹ vve ⁷⁴⁸ real estate ⁴⁹⁸¹ sustainability ¹⁸⁴⁵¹	South-Holland → The Hague ¹⁹⁸⁹⁸
learnpal.nl	Learnpal	The website provides over 70 modules that cover the essence of palliative care, which are useful for caregivers.	Medical Care & Services → Palliative & End-Of-Life Care ¹⁶⁶⁹	palliative care ¹⁴⁰ caregiver ¹¹⁶⁷ patient ⁴⁰⁸² student ⁷⁶²³
pelkedu.nl	Pelk Edu	The website offers various modules focusing on practical skills within the home care sector.	Online Courses → E-Learning ⁶⁰⁶ Training → Online Training ³⁴³	manager ³⁰² home care ⁸²⁷ certification ³³⁸⁰ employee ⁴⁴²⁹ app ⁴⁵⁹⁵
forensischeleerlijn.nl	Churchilllaan	The website includes various modules focusing on different aspects of forensic care.	Law → Criminal Law ¹⁸⁰³ Online Courses → E-Learning ⁶⁰⁶	pathway ⁴⁴⁷ care ¹²³³⁸ news ¹⁵²⁹³ collaboration ¹⁶⁰³⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
moregrip.nl	MOREGRIP	The software consists of various modules that support business functional processes.	Technology → Business Automation ⁷³	business processes ⁵⁶⁴ software ⁸²⁹¹	North-Holland → Heemskerk ¹¹¹¹
promasy.nl	Promasy	The software package consists of several modules that can be used independently of each other.	Logistics → Inventory Management ¹⁰⁰	inventory ¹⁶¹³ vehicle ³⁷⁴³ part ⁵⁰⁴⁴ software ⁸²⁹¹
installonline.nl	Installonline	Distribution boxes are available in different module widths (12, 18, 24, 36, 48)	Lighting → LED Lighting ⁵⁷⁴ Installation & Fixings → Installation Materials ²⁴⁷	distribution box ⁴¹ waterproof ⁹⁸ home automation ³⁷⁶ installation ¹³⁷⁴²	North-Brabant → Bergeijk ⁷⁷⁵
gradez.nl	Gradez	Gradez is based on three clear modules, each covering a specific aspect of cleaning quality.	Customer Relations → Customer Satisfaction ¹²³ Logistics & Transport → Business Tasks ¹¹	customer satisfaction ⁵²⁸ subscription ³²⁸⁷ cleaning ⁴⁵⁶⁷
naupro.nl	NauPro	The website offers various supplementary modules, such as radio communication and fast boating, to further expand employees’ skills.	Transportation → Water Transport ⁶⁶ Marine & Shipping → Maritime ¹⁰²²	arbowet ²⁸ boat license ³⁴ vessel ²⁶² certificate ¹⁰³⁶ training ²⁸¹³³
bouw-tekenburo.nl	Bouw-tekenburo Wietse B. Ligthart	The ModuulZeroWonen© concept is based on the use of different modules to build a house.	Architecture → Architectural Services ¹⁰⁰⁶ Software Development & Engineering → Digitalization ²⁷⁶	construction ⁷⁴²¹ house ⁸¹²¹	Southwest-Friesland → IJlst ¹⁵⁷
autismepraktijk-alice.nl	Autismepraktijk Alice	Autismepraktijk Alice offers various training modules, including ACT and SSP.	Mental & Emotional Well-Being → Autism ⁹⁵⁸ Education → Special Needs & Support ⁶³⁷²	lecture ¹⁶²⁴ blog ¹³³⁹²	Limburg → Voerendaal ³¹²
dutchlabourlaw.nl	Dutch Labour Law & HRM	The learning path is structured into seven modules, each providing focused instruction on a distinct area within Dutch employment law and HRM.	Business Software → HR Software ⁶⁴⁹ Body & Movement → Preventative Care ³⁴⁴	hrm ³¹⁰ netherlands ¹³⁷⁶ workshop ¹⁹³²⁵
gripatwork.nl	GRIPatwork	GRIPatwork offers various modules that are used by experts to improve business processes.	Management → Processes ⁴¹ Management → Business Optimization ¹⁹⁵	scan ⁷⁹⁰ report ⁴⁵⁵¹
eiswijzer.nl	Eiswijzer	Eiswijzer can be expanded with various useful modules.	Business Software → Online Tools ³⁹⁶ Automotive → Financing ¹⁵⁶⁹	reimbursement ⁴⁶⁵ policy ²¹⁴⁹ contract ²⁴¹⁵ finance ⁵³⁴¹ membership ¹⁰⁴⁴²
sfeervollekeuken.nl	Sfeervollekeuken.nl	Ready-to-assemble modules are the product customers can directly order.	Bathroom → Sanitary Ware ⁸⁴⁵	decor ⁹⁴⁵ appliance ⁹⁵⁶ kitchen ⁶⁴⁴³ accessories ¹²⁹⁷⁵ design ²⁷²⁰²	Hardenberg → Collendoorn ¹²
richartdesign-bruiloftstyling.nl	Rich Art Design Wedding Styling	The wedding styling is divided into different modules, varying in price and size.	Weddings → Bridal Styling ¹⁵⁴ Garden → Artificial Plants ⁷³	backdrop ⁴⁶ theme ⁴⁰¹⁵ decoration ⁴⁰⁸⁵	Netherlands → North-Holland ⁹²⁹⁵⁶
newbookcollective.nl	New Book Collective	The software consists of three user-friendly modules focused on revenue, inventory and royalties.	Online Marketing → Promotion ⁶¹⁴ Administrative Support → Business Operations ¹¹⁵⁶	publisher ⁷⁵⁷ promotion ²⁰⁶² sale ⁵⁹³⁰ software ⁸²⁹¹ communication ¹⁰¹⁶²
mikraak.nl	Mikraak Training & Coaching	Mikraak has developed three integrated modules to support communication training.	Management → Team Development ⁶¹⁷ Corporate Events → Team Building ¹⁰⁰⁵	brainstorm ¹⁵⁷ goal ⁴⁹⁷⁴ communication ¹⁰¹⁶² collaboration ¹⁶⁰³⁶	Netherlands → Groningen ²³⁷³⁴
minigarden.nl	Minigarden	The Minigarden systems consist of stackable modules that are easy to install and customize, allowing users to shape their own vertical garden.	Garden → Artificial Plants ⁷³ Gardening → Vertical Gardens ¹⁵	vertical garden ²¹ green wall ³⁷ irrigation ²¹⁵ package ⁶¹¹²
onlineleden.nl	Online Leden B.V.	Various modules, such as member portals and cash systems, increase the functionality of the control system.	Software Development & Engineering → Web Applications ¹⁰⁰⁵	membership management ²² accounting package ⁷⁵ license ¹²⁸⁸ subscription ³²⁸⁷ event ⁴⁵¹⁹⁹
jangro.nl	Jangro Metaal	The company produces modules, likely for various assembly processes.	Trade → Metal Trade ²⁶² Business → Industry ³⁶⁹⁷⁷	sheet metal ²¹⁵ frames ²⁵⁵⁶ production ⁴⁵⁸² design ²⁷²⁰²	North-Brabant → Valkenswaard ¹¹⁷⁹
hollandrabbit.nl	Holland Rabbit	Module sockets are also supplied by the company, ensuring compatibility with diverse electronic modules.	Engineering → Mechanical Engineering ⁷³⁷ Technology → Electronics & Components ¹¹²⁶¹	socket ¹⁴
bouwdirect.nl	BauwDirect	BouwDirect’s unique approach is based on choosing modules for the business premises.	Real Estate → Commercial Property ¹⁸⁴⁰ Project Management → Construction Management ¹⁰³⁸	business premises ¹⁸⁸ price ⁸³²⁸ sustainability ¹⁸⁴⁵¹ design ²⁷²⁰²
verycook.nl	Verycook	The website offers module sets for a complete outdoor kitchen solution.	Garden → Grills ⁶⁵ Outdoor → Barbecues ⁷⁴⁴	trolley ⁵⁷ grill ⁵⁶² accessories ¹²⁹⁷⁵
feli-x.nl	Feli-X	Feli-X offers three-day specialization modules and knowledge colleges.	Wellbeing → Happiness ²³⁶ Professional Development → Teacher Training ¹⁶⁶	happiness ⁶⁵³ vision ¹⁸⁸² teacher ²⁸⁹⁰ education ¹³⁴⁷¹	North-Holland → Amsterdam ⁴¹²⁵³
bema-plaatwerk.nl	Bema plaatwerk	The errors relate to the configuration and functionality of various modules within the application.	Web Design & Development → Web Servers ⁵⁸ Programming Languages → PHP ⁴⁰⁰	validation ⁶⁹ php ²⁸² framework ²⁸³ session ¹⁷⁹¹
praktijkkoekkoek.nl	Praktijk Koekkoek	Users can follow e-health modules via the self-help page.	Medical Care & Services → Psychiatry ⁷⁵⁶ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	waiting time ¹⁴⁰ psychologist ¹¹⁹⁶ practice ⁹⁰⁸⁹ care ¹²³³⁸	Het Hogeland → Winsum ³⁶⁹
blueofficeag.nl	blue office ag	The software features various modules for different functions like cash register management, warehouse management, and relationship management.	Business Software → ERP Systems ¹⁰⁰⁷	erp software ²⁹ order processing ⁴² project management ³⁴²³ report ⁴⁵⁵¹ package ⁶¹¹²
advansor.nl	Advansor	The website describes various modules used in their CO2 systems.	Context → Environment ⁵⁴⁴³⁷ Business → Industry ³⁶⁹⁷⁷	climate solution ³³ heat pump ²⁵⁴¹
richardvandelft.nl	FireMultimedia	The website presents an overview of the most used free Magento modules.	E-Commerce → Magento ³⁸ E-Commerce → E-Commerce Platforms ⁴¹⁰	shopware ¹⁹ magento ¹⁸³ hosting ³¹²⁵ webshop ⁸⁶⁴⁸
leanclinic.nl	Lean Clinic	Short, effective modules provide learning material on a healthy lifestyle.	Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷ Health → Medical Care & Services ²⁹⁴⁶¹	lifestyle program ³¹ questionnaire ⁶⁶⁶ medication ¹¹⁶⁴ doctor ¹³⁹⁷ blog ¹³³⁹²
vertalenfrans.nl	vertalen.nu	An advanced translation module makes it possible to translate sentences from Dutch to French.	Retrieval → Search ³⁷ Language Courses → French ⁸²	french ¹¹¹ english ¹⁸⁵ word ⁵⁶⁷ translation ¹⁵²³ text ²⁴⁶⁷
msvd.nl	MSVD Dronten	The website provides details about building projects of modules, such as a module under construction by Anton.	Model Building → Model Railroading ²⁷³	model railroading ²⁸ locomotive ⁸⁶ bbq ⁹⁰⁸ meeting ²³⁸¹ workshop ¹⁹³²⁵	Flevoland → Dronten ¹⁶⁶⁷
fordbedrijfswageninrichting.nl	Bott	Bott offers numerous building blocks in the form of universal modules that can be used to equip various vehicles.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹ Freight & Logistics → Trucks ⁸⁹⁹	vehicle interior ³⁴ van ²⁰⁰ aluminum ¹¹⁹⁷ safety ⁵⁸¹⁹
hyundaibedrijfswageninrichting.nl	Bott Vario	Bott offers modular interiors that are flexible and adaptable.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹ Lifting Equipment → Transportation Equipment ²⁴⁷	building block ¹⁴ vehicle interior ³⁴ hyundai ³⁷ aluminum ¹¹⁹⁷
renaultbedrijfswageninrichting.nl	Bott	Bott offers numerous building blocks in the form of universal modules for equipping various company vehicles.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹ Lifting Equipment → Transportation Equipment ²⁴⁷	company vehicle interior ¹² aluminum ¹¹⁹⁷ customization ¹⁷²³
quadrepair.nl	QuadRepair	New modules are being developed in collaboration with Joost Plugge for certain models.	Electronics & Components → Audio ²³⁵¹ Fuel & Energy → Electric Vehicles ¹²¹²	quad ⁸³ model ³⁵⁴⁶ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶
denmar-consultancy.nl	DenMar Consultancy	The various modules of Oracle E-Business Suite, such as Order Management and HRMS, provide specific functionalities for different business processes.	Business Software → Business Process Management ³³³ Business Software → ERP Systems ¹⁰⁰⁷	problem ²²¹⁴ consultancy ²⁵⁹⁶
dewetvanaantrekkingskracht.nl	N.V.	The course is divided into five modules, each with a specific focus within the Law of Attraction.	Spirituality → New Age ²⁴³ Training → Online Training ³⁴³	law of attraction ¹¹ dream life ²⁴ course ¹⁴⁷²⁸
ibv24.nl	Vastgoed24	The program is divided into various modules, such as contract management and supplier management, for a structured approach.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Management Software ¹⁴⁶	file management ¹⁰ condition assessment ¹⁷ asset management ³¹⁵ real estate ⁴⁹⁸¹	South-Holland → Delft ⁵³⁰⁹
thuiszorgsoftware.nl	Coolweb Zorgsoftware	The Thuiszorgplanner offers the possibility to add specialized modules, allowing the software to be adapted to the specific needs of the organization.	Software → Healthcare Software ¹⁷⁷ Medical Care & Services → Healthcare Management & Administration ²⁰⁴	bill ¹⁶³ scheduling ²⁶¹ software ⁸²⁹¹ care ¹²³³⁸
steamadvies.nl	STEAMADVIES	The offering includes a range of modules, such as programming, robotics, and making skills.	Technology & IT → STEM Education ²⁴ Education → Educational Policy & Systems ⁵³⁹	steam ¹⁴⁷ implementation ¹⁰²⁹ vision ¹⁸⁸² subsidy ²⁶⁴⁹ education ¹³⁴⁷¹
mydatahouse.nl	My Datahouse	My Datahouse offers various data modules that provide insights into diverse business processes.	Business Software → Accounting Software ⁹⁸⁴ Data Science & Analytics → Data Analysis ¹⁴⁹⁴	forecast ¹¹⁹ dashboard ¹³⁷⁴ finance ⁵³⁴¹ data ⁵⁸⁷²
wmomanagementondersteuning.nl	WMO Momo	The system consists of various modules that can be flexibly added or removed.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸ Social Issues & Welfare → Social Domain ¹³⁴
dairyvent.nl	DairyVent Buisventilatie	A scientific module is used to optimize airflow and prevent drafts.	Livestock → Dairy Farming ⁶⁷¹ Installation & Repair → Ventilation ⁸⁵⁹	duct ³⁵ calf ¹⁵⁰ barn ²⁸² fan ²⁹⁸ cow ⁵⁹⁶
direct-zonnepanelen.nl	Trina Solar	Trina Solar’s solar panels are produced as PV modules.	Shoes → Orthopedic Shoes ⁷¹ Wood & Furniture → Manufacturers ¹⁵⁵	factory ⁵²⁶ certification ³³⁸⁰ solar panels ⁴⁷⁰¹ price ⁸³²⁸
simpelbase.nl	Burggraaf it	The software consists of various modules, each focused on a specific aspect of business operations.	Business Software → Productivity Tools ⁴¹⁶ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	order processing ⁴² invoicing ²⁹² software ⁸²⁹¹ quote ¹²⁸⁶³
bhvr.nl	BHVR	The training is divided into modules, both existing and fully customized.	Virtual & Augmented Reality → Virtual Reality ³⁶¹ Technology & IT → Educational Technology ³⁸⁰	workplace safety ⁵⁰ virtual reality ²⁰³ scenario ²⁸¹ equipment ⁴¹⁴³ training ²⁸¹³³
videostate.nl	Videostate	The course is structured around 10 distinct modules, each focusing on a specific aspect of filmmaking.	Virtual & Augmented Reality → Virtual Reality ³⁶¹ Film → Filmmaking ²²⁰	storytelling ⁶⁴¹ ai ²¹⁸¹ video ⁶⁷¹⁴ course ¹⁴⁷²⁸
premarriage.nl	Premarriage	The website utilizes modules to structure the relationship and wedding preparation information.	Relationships → Relationship Problems ⁶⁴³ Religion → Marriage ²¹²	marriage ²⁰⁹ relationship ⁴²⁰⁵ wedding ⁴²⁵⁸
houvastopschool.nl	Stichting Houvast op School	Specific modules have been developed for different age groups, focusing on topics such as values education.	Primary Education → Learning Resources ¹²⁹ Language Learning → Religious Education ³⁴⁵	pilgrimage ¹⁴⁸ lesson ⁵¹⁵⁴ student ⁷⁶²³
bijbelverhaalspeciaal.nl	Agilo b.v.	The site offers twelve lesson modules, each with specific components for teachers and students.	Christianity → Biblical Studies ³¹³ Education → Special Needs & Support ⁶³⁷²	framework ²⁸³ method ¹⁵⁰⁵ partner ⁴²⁷² education ¹³⁴⁷¹
siteclub.nl	SiteClub.nl	Additional online marketing modules can be purchased later.	Web Design → Website Builders ⁸⁸⁸ Software Development & Engineering → Software ¹¹⁶⁰⁸	hosting ³¹²⁵ price ⁸³²⁸ design ²⁷²⁰²
40fingers.nl	40FINGERS	The service provider offers specialized DNN module development services.	Web Development → CMS ⁵¹⁶ Online & Digital → Digital Services ¹⁰⁰⁸	hosting ³¹²⁵ design ²⁷²⁰²
earthkweek.nl	Earth Kweek	Earth Kweek offers two systems, ‘Circular modules’ and ‘Biobased Growkits,’ serving as building blocks for green roof construction.	Roofs → Green Roofs ¹⁴⁵ Environment → Waste Management ²⁶⁸⁰	natural materials ¹³¹ green roof ²¹⁷ waste ¹³¹²	Tilburg → Berkel-Enschot ⁴¹²
modulairesoftware.nl	Modulaire Software	The product offering includes modules such as HR, field service, and sales, which can be individually added.	Online Services & Platforms → SaaS ¹⁷¹ Management & Consulting → Process Optimization ⁶⁵⁴	results ³⁹⁵⁴ software ⁸²⁹¹
alertverzuimspecialist.nl	Alert Verzuimspecialist	Alert Verzuimspecialist offers modules such as the Coloured Glasses® personality test, to better understand the employee and support their reintegration.	Specialty Medicine → Occupational Medicine ¹²⁹¹ Human Resources → Employee Benefits ²⁴⁵	absence management ⁴⁰ occupational health ⁵² absenteeism ⁴⁶¹ reintegration ¹¹⁵⁷ employee ⁴⁴²⁹
zenosoftware.nl	Zeno Software	The software offers optional modules for additional functionality.	Business Software → Accounting Software ⁹⁸⁴ IT Services & Consulting → Office Automation ¹⁸⁷	server ¹⁰³⁶ database ¹¹⁵³ account ⁵⁷⁸¹ software ⁸²⁹¹
jorsoft.nl	JorSoft B.V.	The MIS system is built from modules that can be individually installed to add functionality.	Business Software → ERP Systems ¹⁰⁰⁷ Logistics → Supply Chain ⁷⁹¹	erp-system ²⁶ webshop ⁸⁶⁴⁸
abilety.nl	Abilety	The training uses online modules, including certificates.	Management → Lean Management ²⁶⁷ Online Courses → E-Learning ⁶⁰⁶	agile ⁴¹⁷ marketing ⁷¹⁰⁷ webshop ⁸⁶⁴⁸ coach ²⁵⁸¹⁰ training ²⁸¹³³
vergelijkingautoverzekeringen.nl	Centraal beheer	The insurance can be assembled independently by selecting various modules.	Insurance → Auto Insurance ⁴³⁹ Comparison → Comparison Tools ¹²⁰	car insurance ²¹¹ premium ⁶⁴³ garage ¹²¹⁰ damage ¹⁵⁶²
beweegjeleefstijl.nl	Beweeg je Leefstijl	There are online modules available on losing weight without dieting.	Online Courses → E-Learning ⁶⁰⁶ Chronic Diseases → Diabetes ³⁴⁹	diabetes ⁷⁵⁰ scan ⁷⁹⁰ lifestyle ²⁹¹⁸ energy ⁹⁰⁷⁵ coach ²⁵⁸¹⁰
cursusreserveringen.nl	i-Reserve	The functionality is built from different modules, such as SMS and online payment.	Online Services → Reservation Systems ²⁶ Software Development & Engineering → Web Applications ¹⁰⁰⁵	dashboard ¹³⁷⁴ integration ¹⁴⁵¹ schedule ²⁶²⁴ course ¹⁴⁷²⁸
smartsonderwijs.nl	Stichting SMARTS Onderwijs	The site contains modules that may relate to the organization's teaching approach.	Social Organization → Child Welfare ¹¹⁴⁷ Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	stichting ⁴⁸¹ newsletter ⁶⁵⁰⁴ education ¹³⁴⁷¹
vvebeheer24.nl	VvE Beheer 24	The company's offering consists of individual modules that allow customers to create a customized management solution.	Business Software → Management Software ¹⁴⁶ Homeownership & Management → Homeowners Associations ⁵⁴⁶	homeowner association ¹³ regulation ¹³⁵⁰ insurance ⁶³⁵⁹ administration ⁶⁵⁸⁷	South-Holland → Noordwijk ²⁵⁰⁷
blauw-ontwerp.nl	BLAUW Ontwerp	The website offers various modules, such as text blocks and social media integrations, for customizable functionality.	Online Services → E-Health ⁶⁹ Software Development & Engineering → Web Applications ¹⁰⁰⁵	form ⁶⁷⁹ gallery ¹⁹⁸³ text ²⁴⁶⁷
plusm2.nl	PlusM2	PlusM2’s floors consist of different modules, making them flexible and adaptable.	Logistics → Warehouse Fitting ¹¹ Building & Materials → Steel & Metal ⁷⁷⁹	mezzanine ³³ warehouse ¹⁰²⁷
nmcbv.nl	NMC BV	The website highlights NMC’s capabilities in constructing and delivering modular solutions for energy projects.	Engineering → Industrial Engineering ²⁷⁰ Engineering → Marine Engineering ¹⁰²	fabrication ⁵⁶ yacht ⁶⁴⁷ engineering ¹⁴⁶⁸ construction ⁷⁴²¹	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
cube-consulting.nl	Cube Consulting	The website offers modules to facilitate learning.	Data Science & Analytics → Data Analysis ¹⁴⁹⁴ Research & Academia → Educational Development ³⁵⁴	trajectory ⁵⁵⁶ knowledge ³⁵²⁸ data ⁵⁸⁷² student ⁷⁶²³ education ¹³⁴⁷¹
app2order.nl	App2Order B.V.	App2Order operates in five logical modules that are easily implementable.	Business Software → Logistics Software ¹⁰³ Hospital & Acute Services → Hospitals ⁷³⁵	csa ²⁷ statistics ³⁹² logistics ³²⁵⁷ app ⁴⁵⁹⁵
deloopbaanopleiding.nl	Dé Loopbaanopleiding	The program consists of 11 modules, some of which can also be taken individually, offering a flexible learning experience.	Vocational Training → MBO Education ²⁴ Driver & Vehicle → Post-Secondary Education ⁴⁰	work ³¹²² coach ²⁵⁸¹⁰
schooltrans.nl	Schooltrans B.V.	Specific retraining modules are scheduled on different dates in 2025.	Driving & Vehicle → Vehicle Training ⁵⁵³	retraining ³⁷ tractor ⁷⁸⁹ certification ³³⁸⁰	Hoeksche Waard → Numansdorp ³¹⁴
scholingsgroep.nl	Scholingsgroep	The platform's content consists of modules with theory, practice exercises and tests.	Career → Career Development ¹⁰⁷⁰ Human Resources → Talent Management ⁵³⁷	course ¹⁴⁷²⁸
rechtsbijstandverzekeringregelen.nl	N/A	Users can customize their insurance by selecting different modules, such as Consumer, Housing or Work.	Personal Wealth → Insurance ²¹⁸³ Legal → Legal Aid ⁴²⁰	compare ⁵⁸² risk ²⁸⁹⁶ insurance ⁶³⁵⁹
renovatieplanner.nl	De Renovatieplanner	The Renovatieplanner provides various modules, such as inspections, forms, and communication, working together to improve project management.	Business Software → Education Software ⁴⁷ Project Management → Construction Management ¹⁰³⁸	forms ²⁴⁴ resident ³²⁴⁵ inspection ⁴²⁷⁹
beau-events.nl	BEAU Events	BEAU Events has developed its own IT module for online speed dates.	Social Media → Dating ¹⁶⁴⁴ Community & Social → Social Events ⁴¹⁶	speeddate ⁵³ singles ¹⁴⁵ event ⁴⁵¹⁹⁹
tislog.nl	TIS GmbH	The software offers extensive software modules that can be configured to your needs.	Business Software → Logistics Software ¹⁰³ Transportation → Transportation Management ⁷⁰	goods ⁶⁶⁶ driver ¹⁸³² transport ⁶¹⁰⁵ software ⁸²⁹¹
praktijkouwehand.nl	Praktijk Ouwehand	The treatment consists of a maximum of 12 sessions, supplemented with help from modules via the internet.	Workshops → Personal Growth ⁷⁷	practice ⁹⁰⁸⁹ treatment ²¹²⁰³
gatochmindmappen.nl	MindMap.Nederland	The website is divided into modules, each focused on a specific aspect of Mind Mapping and related software.	Business Software → Productivity Tools ⁴¹⁶ Software → Productivity & Office ¹²⁰³	lesson ⁵¹⁵⁴
popupmedia.nl	Pop-Up Media	The website offers standard modules such as a photo player and contact form, and can be further extended with custom applications.	Online Marketing → Website Management ³⁶⁹ E-Commerce → E-Commerce Platforms ⁴¹⁰	functionality ⁴¹⁷ brand identity ¹⁴⁵⁷	North-Holland → Haarlem ⁸⁶⁷⁴
jbnmasterclass.nl	Young Construction Netherlands (JBN)	The masterclass is structured around four modules, each focused on a specific theme.	Investing → Cryptocurrency ⁷⁷⁶ Training → Management Training ¹⁰²⁵	chain ³¹³ masterclass ⁴¹⁹ construction ⁷⁴²¹
themis-innovations.nl	Themis Innovations	Themis consists of five independent software modules that work together.	Business Software → Management Solutions ¹⁴ Technology → Audiovisual & Media ⁶⁸⁸	narrowcasting ¹¹⁸
shipiq.nl	N2k Installatie Benodigdheden BV	The NMEA2000 IoT module is a key component of the system for data storage and management.	Manufacturing → Technical Products ⁹⁶ Marine & Shipping → Maritime ¹⁰²²	web portal ²⁶ fleet ¹³⁵¹
beterspelenenbewegenmetkleuters.nl	Better Play and Movement	The website is structured around various modules, each addressing a specific aspect of movement and learning with preschoolers.	Professional Development → Teachers ²¹² Primary Education → Physical Education ¹⁰¹	physical education ²¹ lesson ideas ²⁷ preschooler ³⁶ test ⁷⁶⁹ package ⁶¹¹²
goudseacademie.nl	Goudse Academie E-learning	The course modules are structured so that students can choose the content and order of the chapters.	Nursing & Support → Nursing ⁵³⁶ Adult & Continuing Learning → Professional Training ¹²²⁴	quiz ⁷¹⁰ acupuncture ¹⁵³⁷ teacher ²⁸⁹⁰ course ¹⁴⁷²⁸
klik-ict.nl	Klik ict	The company develops and integrates modules for various e-commerce platforms.	Web Development → CMS ⁵¹⁶ Online & Digital → Internet Services ¹⁰⁰⁴	e-commerce ⁷³⁸ seo ³⁷⁰⁷	Netherlands → Friesland ²⁷⁹¹¹
jvmmaster.nl	EscapeReserving	Various modules can be added to the system to expand functionality.	Online Services → Reservation Systems ²⁶ Software Development & Engineering → Web Applications ¹⁰⁰⁵	staff scheduling ¹³ reservation system ⁴² escape room ⁴³⁰ calendar ¹⁵⁵⁶	North-Brabant → Dongen ⁸⁵¹
topzorgverzekeringen.nl	Top Zorgverzekeringen 2025	The website describes the various supplementary modules available with the health insurance providers.	Websites → Comparison Sites ⁸⁶⁹ Legal & Financial & Career → Health Insurance ⁵¹⁹	deductible ⁶⁰ premium ⁶⁴³ reviews ³¹⁷² insurance ⁶³⁵⁹
rijschoolfirst.nl	Rijschool First	The driving education is divided into 4 modules with different tests.	Testing → Exams ¹⁰⁸	driving lesson ⁷¹² exam ²¹²⁰ instructor ³¹²⁶ package ⁶¹¹²
salsaopleiding.nl	Stichting SON	The courses are divided into modules, allowing participants to learn flexibly.	Adult & Continuing Learning → Professional Training ¹²²⁴	dance ¹⁸³⁴ course ¹⁴⁷²⁸
kantelprogramma.nl	Kantel Programma	The 13 powerful modules form the foundation of the program.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	pelvic pain ³⁰ mother ⁶⁰³ movement ²³⁰⁴ energy ⁹⁰⁷⁵
vagcomlimburg.nl	Vagcom Limburg	Vagcom Limburg offers services for parameterizing and learning modules using dealer diagnostic equipment.	Medical Care & Services → Diagnostics & Testing ³⁴⁸	diagnostic equipment ³² modification ¹⁸⁸ navigation ³³⁰ diagnosis ¹⁴⁹⁰
herregistratieschoolleider.nl	PMC herregistratie schoolleider BV	The courses consist of accredited modules on various professional development themes.	Business & Management → School Leadership ¹¹⁹ Adult & Continuing Learning → Professional Development ²⁰⁸⁰	professional development ²⁴ school leader ⁵² education ¹³⁴⁷¹ training ²⁸¹³³
onlineacademy-patriciadegroot.nl	Intuition Academy	The course is divided into five modules, each with accessible materials.	Management → Team Development ⁶¹⁷ Spirituality → Intuition ⁴⁹	workbook ¹⁵⁴ intuition ⁵³⁵ course ¹⁴⁷²⁸
bedrijfswagenmodificatie.nl	Hofstede Bedrijfswagenmodificatie	The website introduces various Aluca modules as part of its fitting offering.	Lighting → LED Lighting ⁵⁷⁴ Logistics → Transportation ¹¹⁰²	drawer ⁴⁶ efficiency ³³⁶ fit ³⁵³ vehicle ³⁷⁴³ safety ⁵⁸¹⁹	Gelderland → Barneveld ²⁷⁸¹
schone-binnenlucht.nl	Schone Binnenlucht	Portable modules are offered for air purification.	Commercial Properties → Offices ⁷⁷³ Environment → Air Quality ¹¹⁶	air purification ⁴³ air quality ¹⁶² ventilation ¹¹¹⁰ air conditioning ²¹⁷⁸ plan ²⁵⁶⁶
pedagogievoorhetjongekind.nl	Pedagogiek voor het Jonge Kind	The course is offered in modules, which take place on Fridays from 3:00 PM to 8:30 PM in Zeist.	Education → Pedagogy & Methods ²⁹⁴⁴	anthroposophy ⁹² pedagogy ⁴⁰² child ¹¹⁵⁶⁶ course ¹⁴⁷²⁸
ytechmotors.nl	Y Tech Motors	Module programming is a specialization of Y Tech Motors, allowing the functionality of the car to be adjusted.	Motorcycles → Modifications ⁵⁶ Transportation → Automotive Technology ³¹⁵	retrofit ²⁶ key ²²⁸ diagnosis ¹⁴⁹⁰ repair ¹⁴⁵⁷⁶
veevoedingsadviesbureau.nl	Veevoedingsadviesbureau Nijhof	The website offers various modules (Basic Dairy, Top Dairy, Manure Accounting) for a clear approach.	Livestock → Dairy Farming ⁶⁷¹	ration ³¹ yield ²⁹² environment ⁴⁸⁷³
vandijkcichlids.nl	Van Dijk Cichlids	Modules add functionality to an aquarium and can be used to fulfill specific needs.	Aquariums → Aquarium Supplies ¹⁷ E-Commerce → Pet Supplies ¹⁰¹³	fish food ²⁶ background ¹²⁴ filters ⁴²⁴ decoration ⁴⁰⁸⁵	Moerdijk → Zevenbergschen Hoek ⁶⁶⁹
bodycademie.nl	Yvonne Janssen	The BODYCADEMIE offers online modules to provide users with the correct knowledge.	Nutrition → Lifestyle Advice ⁹⁵	assignment ¹¹²¹ movement ²³⁰⁴ nutrition ⁴⁹³⁵ health ⁶³⁶⁶ coach ²⁵⁸¹⁰
autorijschoolevans.nl	Rijschool Evans	The RIS training is built up from 4 modules.	Online Courses → E-Learning ⁶⁰⁶	ris ⁴¹ driver’s license ⁴³⁸ script ⁵³² driving school ⁶⁹⁶ driving lessons ²⁴⁵³	North-Brabant → Breda ⁹⁰⁰³
your-first-way.nl	Yfw.ie	The premium package includes access to all YFW modules, such as the news portal and the marketplace.	Advertising → Online Advertising ⁹⁴⁸ Local Events → Markets ¹⁰⁹⁷	editorial ¹⁶² advertising ²³⁰² destination ²⁵⁸⁰ package ⁶¹¹²	Westland → De Lier ⁴⁰⁴
lerenvoorjediploma.nl	Geert Bril	The website offers a series of modules focused on various learning aspects.	Educational Support → Homework Assistance ³⁷⁹ Education → Pedagogy & Methods ²⁹⁴⁴	neuropsychology ²⁶ learning ⁹²⁰ tips ²⁷⁸⁹ video ⁶⁷¹⁴ strategy ⁹³⁷⁹
progresswerkt.nl	Progressnl	The lesson materials are based on a modular structure, with individual modules for specific topics.	Mathematics → Arithmetic ²⁵ Primary Education → Educational Materials ⁷¹¹	arithmetic ²³ learner ¹²⁹ lesson material ¹⁸⁹ level ⁴⁹⁴ author ⁹⁴⁹
instituteofabracadabra.nl	Institute of Abracadabra	The course consists of 13 in-depth modules covering various magical traditions.	Spiritual Practices → Spirituality ⁴³⁹⁹ Adult & Continuing Learning → Spiritual Education ²³¹	magic ²⁵⁸ community ⁷⁹³¹ course ¹⁴⁷²⁸
fmcaravan.nl	goFlowApps	fmCaravan is built from modules, allowing users to flexibly choose the functions they need.	Caravans → Caravan Storage ¹⁴⁵ Business Software → Accounting Software ⁹⁸⁴	caravan storage ²⁸ invoicing ²⁹² business operations ³¹⁰ agenda ⁴³⁷⁴
egkok-psychotherapie.nl	Eli Kok Psychotherapy	Together with a colleague, she developed the ‘Black Swans, White Swans’ module.	Education → Career & Guidance ¹¹⁵⁷	supervision ¹¹⁸⁴ emotion ²¹⁶⁹ therapy ⁷⁴⁴⁸	North-Brabant → Waalwijk ¹⁷⁴⁴
sterkplan.nl	REUS	The website offers various modules, such as a home finder and tools for purchase agreements.	Online Marketing → Marketing Automation ²⁸⁹ Online Marketing → Email Marketing ²⁴⁸	new construction project ⁷⁹ marketingstrategy ²⁹² target audience ¹¹⁰⁸ branding ⁴⁶¹⁴	Noordoostpolder → Emmeloord ¹⁶⁴⁹
100dagenwerkplezier.nl	Hillegonda	The website introduces separate modules aimed at specific issues such as stress and proactivity.	Human Resources → Employee Development ⁷⁶² Human Resources → Talent Management ⁵³⁷	workplace happiness ⁸⁵ stress ³⁹⁶⁵ employee ⁴⁴²⁹ course ¹⁴⁷²⁸
plandou.nl	Plandou	The platform is modular, with different modules for maintenance, reporting, and document management.	Online Services & Platforms → SaaS (Software as a Service) ⁴⁴ Data Analysis → Business Intelligence ¹⁰⁰²	cloud ¹⁵²⁷ report ⁴⁵⁵¹ installation ¹³⁷⁴² collaboration ¹⁶⁰³⁶ maintenance ²⁰⁰⁹³
belasdo.nl	Belasdo	The website offers a calculation module for calculating the required materials.	Electric Vehicles → Charging Stations ³⁰³	socket ¹⁴ block ⁹¹ mounting ⁴⁴⁸ charging station ⁷⁸⁹ foundation ⁶⁶⁷⁸
jachthaven-software.nl	Ansacon	The software consists of various modules, offering functionalities such as guest management, location management, and electricity consumption control.	Energy → Energy Management ⁵⁰⁴	occupancy ¹² marina ⁴⁸⁷ guest ¹³³⁴ software ⁸²⁹¹
smartblox.nl	SMARTBLOX	Users can assemble their website from pre-built modules.	Web Design → Website Builders ⁸⁸⁸ Web Development → CMS ⁵¹⁶	cms ⁶¹³ design ²⁷²⁰²
montagebedrijfvet.nl	Montagebedrijf Vet B.V.	The company provides quick and efficient repairs for damaged modules, such as those used at Nissan.	Storage → Cabinets ⁶¹² Assembly & Production → Assembly ²²⁷	shop fitting ¹⁹ shelving unit ²⁹ relocation ³⁶⁴	Zaanstad → Wormerveer ⁵³⁰
easyparp.nl	EasyPARP	EasyPARP provides various modules to guide the PARP journey, including intakes and inventories.	Web Design & Development → Web Servers ⁵⁸	documentation ⁴⁵²
kinderopvangleert.nl	Kinderopvangleert	The website offers a diverse range of online learning modules specifically designed for the childcare sector.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Recruitment → HR Services ³³⁸⁴	learning solutions ¹⁷ staff ³⁴⁰⁵ communication ¹⁰¹⁶² collaboration ¹⁶⁰³⁶
learnovate.nl	Learnovate	The organization provides short modules focused on strengthening personal leadership.	Business & Management → School Leadership ¹¹⁹	development program ¹⁴ personal development ⁸¹⁰ leadership ³⁷²⁴ innovation ⁴⁶⁵⁹
cursusgrieks.nl	Petra Mens-Omtzigt	Together with a colleague, Petra Mens-Omtzigt develops online learning and practice modules under the name Grieksonline.nl.	Language Learning → Language Courses ⁷⁶⁹	skype ²⁴ greek ⁴² book ¹¹³⁹⁶
heldensmodulairebouw.nl	Heldens Modulaire Bouw	Heldens Modulaire Bouw offers both new and existing modules, which can be adapted according to needs.	Sustainable Building → Construction Projects ⁸²³ Construction → Building & Materials ¹⁹⁴⁴⁹
greenpoort.nl	Greenpoort	The solar energy course is divided into 5 modules that can be followed flexibly.	Online Courses → E-Learning ⁶⁰⁶	solar ¹³² e-learning ⁵⁸⁰ exam ²¹²⁰ course ¹⁴⁷²⁸
berlix.nl	BERLIX	BERLIX develops custom modules to improve website functionality.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	joomla! ²⁶ optimization ⁶¹¹ maintenance ²⁰⁰⁹³
contrans.nl	TBIJ BV	The system offers a wide range of modules for various applications.	Sustainable Construction → Materials ¹⁰⁴³ Trailers & Towing → Trailers ⁶⁵⁰	slides ⁸⁸ trailer ¹⁶²⁴ container ¹⁷⁰⁹ transport ⁶¹⁰⁵
newy.nl	NEWY	The toolkit consists of six modules, each with specific content and objectives.	Employment Law → Works Councils ¹⁰⁷ Law → Administrative Law ¹⁰¹⁹	representation ¹⁰⁰ toolkit ¹⁵⁷ law ¹³²⁹ coach ²⁵⁸¹⁰
vindjeopleiding.nl	NIBIG Vindjeopleding	Individual modules are presented alongside complete courses.	Alternative Medicine → Complementary Therapies ⁸⁵⁸	healthcare provider ⁴⁷⁴ training ²⁸¹³³
cq-living.nl	CQ-Living	The standard module of 90m2 provides a foundation for diverse residential care solutions and is easily adaptable to specific desires.	Construction Companies → Residential Construction ¹⁰¹³ Administrative Support → Business Models ¹⁹⁴	standardization ²⁷ flexibility ⁹⁹⁶ housing ⁴³⁷⁸ care ¹²³³⁸
oomtijdelijkinhetbuitenland.nl	OOM	The insurance offers various modules which can be taken separately.	Insurance → International Insurance ¹³	coverage ³⁴⁸ package ⁶¹¹² insurance ⁶³⁵⁹ health ⁶³⁶⁶
imotamodular.nl	Imota Modular	The ready-to-use wooden modules are a core product of Imota Modular and form the basis for sustainable homes.	Building & Construction → Sustainable Building ¹⁰⁰⁴ Fabrication & Production → Prefabrication ⁴¹²	architect ⁶⁰⁹ buildings ⁸⁹⁸ production ⁴⁵⁸² sustainability ¹⁸⁴⁵¹
isp-vision.nl	ISP Vision	The software is modularly constructed, allowing users to select only the relevant modules.	Business Software → ERP Systems ¹⁰⁰⁷ Business Software → CRM ⁷⁶⁴	flexibility ⁹⁹⁶ report ⁴⁵⁵¹ software ⁸²⁹¹	Alphen aan den Rijn → Boskoop ⁶⁵²
veterino.nl	Maarn Consult	The system consists of both mandatory and optional modules to meet the specific needs of the clinic.	Primary Care → Veterinary Medicine ⁷⁰⁴ Management → Quality Management ⁹⁰⁹	practice manager ¹⁵
esthetischegeneeskunde.nl	Esthetic Medicine Training Institute	The website offers a range of educational online modules on various aspects of aesthetic medicine.	Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵ Adult & Continuing Learning → Medical Training ⁶⁷	cosmetic doctor ¹⁷ aios ¹⁸ research ⁸⁹⁶⁷
wasboxbouwen.nl	Autorette	The website introduces the Spectro Internet Module for efficient use of cleaning agents.	Automation & Control → Automation ¹⁴⁹⁴ Household Supplies → Cleaning Products ²⁰⁹	washbox ⁶⁶ controller ²³⁹ fire ⁴²⁹	North-Brabant → Helmond ³⁰⁵⁸
autorijschoolvanwijngaarden.nl	Autorijschool Van Wijngaarden	The Rijopleiding in Stappen (RIS) is based on structured modules.	Driver & Vehicle → Driver’s License ¹⁶²⁵	ris ⁴¹ theory ⁹⁵⁶ license ¹²⁸⁸ exam ²¹²⁰ driving lessons ²⁴⁵³	Alphen aan den Rijn → Boskoop ⁶⁵²
dehelicopterview.nl	Pelle van der Lee	Online modules provide a flexible way to explore supplementary subjects.	Coaching → Leadership Coaching ⁵⁵⁷ Mental & Emotional Well-Being → Autism ⁹⁵⁸	pilot ²⁰⁸ self-awareness ⁷⁵¹ life ²⁶⁷³ balance ⁴⁵⁸² coach ²⁵⁸¹⁰
kinderopvang-online.nl	Ikke	The ‘Space as a third pedagogue’ module is an example of the offered training courses.	Business & Management → School Leadership ¹¹⁹ Adult & Continuing Learning → Professional Development ²⁰⁸⁰	childcare ³⁵¹² network ¹¹¹²³ training ²⁸¹³³
kleuterexpertise.nl	Kleuter Expertise	The website offers various modules focused on specific educational topics.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Education → Special Needs & Support ⁶³⁷²	bibliography ⁴² giftedness ³⁴⁰ education ¹³⁴⁷¹ training ²⁸¹³³
tandwielenshop.nl	TandwielenShop	The company produces gears in various modules, tailored to the specific needs of the customer.	Legal → Bankruptcy ⁶⁵ Manufacturing → Machine Building & Parts ³²	gear ¹²⁶ production ⁴⁵⁸²
theatermanager.nl	TheaterManager	TheaterManager's solutions consist of various modules that can be implemented quickly and easily.	Business Software → HR Software ⁶⁴⁹ Business Software → ERP Systems ¹⁰⁰⁷	webinar ⁸⁷⁰ time ⁹³² payroll ¹⁸²³ schedule ²⁶²⁴
werkaanstress.nl	Work on Stress	The website offers individual modules, ranked by theme and difficulty.	Online Services → Platforms ⁵³⁷ Curriculum & Resources → Educational Resources ⁴⁰¹	bundle ²⁵⁴ e-learning ⁵⁸⁰ test ⁷⁶⁹ stress ³⁹⁶⁵ relaxation ³⁹⁶⁸
247newsroom.nl	24/7 Newsroom	The various modules of 24/7 Newsroom offer specific functionalities for diverse communication tasks.	Software → Communication Software ¹² Community → Government & Administration ¹⁰⁵⁶⁷	press releases ¹⁵⁷ communication ¹⁰¹⁶²
arnovanliere.nl	Arno van Liere	For the Rotterdams Dameskoor, Arno van Liere developed a module that integrates with Joomla and provides features like a calendar and guestbook.	Software Development & Engineering → Web Applications ¹⁰⁰⁵ Software Development & Engineering → Content Management Systems ¹⁷	programmer ⁶⁵ script ⁵³² cms ⁶¹³ portfolio ⁶⁸⁵⁴	Zeeland → Terneuzen ¹⁵¹⁷
bkr-connect.nl	De Voorkant B.V.	The website describes various modules, including matching and profiling, which are part of the Bkr Connect system.	CRM → Customer Management ⁶⁰ Financial Services → Financial Technology ⁵⁸	dashboard ¹³⁷⁴
boekhoudenvergelijker.nl	Boekhoudenvergelijker.nl	The website offers the possibility to select specific modules, such as invoicing.	Websites → Comparison Sites ⁸⁶⁹ Accounting → Bookkeeping ¹²³⁰	accounting program ⁵² functionality ⁴¹⁷ comparison ⁵⁴¹ account ⁵⁷⁸¹ package ⁶¹¹²
boekjaar.nl	BoekJaar	The BoekJaar platform consists of four different modules, each offering a specific function.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Financial Software ¹⁵¹	workflow ⁴⁰⁷ insight ⁶²⁸ automation ²⁶⁸² account ⁵⁷⁸¹
clausrijopleiding.nl	Claus Rijopleiding	The lessons are divided into modules, enabling learners to follow a clear structure and track their progress.	Mental & Emotional Well-Being → Autism ⁹⁵⁸ Medical Care & Services → Diagnostics & Testing ³⁴⁸	traffic situation ¹⁹ ris ⁴¹ adhd ³⁵⁴ test ⁷⁶⁹ driving lessons ²⁴⁵³
coachjouwgeluk.nl	Marja	The website describes a trio of proven modules that are part of Marja’s coaching approach.	Coaching → Relationship Coaching ⁵⁵⁸ Self-Help → Happiness ¹⁴	self-love ²⁶² single ⁴⁴⁵ happiness ⁶⁵³ value ¹³⁵² coach ²⁵⁸¹⁰
connectx.nl	ConnectX	ConnectX consists of individual components, or modules, that can be tailored to the customer's needs.	Enterprise Solutions → Business Systems ⁹¹ Technology → Software Solutions ²¹⁵	software ⁸²⁹¹
crea-academie.nl	Crea Teken Academie	The course is divided into modules with various drawing lessons, based on specific themes and visual elements.	Games → Creativity ⁵⁴ Childcare → Cultural Activities ¹⁰	drawing course ¹¹ course ¹⁴⁷²⁸
docutweak.nl	Output4you	Docutweak offers various modules, such as for insurance, financial documents, and agent forms.	Business Software → Workflow Management ⁶³ Business Software → Document Management ³²⁸	output ²⁰ dashboard ¹³⁷⁴ office ²⁸⁹⁸ software ⁸²⁹¹
envira.nl	Joomla Community	Modules are functionalities that can be added to a website to add functionality, such as displaying images or showing popular tags.	Web Design → Website Templates ⁹⁷ Web Development → Content Management Systems ⁵⁰²	joomla ¹⁷¹ template ⁷⁴² blog ¹³³⁹²
epwexamenhulp.nl	EPWexamenhulp.nl	The practice materials are organized around the EP-W modules 1 through 4/B.	Curriculum & Resources → Educational Resources ⁴⁰¹ Testing → Exams ¹⁰⁸	practice materials ²¹ knowledge base ⁵⁶⁹ quote ¹²⁸⁶³
equinologica.nl	EquinoLogica	The website describes the different training modules offered.	Outdoor → Horse Riding ⁹⁴¹ Horses → Horse Care ⁴⁸⁸	bond ³⁴⁸ method ¹⁵⁰⁵ behavior ¹⁷⁷⁹ horse ⁴³³⁷ training ²⁸¹³³
financieelinzichtonline.nl	FIO	FIO is divided into Basic and Extended modules with different functionalities.	Personal Finance → Financial Planning ¹⁰¹⁷ Human Resources → Pension Administration ¹⁰	finance ⁵³⁴¹
flowerdesk.nl	Composd BV	The inventory/purchasing module supports florists in managing their stock and planning purchases.	E-Commerce → Webshop Integrations ¹⁰ Retail → Point of Sale Systems ⁶⁸	pos system ⁷⁸ webshop ⁸⁶⁴⁸
framestory.nl	FrameStory	FrameStory offers modular software modules that can be customized to meet the specific needs of an insurance company.	Business Software → Accounting Software ⁹⁸⁴ Technology → Software Solutions ²¹⁵	administration ⁶⁵⁸⁷ software ⁸²⁹¹
hoarding.nl	Niet gespecificeerd	The website offers modules under the name CORONA Academy.	Social Services → WMO ¹⁶² Mental & Emotional Well-Being → Addiction ⁴⁹³	hoarding ¹⁵ population ¹⁰²
koningsgroep.nl	Koningsgroep	The website offers various module positions and styles to customize website layouts and functionality.	Web Design → Website Builders ⁸⁸⁸ Web Development → Content Management Systems ⁵⁰²	joomla ¹⁷¹ layout ⁸⁹⁹ extension ¹⁹⁴¹ menu ¹³⁸⁵⁶
lekkerinjevelopschool.nl	Lekker In je Vel op school	LIV is divided into six thematic modules focusing on various aspects of well-being.	Special Needs & Support → Educational Support ²¹⁹⁵ Education → Pedagogy & Methods ²⁹⁴⁴	self-awareness ⁷⁵¹ choice ⁸²⁷ exercises ¹⁰⁵⁸ wellbeing ²⁶²⁰ student ⁷⁶²³
link2linker.nl	Link2Linker	The website describes various AFAS Profit modules, such as CRM and HRM, which Link2Linker can configure.	Business Software → HR Software ⁶⁴⁹ Business Software → ERP Systems ¹⁰⁰⁷	afas profit ¹² implementation ¹⁰²⁹ data ⁵⁸⁷²
musisites.nl	Musisites	The website offers standard modules relevant to musicians, accelerating the configuration process.	Web Design → Website Builders ⁸⁸⁸ Recordings & Media → Musicians ⁴³⁷	expansion ¹³⁶ domain ¹⁸¹¹
netglobe.nl	Netglobe	Netglobe offers various modules, such as stoma registration and wound care, as part of its cloud packages.	Software & Computing → Cloud Computing ¹²⁵³ Health → Medical Care & Services ²⁹⁴⁶¹	epr ¹² ict ¹⁰⁴⁹ cloud ¹⁵²⁷ healthcare ²³¹⁶ software ⁸²⁹¹
nielsdezeeuw.nl	Niels de Zeeuw	The training is structured into three modules, each addressing different aspects of intimacy and relationships.	Relationships → Relationship Problems ⁶⁴³ Mindfulness & Compassion → Emotional Intelligence ²¹²	intimacy ¹²¹ relationship ⁴²⁰⁵ communication ¹⁰¹⁶² training ²⁸¹³³
overnamefusie.nl	De Raadgevers	De Raadgevers utilizes a unique module system for providing customized solutions.	Financial Management → Acquisitions ³⁰² Business News → Acquisitions ²⁰	merger ³²³ acquisition ⁴⁰⁸
prasset.nl	Prasset	Prasset consists of various building blocks, also known as modules, that users can combine to meet their needs.	Business Software → CRM ⁷⁶⁴ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	objects ⁴²⁶ portal ⁵⁹¹ crm ⁵⁹¹ real estate ⁴⁹⁸¹
rijschool-erikbrok.nl	Erik Brok Driving School	Driving lessons are divided into modules, with tests at the end of each phase.	Driver & Vehicle → Continuing Education ⁴⁵⁴ Driving & Vehicle → Educational Services ³⁷⁹	automatic transmission ³⁶ ris ⁴¹ driving lesson ⁷¹² driver's license ¹²⁸³ instructor ³¹²⁶
salesstars.nl	Worldaspect B.V.	The Company Stars Sales module is used to determine the sales style of employees.	Training → Sales Training ⁴³⁷ Human Resources → Employee Development ⁷⁶²	competency ²²⁸ talent ³⁹⁸⁷
systeemgerichtwerkeninsocialeberoepen.nl	Boom uitgevers Amsterdam	The website is structured around various modules, each addressing a specific topic.	Community → Social Issues & Welfare ²⁸¹⁵⁹ Education → Pedagogy & Methods ²⁹⁴⁴	education ¹³⁴⁷¹
technischva.nl	Weblish	The course consists of 38 modules that participants can follow at their own pace.	Training → Online Training ³⁴³	wordpress ³⁵⁵¹ student ⁷⁶²³ course ¹⁴⁷²⁸
tvstand.nl	TVstand B.V.	Optional modules, such as a tilt function, increase the functionality of the TV stand.	Event Management → Trade Show Marketing ⁵⁰ Business & Professional → Trade Shows ⁹⁵¹	trade show ⁹⁹ stand ²⁹⁴ steel ¹¹⁷⁷ design ²⁷²⁰²
uitgeverijmaakeenboek.nl	Maak Een Boek	Each package consists of different modules that can be adapted to the customer's wishes.	Spirituality → New Age ²⁴³ Marketing → Creative & Design Services ⁴⁹³⁸	dream ⁸⁸³ editing ¹³³⁸ package ⁶¹¹² book ¹¹³⁹⁶ care ¹²³³⁸
vlees-verscollege-vvc.nl	VVC Vlees-Vers College-vvc.nl	The training programs are built around various modules.	Business Software → Logistics Software ¹⁰³ Food → Supermarkets & Grocery ³⁵⁶⁸	chain ³¹³ meat ²⁰⁵⁵ teacher ²⁸⁹⁰ training ²⁸¹³³
vloedeneb.nl	Vloed & Eb	Vloed & Eb has developed modules in collaboration with 1 Gezin 1 Plan 1 Regisseur, focused on specific aspects of youth care.	Social Organization → Child Welfare ¹¹⁴⁷ Medical Care & Services → Psychiatry ⁷⁵⁶	issues ⁴⁷⁰ youth ³¹²⁶ care ¹²³³⁸ training ²⁸¹³³
werkbaarbeter.nl	WerkbaarBeter	WerkbaarBeter offers various modules, including prevention, reintegration, and wellness budgets, to support engagement.	Online Services → Platforms ⁵³⁷ Human Resources → Absence Management ⁸⁵⁰	engagement ²³⁹ policy ²¹⁴⁹ data ⁵⁸⁷²
witsysteem.nl	Tijhuis Ingenieurs	WIT consists of various modules, each tailored to a specific phase of the dredging process.	Engineering → Environmental Engineering ⁴¹ Sustainable Building → Dredging ⁴²	waterbed ⁵³ dredging ⁹⁸ planning ¹⁹⁶⁹ data ⁵⁸⁷² software ⁸²⁹¹	Utrecht → Houten ¹⁶⁷⁷
xmaps.nl	Screens & Pages	The XMAPS software consists of flexible modules that can be linked via XML, SOAP, REST, and API's.	Business Software → ERP Systems ¹⁰⁰⁷	database ¹¹⁵³ software ⁸²⁹¹
stacka.nl	Stacka Spaces	Stacka’s modular homes are built from loose, stackable components that can be easily adapted and expanded.	Property Location & Neighborhood → Residential ⁸⁵¹ Design → Product Design ⁷²²	living environment ¹⁷⁷ sustainability ¹⁸⁴⁵¹ design ²⁷²⁰²
safetysys.nl	Safetysys	Safetysys is divided into modules to modularize functionality and simplify use.	Business Software → Management Software ¹⁴⁶ Management → Quality Management ⁹⁰⁹	avg ¹⁴⁵ vca ²⁸³ data ⁵⁸⁷²
heroes-test.nl	Ludus Training & Fysio	New modules have been added to the Ronneby theme, providing pre-configured elements for easy customization and content addition.	Web Design → Website Builders ⁸⁸⁸	shortcode ¹⁸ theme ⁴⁰¹⁵
technologischdesign.nl	Segbroek College	Each Technologisch Design module concludes with a final project applying the learned concepts.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹	technology ⁶⁸¹⁶ student ⁷⁶²³ design ²⁷²⁰²
sandermom.nl	sandermom.nl	Modules are configurable elements that can be added to pages to provide additional functionality or content.	Web Design → Website Builders ⁸⁸⁸ Web Development → CMS ⁵¹⁶	joomla ¹⁷¹ cms ⁶¹³ template ⁷⁴² article ⁶⁰⁰⁰
digitalcardservices.nl	Digital Card Solutions B.V.	Digital Card Solutions offers flexible modules to its clients to enhance the functionality of their apps.	Software Development & Engineering → Web Applications ¹⁰⁰⁵ Mobile & Wireless Communication → Mobile Apps ⁵³⁴	cms ⁶¹³ app ⁴⁵⁹⁵	North-Holland → Amsterdam ⁴¹²⁵³
doornvan.nl	Doe maar	Modules are used to add dynamic elements and functionality to individual pages of the website.	Web Design → Content Management ²⁹³ Web Development → CMS ⁵¹⁶	template ⁷⁴² article ⁶⁰⁰⁰
supproacademy.nl	Suppro	The training courses can be offered in modules, with new modules periodically released.	Training → Online Training ³⁴³	password ²¹³ question ²²⁶¹ training ²⁸¹³³
sinnesera.nl	Sinnesera Service Solutions	The website offers various modules such as FM Reset and FM Routekaart to address facility problems.	Construction & Maintenance → Procurement ⁵⁶⁷ Commercial Properties → Offices ⁷⁷³	work environment ²⁹⁵ supplier ¹⁷²⁵ facility ²⁶¹⁶ sustainability ¹⁸⁴⁵¹
rcutrecht.nl	Railclub Utrecht	Modules are pre-built sections of model railway track built and maintained by club members.	Model Building → Model Railroading ²⁷³ Combat → Badminton ⁷⁰²	club ⁴²²⁵ agenda ⁴³⁷⁴	Netherlands → Utrecht ⁴⁸⁹⁰¹
deurmatgigant.nl	Joomla.org	The site explains the functionality of various modules, such as the Image and Popular Tags modules.	Content Management → Web Content Management ¹¹ Web Development → CMS ⁵¹⁶	typography ¹⁵⁵ joomla ¹⁷¹ template ⁷⁴² blog ¹³³⁹²
erppakketselectie.nl	ERP Pakketselectie	An ERP program consists of various modules that each support a specific task, such as financial accounting or inventory management.	Business Software → ERP Systems ¹⁰⁰⁷	erp ³⁶³ database ¹¹⁵³ software ⁸²⁹¹
susanneoosterveen.nl	Susanne Oosterveen	The website offers services for the development of engaging e-learning modules.	Web Design → Content Management ²⁹³ Online Courses → E-Learning ⁶⁰⁶	format ³⁶² e-learning ⁵⁸⁰ education ¹³⁴⁷¹
makelaarsservice.nl	Makelaarsservice	The platform offers diverse modules for creating advertising campaigns.	Software → Real Estate Software ¹⁰⁰ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	template ⁷⁴² advertisement ¹⁷⁰⁷ studio ⁵⁴⁶⁵
eela-audio.nl	PMT Europe Luxemburg	New and used modules are available for a wide range of Eela audio mixing consoles, enabling repairs and upgrades.	Audio → Audio Equipment ⁵⁴⁷ Audio → Professional Audio ³³	part ⁵⁰⁴⁴ repair ¹⁴⁵⁷⁶
apkvragen.nl	APKvragen.nl	The website offers exams in module format for a structured study.	Automotive Maintenance → Vehicle Inspection ¹¹⁰² Testing → Examinations ¹¹³	practice exam ⁶³ feedback ⁵¹⁵ apk ¹³³³ regulation ¹³⁵⁰ exam ²¹²⁰
worktool.nl	Worktool	Worktool offers a wide range of additional modules, such as project management and purchasing management, which can expand the functionality of the platform.	Business Software → HR Software ⁶⁴⁹	leave ⁸⁴ scheduling ²⁶¹ integration ¹⁴⁵¹ employee ⁴⁴²⁹
group57.nl	GROUP 57	GROUP 57 can provide support with the development and production of electronic modules.	Assembly & Production → Assembly ²²⁷ Audio → Components ⁴⁸⁹	pcb ⁴⁷ electronics ⁹⁷¹
kinderwerkersplein.nl	kinderwerkersplein.nl	The website offers various learning modules for students in the primary, middle, and upper levels, using the accompanying books.	Christianity → Biblical Studies ³¹³ Education → Pedagogy & Methods ²⁹⁴⁴	forum ¹³⁶² method ¹⁵⁰⁵ municipality ⁶⁸³⁷
kodumaja.nl	Kodumaja	The production of homes is CO2 neutral.	Residential Construction → Modular Construction ⁴² Sustainable Construction → Circular Construction ⁸⁰	circular ³⁶⁹ transport ⁶¹⁰⁵ school ⁷⁸⁵⁶ home ⁷⁹⁷⁶ design ²⁷²⁰²
contendowebsite.nl	Contendo	The website packages include several included modules for complete functionality.	Web Design → Website Maintenance ²⁸⁷	rate ²⁶⁰⁶ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	North-Holland → Haarlem ⁸⁶⁷⁴
elektrotraining.nl	elektrotraining	The training programs are structured into modules, such as VOP and VP, tailored to specific target groups.	Training → Corporate Training ¹³³¹ Vocational Training → MBO ⁶⁹⁰	target group ⁵⁷⁸ electrical engineering ⁸¹⁷ training ²⁸¹³³
bladman.nl	Not specified	Modules are reusable components that add functionality and customization options to a website.	Programming Languages → PHP ⁴⁰⁰ Web Development → CMS ⁵¹⁶	settings ⁶⁸ joomla ¹⁷¹ template ⁷⁴² article ⁶⁰⁰⁰
nourcollege.nl	Nour College	The college offers modules for strengthening faith and identity.	Local Communities → Religious Communities ²⁷⁰ Religious Education → Islamic Education ⁴⁷	spiritual development ³⁹ brotherhood ⁷⁷ islam ¹⁷² community ⁷⁹³¹
mydodo.nl	Mydodo.nl	The website uses specific modules to organize and customize the page.	Software Development & Engineering → Web Applications ¹⁰⁰⁵ Collaboration & Networking → Networking ¹²²⁵	wizard ¹⁴ page ⁴²⁷ news ¹⁵²⁹³
dpo-trainingen.nl	N.V. Online Cursussen	The training is divided into nine modules, each focused on a specific aspect of the GDPR.	Legal → Privacy ⁵⁹⁶ Law → Privacy Law ⁷¹	data protection officer ¹⁰ gdpr ¹⁷⁹ data ⁵⁸⁷² training ²⁸¹³³
metspoedeenwebsite.nl	Everytising Makers van reclame	Clients can optionally add modules to their website, such as photo galleries or contact forms.	Web Development → Content Management Systems ⁵⁰²	package ⁶¹¹²
erikhuijs.nl	erikhuijs.nl	Drupal is equipped with contrib-modules that add extra functionality to the website, such as content management and information presentation.	Participation → Citizen Participation ²³⁷ Software → Open Source ²¹⁰	citizen participation ⁴¹ drupal ⁸⁰ image ²⁶⁰⁵ news ¹⁵²⁹³ training ²⁸¹³³
mijnfysiothuis.nl	Mijn Fysio Thuis	Free self-help modules are offered as a supplement to online physiotherapy.	Business Software → Scheduling Software ⁵² Online Courses → E-Learning ⁶⁰⁶	physiotherapy ⁴⁶⁸⁸ complaint ⁶⁴⁷⁹ collaboration ¹⁶⁰³⁶	North-Brabant → Deurne ¹³²⁹
ontwerpduurzaam.nl	The Best Webshop	The website offers various modules, such as navigation and article management, to extend the functionality of a website.	Web Design → Website Builders ⁸⁸⁸ E-Commerce → E-Commerce Platforms ⁴¹⁰	hosting ³¹²⁵ webshop ⁸⁶⁴⁸ design ²⁷²⁰²
cms-helpdesk.nl	cms-helpdesk.nl	Each module of the CMS has a specific function and is explained in the guide.	Web Design → Content Management ²⁹³ Web Development → CMS ⁵¹⁶	search field ¹⁵ sitemap ⁴⁴ cms ⁶¹³ guide ¹³⁶⁴ menu ¹³⁸⁵⁶
elsene.nl	Martin Cleven	The content is divided into three modules to present the information in a structured way.	Context ¹⁶¹³⁹⁴	genealogy ⁵⁴³ history ⁷²⁸⁶	Echt-Susteren → Nieuwstadt ⁵²
mijnopruimchallenge.nl	Mijn Opruimcoach	Each day a new module is made available with assignments and information.	Business Software → Productivity Tools ⁴¹⁶ Software → Productivity & Office ¹²⁰³	mailbox ²²⁷ email ¹⁰¹² challenge ¹⁶⁹⁷ course ¹⁴⁷²⁸
groenzichtbv.nl	Groenzicht BV	Groenzicht offers three modules (Day Trading, Garden Center, Retail) to cater to the needs of every customer.	Gardening → Plants ²⁸⁶⁷ Software Development & Engineering → Programming ⁵¹⁹	fuchsia ¹³ distribution ¹⁰¹¹	Rotterdam → Hoek van Holland ⁵⁴⁰
graphtec.nl	Dewetron / Graphtec	The dataloggers are modular, meaning they can be expanded with various sensors and modules to meet specific measurement needs.	Measurement → Measurement Instruments ⁴⁶ Technology → Electronics & Components ¹¹²⁶¹	datalogger ¹⁴ interface ¹²² sensor ⁴⁸² instrument ¹²⁹⁵ software ⁸²⁹¹
shopcase.nl	SHOP CASE	The system consists of various modules that retailers can combine.	Business Software → Retail Software ⁵⁶	mood ⁷² identity ¹⁰²⁸ customization ¹⁷²³
thejoyofbeingalive.nl	Digital Wealth Academy	The course is divided into five modules, each focusing on a specific aspect of building an online business.	Online Marketing → Affiliate Marketing ²⁹⁹ Investing → Cryptocurrency ⁷⁷⁶	profit ¹⁵⁹ income ⁶⁶⁰ marketing ⁷¹⁰⁷ course ¹⁴⁷²⁸
jubako.nl	ArmAqua Global B.V.	Prefabricated modules allow for flexible system configuration to meet diverse application requirements.	Engineering → Environmental Engineering ⁴¹ Agricultural Technology & Innovation → Aquaculture ²⁰	aquaculture ¹³ crates ⁸⁸	Maashorst → Uden ¹⁵⁴⁰
maxicms.nl	MaxiCMS	The system offers various modules that can further expand the website’s capabilities.	Online Marketing → Website Management ³⁶⁹ Web Development → CMS ⁵¹⁶	cms ⁶¹³ package ⁶¹¹²
notubiz.nl	NotuBiz Nederland	The various modules of the platform can be connected to existing systems of users.	Business Software → Administrative Software ¹⁵⁸ Mental & Emotional Well-Being → Autism ⁹⁵⁸	whitepaper ¹¹⁶ meetings ¹⁰¹¹ document ¹⁶⁷⁸
banster.nl	Banster	Clients can choose which modules to utilize.	Business Software → Administrative Software ¹⁵⁸ Business Software → Membership Management ¹⁵	membership management ²² cloud ¹⁵²⁷ security ⁶⁶⁵⁵ software ⁸²⁹¹ event ⁴⁵¹⁹⁹
ou.nl	Open University	Education is offered through online modules, providing flexibility.	Primary Education → Educational Materials ⁷¹¹ Education → Pedagogy & Methods ²⁹⁴⁴	researcher ²²⁰ research ⁸⁹⁶⁷ event ⁴⁵¹⁹⁹
i-reserve.nl	i-Reserve	i-Reserve is a modular system, meaning users can select only the functionalities they need.	Business Software → Management Software ¹⁴⁶ Online Services → Reservation Systems ²⁶	reservation system ⁴² customer management ⁴³ meeting room ⁶⁸⁵ integration ¹⁴⁵¹
rijnijssel.nl	Rijn IJssel	In addition to mbo courses, courses are also offered, such as language courses and immersion classes.	Language Learning → Language ¹⁶⁸⁹	virtual tour ²²⁰ internship ⁶⁹⁴ course ¹⁴⁷²⁸	Rheden → Dieren ⁴⁶²
mijnkleutergroep.nl	MijnKleutergroep	The planning module allows for scheduling lesson plans and activities.	Education & Training → Educational Software ²⁷⁴ Early Years → Early Childhood Education ¹³⁴⁵	observation ²⁴⁸ teacher ²⁸⁹⁰ app ⁴⁵⁹⁵
delcom.nl	Delcom	The platform’s modular design allows users to select and pay for only the functionalities they need.	Software → Event Management Software ³⁰ Education → Sports Management ¹⁰⁰	ticket ²⁷⁸⁵
city.nl	CITY SOFTWARE	The software is modularly constructed, allowing municipalities to flexibly implement different functionalities.	Applications → Municipal Software ¹³ Technology → Software Solutions ²¹⁵	application ³³⁷⁷ data ⁵⁸⁷² municipality ⁶⁸³⁷ software ⁸²⁹¹ collaboration ¹⁶⁰³⁶
timemate.nl	TimeMate BV	The ability to choose custom modules offers flexibility and adapts the application to the needs of the business.	Project Management → Time Tracking ⁸⁴ Mobile & Wireless Communication → Mobile Apps ⁵³⁴	scheduling ²⁶¹ hour ³⁶⁵ integration ¹⁴⁵¹
csw.nl	CSW Software	Customers can choose their ideal composition of modules within each package.	Enterprise Solutions → Business Systems ⁹¹	package ⁶¹¹² administration ⁶⁵⁸⁷
artsystems.nl	Art Systems B.V.	Transpas Enterprise is built in modules to meet the specific needs of transport companies.	Business Software → Logistics Software ¹⁰³ Transportation → Transportation Management ⁷⁰	tms ³⁰ transport ⁶¹⁰⁵ software ⁸²⁹¹
datadossier.nl	DataDossier	The platform offers directly deployable modules, perfectly tailored to customer needs.	Business Software → Productivity Tools ⁴¹⁶	workflows ⁷⁶ graph ¹⁰⁴ data ⁵⁸⁷²
bronboek.nl	Bronboek Software Development	The software is modular, enabling customers to purchase individual components and use them.	Business Software → Retail Software ⁵⁶ Books → Bookstores ⁵⁸³	cash system ⁶⁹ bookstore ¹⁴⁹ automation ²⁶⁸² software ⁸²⁹¹	Hoeksche Waard → Strijen ²³⁶
xps.nl	XPS	The modular nature of XPS allows companies to select the desired functionalities.	Business Software → Project Management Software ⁶⁵ Recruitment → HR Services ³³⁸⁴	workforce management ¹³ planning ¹⁹⁶⁹ ai ²¹⁸¹ contract ²⁴¹⁵
podotherapie.nl	Dutch Association of Podotherapists	The 'Preventive Foot Ulcer Prevention Module' is an e-learning program that informs podotherapists about preventing foot ulcers in diabetic patients.	Orthopedics → Foot Problems ⁹⁷⁷ Body & Movement → Preventative Care ³⁴⁴	podotherapy ¹⁶⁸ reimbursement ⁴⁶⁵ diabetes ⁷⁵⁰
embloom.nl	Embloom	The platform offers more than 400 e-health orders and modules for online treatment.	Online Services → E-Health ⁶⁹ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	e-health ⁶⁹ questionnaire ⁶⁶⁶ tool ³⁹⁰⁷ care ¹²³³⁸	Limburg → Maastricht ⁶⁰⁰⁸
tyd.nl	TYD	TYD has developed specific modules for medical sign language, which were successfully deployed during the Teddy Bear Hospital to guide deaf and hard-of-hearing children.	Language Learning → Language ¹⁶⁸⁹ Education → Pedagogy & Methods ²⁹⁴⁴	sign language ⁶⁸
kunstuithetvuistje.nl	Kunst uit het Vuistje	The material remains current through the addition of new modules.	Arts & Culture → Cultural Education ²⁰⁶ Curriculum & Resources → Educational Resources ⁴⁰¹	image material ¹³ cultural education ⁹⁵ lesson material ¹⁸⁹ methods ⁴⁸¹ student ⁷⁶²³
carwise.nl	CarWise	CarWise is specialized in developing software for rental, leasing, and asset management.	Software Development & Engineering → Software Providers ¹⁰ Business → Industry ³⁶⁹⁷⁷	mobility ¹²⁶⁴ package ⁶¹¹² software ⁸²⁹¹
digineers.nl	Digineers	The website offers modular building blocks (modules) that customers can use to customize and expand their website.	Web Development → CMS ⁵¹⁶ Software Development & Engineering → App Development ¹⁰⁸⁴	online marketing ¹⁰⁸⁵ webdesign ⁴⁰⁹²
qloods.nl	Q Loods	Q Loods delivers prefabricated modules for the construction site.	Garden → Sheds ⁶² Logistics → Storage ¹¹⁷⁰	steel structure ²⁰⁸ kit ⁵²⁶ shed ⁶³⁰ roof ³⁶⁶² quote ¹²⁸⁶³
celon.nl	Celon Solutions	Celon360 consists of various modules that can be used separately or in combination.	Business Software → Productivity Tools ⁴¹⁶	resources ³¹⁰ implementation ¹⁰²⁹ portfolio ⁶⁸⁵⁴
vdo-webshop.nl	VDO Webshop Warehouse	Control modules are part of the systems offered on the website.	Auto Parts & Tires → Tuning ¹⁵² Transportation → Automotive Technology ³¹⁵	sensor ⁴⁸² radio ¹²⁰⁰ instrument ¹²⁹⁵
wincar.nl	Automotive ICT Solutions B.V.	The software is modularly built, allowing users to flexibly select the required functions.	Business Software → Management Software ¹⁴⁶ Automotive → Car Dealerships ¹⁶⁴⁷	business processes ⁵⁶⁴ implementation ¹⁰²⁹ software ⁸²⁹¹
alkpro.nl	ALK-Abelló BV	The site offers accredited learning modules to structure and improve allergy care.	Hospital & Acute Services → Hospitals ⁷³⁵	knowledge center ¹³¹ continuing education ²⁰¹ allergy ²⁵⁴ treatment ²¹²⁰³
suitcase.nl	Suitcase talen	The course is modular and consists of 8 modules, covering levels A1, A2 and B1.	Language → Dutch ⁵⁶⁰	expat ³⁴⁴ level ⁴⁹⁴ teacher ²⁸⁹⁰ course ¹⁴⁷²⁸
bimmercoderen.nl	Bimmercoderen	BMW's contain various control units (modules) that regulate functions, which can be adjusted by Bimmercoderen.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹ Medical Care & Services → Diagnostics & Testing ³⁴⁸	transmission ¹²⁴ feature ³⁰⁰ code ⁵⁰⁹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
dc.nl	Data Connection BV	The software is modular and offers various modules such as financial administration, payroll administration, and projects.	Business Software → ERP Systems ¹⁰⁰⁷ Web Design & Development → Web Services ⁴¹³
nenko.nl	Nenko Snoezelen	The website offers various Nenko Modules that can be used to provide sensory stimulation.	Sustainable Construction → Materials ¹⁰⁴³ Toys → Sensory Toys ²⁰
doorsafe.nl	Doorsafe	The website offers various modules that can be used to extend the functionality of the doorbells.	Technical Aspects → Cameras ³²⁰ Security & Surveillance → Security ³²⁵¹	poe ¹⁰ doorbell ²⁸ screen ¹⁴³⁸ internet ¹⁶⁷⁸
hetrekenprogramma.nl	RekenProgramma B.V.	Calculation modules can help with making calculations.	Business Software → Financial Software ¹⁵¹ Criminal Law → Personal Injury ⁷⁷¹	graph ¹⁰⁴ benefit ²⁴⁷ calculation ⁶⁵⁷ loss ⁷⁴⁰
smartinhuis.nl	SmartinHuis	SmartinHuis sells various modules for self-assembly of smart switch installations.	Technology → Smart Home & Automation ¹¹⁴⁶	socket ¹⁴ dimmers ³⁸ switch ¹⁴⁰ combination ¹⁸⁹
futureliferesearch.nl	Future Life Research	Users can choose modules and determine the order, creating a personalized learning experience.	Entrepreneurship → Social Entrepreneurship ³¹¹ Online Courses → E-Learning ⁶⁰⁶	behavioral change ⁴⁶ competency ²²⁸ e-learning ⁵⁸⁰
beroepsvervoercollege.nl	Beroeps Vervoer College BVC	The courses consist of various modules, such as business management and road transport, providing participants with a wide range of knowledge and skills.	Logistics → Transportation ¹¹⁰² Driving & Vehicle → Vehicle Training ⁵⁵³	diploma ⁷⁹⁵ license ¹²⁸⁸ transport ⁶¹⁰⁵ course ¹⁴⁷²⁸
care4fresh.nl	Care4iT	The modular system of Care4Fresh makes it possible to develop a customized program.	Business Software → Logistics Software ¹⁰³ Transportation → Transportation Management ⁷⁰	fresh products ¹⁵ track and trace ²⁴
landentuinbouwcursussen.nl	Land and Garden Training Courses	The courses are divided into several modules to structure the learning material.	Agriculture → Agricultural Technology & Innovation ⁷⁴³ Business & Management → Certification ³⁶⁴	final exam ¹⁰ cultivation ⁴⁸¹ course ¹⁴⁷²⁸
itgsoftware.nl	ITG software	ITG Groen lite and ITG Groen Pro can be extended with modules to meet the specific needs of the business.	Business Software → Retail Software ⁵⁶ Business Software → Logistics Software ¹⁰³	software ⁸²⁹¹	Gelderland → Barneveld ²⁷⁸¹
zaalreserveringen.nl	i-Reserve	i-Reserve is modular, allowing for easy addition of extra functionalities.	Business Software → Administrative Software ¹⁵⁸	integration ¹⁴⁵¹ hall ¹⁷⁸⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
doc2web.nl	Doc2Web	The website describes the availability of high-quality modules that can be quickly installed and added to the website.	Online Marketing → Website Optimization ²⁶⁵ Web Development → Content Management Systems ⁵⁰²	cms ⁶¹³ design ²⁷²⁰²
kenniscollect.nl	Kenniscollect	The training programs are built up from modules, allowing users to adapt their learning experience.	Online Courses → E-Learning ⁶⁰⁶	excel ²²⁸ knowledge ³⁵²⁸ app ⁴⁵⁹⁵ training ²⁸¹³³
diversionacademy.nl	Diversion Academy	The online tool is comprised of four modules that can be taken separately.	Wellbeing → Happiness ²³⁶ Professional Development → Teacher Training ¹⁶⁶	stigma ²⁰ ambassador ²¹³ conversation ¹⁸²⁸ story ⁸²⁸⁵ training ²⁸¹³³
ega-online.nl	EGA Online	The online course is divided into weekly modules, each containing a new weekly menu and tips.	Nutrition → Nutritional Advice ⁶⁴⁶ Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷	weight loss ⁶⁷⁸ consultant ⁷⁰⁶ recipe ⁵¹⁴² course ¹⁴⁷²⁸
masterpro.nl	MedischOnderwijs.nl	Various modules are available, such as 'Know the LUMC' and 'Basic Airway Management'.	Education & Training → Educational Software ²⁷⁴ Online Courses → E-Learning ⁶⁰⁶	case study ⁵⁶ e-learning ⁵⁸⁰ software ⁸²⁹¹
aquasfeer.nl	Aquasfeer	Aquasfeer uses a proven method where swimming pools are built using 7 modules.	Garden → Swimming Pools ⁶⁰¹	filtration ⁶⁰ water treatment ¹⁶⁶ swimming pool ¹⁶⁶⁴ accessories ¹²⁹⁷⁵
rxmission.nl	Rx.Mission	Rx.Mission offers various modules, such as JeContact and Archiving, which offer different functionalities.	Online Services & Platforms → SaaS ¹⁷¹ Community → Government & Administration ¹⁰⁵⁶⁷	enforcement ¹⁰⁷ supervision ¹¹⁸⁴ license ¹²⁸⁸ data ⁵⁸⁷²
ara-industries.nl	ARA Industries	ARA Industries develops high-quality mechatronics modules and provides custom solutions.	Manufacturing → Industrial Manufacturing ¹⁵⁰ Wood & Furniture → Manufacturers ¹⁵⁵	procurement ⁴⁹³ production ⁴⁵⁸² design ²⁷²⁰²	Gelderland → Aalten ⁹⁶⁴
thunderstock.nl	Thunderstock	Thunderstock offers various modules designed to support different stages of the product lifecycle.	Online Services & Platforms → SaaS ¹⁷¹	demand ⁴⁸ forecast ¹¹⁹ sale ⁵⁹³⁰
one-q.nl	oneQ	The barbecue systems consist of individual modules that can be combined.	Garden → Garden Accessories ⁵⁶⁵ Garden → Grills ⁶⁵	outdoor kitchen ¹³¹ stand ²⁹⁴ barbecue ¹¹⁷⁵ extension ¹⁹⁴¹
be-come.nl	Be-Come	The modules that Be-Come implements at Boma Letu contribute to the realization of the goal of self-sufficiency.	Politics → International Cooperation Projects ⁶⁵⁶ Nonprofits → International Development ⁴²⁰	self-sufficiency ²⁹⁵ community ⁷⁹³¹ child ¹¹⁵⁶⁶
crescentone.nl	CrescentOne, Inc.	The ERP system utilizes a modular design, offering specialized tools for product management, financial control, and more.	Industrial → Industrial Automation ¹⁰⁴² Management & Consulting → Process Optimization ⁶⁵⁴	erp ³⁶³ manufacturing ³⁹⁶ supply chain ⁴¹³ consulting ³⁶³⁹
evolinestore.nl	EVOlineStore	Modules are flexible components that can be combined to create customized solutions for cable management.	Audio → Components ⁴⁸⁹	outlet ²³⁵ cable ⁷³²
honderdprocentec.nl	100% Educatieve Coaching	The language training is offered in modules, which start every ten weeks.	Language Learning → Language Education ⁴²⁷ Education → Adult & Continuing Learning ⁶⁵¹⁰	language training ¹¹² language course ¹⁴⁸ integration ¹⁴⁵¹ teacher ²⁸⁹⁰	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
yogabijdeijssel.nl	Yoga bij de IJssel	The breathing therapy courses are offered in modules ('Ademruimte' and 'Samen Ademen') with specific content and dates.	Therapy → Breathing Therapy ¹⁹⁴ Body & Movement → Exercise ¹⁰⁰⁵	breathing ⁹⁷⁶ yoga ³⁷⁰⁴ registration ⁴³⁶⁶ course ¹⁴⁷²⁸	Heerde → Wapenveld ²⁰³
prismata.nl	Prismata	It offers various packages such as Prismata Enterprise and Lite, based on modules.	Security Systems → Security Technology ³⁹⁹ Software Development & Engineering → Software ¹¹⁶⁰⁸	cost ¹⁹⁹⁰ package ⁶¹¹² security ⁶⁶⁵⁵
trixcomfort.nl	TriX Comfort®	More than 900 TriX modules have already been applied in homes.	Wood & Furniture → Manufacturers ¹⁵⁵ Business & Professional → Trade Shows ⁹⁵¹	floor system ¹⁶ fair ⁵⁸³ climate ⁹³⁴ heat pump ²⁵⁴¹ sustainability ¹⁸⁴⁵¹
vandrunenorthopedie.nl	Van Drunen Orthopedie	The company offers various modules to customize the shoes to the specific needs of the foot.	Shoes → Orthopedic Shoes ⁷¹ Clothing & Accessories → Shoe Stores ⁴⁴¹	factory ⁵²⁶ foot ¹⁹²⁹ shoes ²⁶⁹⁹
volkswagenbedrijfswageninrichting.nl	Bott	Bott offers a system of modular building blocks, which can be easily combined to create the ideal interior.	Storage → Cabinets ⁶¹² Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹	vehicle interior ³⁴ aluminum ¹¹⁹⁷ vehicle ³⁷⁴³
campercompact.nl	Campercompact	The base module of the camperbox contains drawers for storage and cooking, and provides a foundation for the interior design.	Commercial Vehicles & Trucks → Vans ⁵⁸	van ²⁰⁰ cooking ⁸⁰¹ storage ²⁴⁴⁶
acuerdo.nl	Acuerdo	Acuerdo® is modular, enabling users to select the specific functionalities they require.	Business Software → POS Systems ¹⁰¹ Business Software → ERP Systems ¹⁰⁰⁷	erp ³⁶³ revenue ⁶⁹³ inventory ¹⁶¹³
devbird.nl	DevBird	The extensive website offers space for various modules, such as a blog or newsletter system.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	backup ⁴⁹⁴ cms ⁶¹³ package ⁶¹¹²
salvorsbeheer.nl	Salvors VvE & Real Estate Management	Users can determine which management modules they wish to use.	Energy → Energy Management ⁵⁰⁴	real estate management ¹²³ project development ²¹⁵ contact person ²⁴³ vve ⁷⁴⁸ newsletter ⁶⁵⁰⁴
isoware.nl	Metaware	A module is a component of a software package that performs a specific function within the quality system.	Business Software → Management Software ¹⁴⁶ Management → Quality Management ⁹⁰⁹	quality system ⁴⁹ management system ¹¹⁸ documentation ⁴⁵²
fusesolutions.nl	Fuse B.V.	The configurable shell utilizes modules, similar to a Lego set, to meet specific needs.	Events & Hospitality → Planning ⁶⁶³	planning ¹⁹⁶⁹ data ⁵⁸⁷²
digital-division.nl	YOOtheme	The theme’s module menu position allows for flexible widget placement and customization.	Web Design → Content Management ²⁹³ Web Design → Themes ²⁴⁰	font ⁷¹ icon ⁹³ theme ⁴⁰¹⁵ design ²⁷²⁰²
rxenterprise.nl	Rx.Enterprise	The solution offers expandable functionalities through modules.	Online Services & Platforms → SaaS ¹⁷¹ Online & Digital → Digital Services ¹⁰⁰⁸	case ¹¹⁵³ integration ¹⁴⁵¹ data ⁵⁸⁷²
juniorwereldcampus.nl	Junior World Campus	The method consists of various modules that are aligned with the students’ worldview.	Primary Education → Methodologies ⁵³ History → Social Sciences ¹⁰⁷⁸⁶	world orientation ¹⁰ skills ¹¹⁰⁵ student ⁷⁶²³ research ⁸⁹⁶⁷ design ²⁷²⁰²
aceflex.nl	Zonnewinkel en installateur ☀️ Complete oplossingen	Solar panels modules from different brands and specifications are offered.	Electronics & Components → Batteries ³⁷⁶ Energy → Energy Management ⁵⁰⁴	inverter ³¹³ battery ¹⁷⁵¹ solar panels ⁴⁷⁰¹ installation ¹³⁷⁴²
sekurit-beveiliging.nl	Sekurit Beveiliging	Sekurit Beveiliging offers a tailored package of safety measures based on adjustable modules.	Insurance & Risk → Risk Management ¹⁰⁶⁰	sector ¹³³² risk ²⁸⁹⁶ security ⁶⁶⁵⁵
winvis.nl	WinVIS	The WinVIS software is modular, meaning users can only use the functionalities they need.	Business Software → CRM ⁷⁶⁴ Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	relationship management ⁴⁸ database ¹¹⁵³ document ¹⁶⁷⁸ administration ⁶⁵⁸⁷ software ⁸²⁹¹
verkeersbesluiten.nl	Verkeersbesluiten.nl	The offering is modular, allowing customers to choose which services they want to take.	Traffic Management → Traffic ⁵⁸⁹ Legal → Legal Aid ⁴²⁰	traffic regulation ²⁴ workflow ⁴⁰⁷ municipality ⁶⁸³⁷
t-challenge.nl	Simenco	The teacher can add modules to customize the game.	Pedagogy & Methods → Learning Methods ¹⁸⁵	scenario ²⁸¹ learning ⁹²⁰ entrepreneurship ¹⁵⁷⁹ game ²⁸⁰⁷
apartaudioshop.nl	apartaudioshop.nl	Caymon Casy and Vision modules are offered.	Audio → Audio Equipment ⁵⁴⁷ Audio → Amplifiers ¹¹³	mixer ¹⁰⁴ amplifier ³⁰² speaker ¹⁴⁸¹ accessories ¹²⁹⁷⁵ installation ¹³⁷⁴²
tropcrop.nl	Wageningen University	The software is structured into modules, including CropPix, which offers a visual gallery of crops from around the world.	Horticulture & Floristry → Crops ⁹⁶ Adult & Continuing Learning → Distance Learning ²⁴	crop ¹⁸⁸ photo ⁷⁷⁷⁸
wordpresswebdesign.nl	WordpressWebdesign.nl	WordPress modules are additional functionalities that can be added to a website, such as contact forms or e-commerce functionality.	Software Development & Engineering → Content Management Systems ¹⁷	hosting ³¹²⁵ wordpress ³⁵⁵¹ theme ⁴⁰¹⁵
aromatherapiecursus.nl	PURE by Me	The course is structured into multiple modules that organize the learning material.	Alternative Medicine → Aromatherapy ²⁴¹ Emergency & Safety → Alternative Healthcare ⁵⁶⁷	diffuser ⁸² essential oil ⁴²⁸ oil ⁹⁷⁰ recipe ⁵¹⁴² course ¹⁴⁷²⁸
posaiq.nl	Posaïq	Users can opt-in to desired modules that take work off their hands.	Business Software → Cash Register Systems ¹² Marketing & Advertising → Marketing ²¹⁹³⁷	cash register ⁷⁰ partner ⁴²⁷² software ⁸²⁹¹
woudvoorwonen.nl	Woud	The houses consist of modules of biobased materials produced in a timber factory.	House Types → Houses ²⁵⁴⁶ Building & Construction → Sustainable Building ¹⁰⁰⁴	biobased materials ²² house type ⁷⁴ housing corporation ⁴²⁴ house ⁸¹²¹	North-Brabant → Tilburg ⁸⁷⁵⁹
nutritionhub.nl	Nutrition Hub	The website offers various modules, including individual coaching and master classes, tailored to the client's needs.	Nutrition → Nutritional Advice ⁶⁴⁶ Nutrition → Dietetics ⁸¹⁶	nutritional advice ³¹⁷ coach ²⁵⁸¹⁰	Gelderland → Rivierenland Water Authority ¹⁷⁵
waalen.nl	Onderzoeksburo Jan Waalen	The Digitale-Sociale-Kaart has a matching module for adjusting the selection.	Anthropology & Sociology → Sociology ⁴⁵⁴ Information Technology → Data Management ⁸²⁷	map ⁸⁰¹ database ¹¹⁵³ data ⁵⁸⁷²	North-Brabant → Oirschot ⁹²⁹
wistor.nl	Wistor	The platform utilizes modular modules that users can configure themselves.	Data Analysis → Business Intelligence ¹⁰⁰² Information Technology → Data Management ⁸²⁷	asset ⁵⁹¹ data ⁵⁸⁷²
smartfasthouse.nl	Smartfast House	Smartfast House offers various modular solutions, including care homes and small homes.	Building & Construction → Sustainable Building ¹⁰⁰⁴ Fabrication & Production → Prefabrication ⁴¹²	home type ¹⁸ brochure ¹⁶⁴² home ⁷⁹⁷⁶ energy ⁹⁰⁷⁵
revonia.nl	Revonia	It is possible to build everything with their modules.	House Types → Houses ²⁵⁴⁶ Garden → Swimming Pools ⁶⁰¹	outdoor kitchen ¹³¹ cellar ¹³⁴ sauna ¹¹⁷⁵ house ⁸¹²¹
compascare.nl	Com.pas Care	Com.pas Care offers various modules that healthcare entrepreneurs can choose to improve their business operations.	Business Software → Logistics Software ¹⁰³ Management → Business Optimization ¹⁹⁵	business operations ³¹⁰ procurement ⁴⁹³ consulting ³⁶³⁹ administration ⁶⁵⁸⁷
opensourcerer.nl	OpenSourcerer	Modules are extensions for PrestaShop that can enhance the functionality of the webshop, both free and paid.	Web Design → Website Builders ⁸⁸⁸ Software → Open Source ²¹⁰	prestashop ⁴² wordpress ³⁵⁵¹ theme ⁴⁰¹⁵ webshop ⁸⁶⁴⁸
meshconnect.nl	MeshConnect	With 8 years of experience and multiple modules, Mesh Connect is a suitable solution for your problem.	Investing → Asset Management ³¹⁸ Virtual & Augmented Reality → Internet of Things (IoT) ¹⁰⁵	gateway ²⁶ object ²⁷⁰ asset ⁵⁹¹
ci-plus.nl	CI-Plus.nl	Interactive CI+ modules are offered for enhancing digital television functionality.	Electronics & Components → Television ²⁶²	remote control ¹⁰⁹
beweegpartner.nl	Beweegpartner	Beweegpartner offers various modules to implement physical education in schools.	Driving & Vehicle → Educational Services ³⁷⁹	physical education ²¹ teacher ²⁸⁹⁰ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶
wbsoplus.nl	Innovation Funding	Companies can choose which modules of the service offerings best suit their needs.	Financial Services → Fintech ⁵⁰ Economy → Subsidies ²⁰²	subsidy ²⁶⁴⁹ innovation ⁴⁶⁵⁹
elementairboekhoudeninbalans.nl	Management & Organisatie in Balans	The website includes several modules, such as BKB/Elementair Boekhouden in Balans, which help students learn the basics of bookkeeping.	Secondary Education → HAVO ⁸¹ Adult & Continuing Learning → Professional Training ¹²²⁴	exercise ⁷⁰⁶ bookkeeping ¹³¹⁹ exam ²¹²⁰ book ¹¹³⁹⁶
xbusrijnmond.nl	XBUS Dealer in Nederland	The XBUS is modular, with different options available.	Commercial Vehicles & Trucks → Delivery Vans ³⁶ Fuel & Energy → Electric Vehicles ¹²¹²	variant ⁶⁸ electric ²⁶⁹ weight ³⁸²	Katwijk → Katwijk aan Zee ⁶¹⁶
werkenaannederlands.nl	Werken aan Nederlands	The lesson materials are built from modules that can be tested and certified.	Primary Education → Educational Materials ⁷¹¹ Education → Adult & Continuing Learning ⁶⁵¹⁰	lvs ¹⁰ spelling ¹¹⁴ vocabulary ¹³³ reading ⁷⁸⁴
softwareopmaatgemaakt.nl	Softwareopmaatgemaakt	The company has ready-made modules that can be customized.	Enterprise Solutions → Business Systems ⁹¹ Software Development & Engineering → Custom Software ³⁰⁵	software ⁸²⁹¹
mymusicmybusiness.nl	ReCo Culture Management	The workshop utilizes modular content, offering flexibility in terms of topic selection and workshop length.	Insurance → International Insurance ¹³ Industry & Business → Music Businesses ¹³	taxes ⁵⁰⁰ entrepreneurship ¹⁵⁷⁹ contract ²⁴¹⁵ career ²⁵¹³ workshop ¹⁹³²⁵
digitaalmodelspoor.nl	Koen Kuypers	The course is divided into four modules, each focused on specific aspects of digital model railroading.	Model Building → Model Railroading ²⁷³	control center ¹⁷ model railway ⁷⁰
soccercourts.nl	SoccerGround GmbH & Co. KG	Through the different modules, the playing field can be quickly made larger or smaller.	Sports & Entertainment → Sponsorship ¹⁵¹ Sports Activities → Football ⁴¹⁴⁴	configurator ²³⁴ trailer ¹⁶²⁴ sponsorship ²⁶⁸⁶
rocketwebsites.nl	Rocket Websites	The website offers the possibility to add functionalities to the website using modules.	Web Design → Website Builders ⁸⁸⁸ Online Marketing → Website Optimization ²⁶⁵	wordpress ³⁵⁵¹ security ⁶⁶⁵⁵ design ²⁷²⁰²
soft-integrations.nl	Soft-Integrations	Si-Planner contains various modules that encompass different aspects of service management, such as configuration and execution.	Management → Process Management ³⁰¹	software ⁸²⁹¹
ivas.nl	Human Data Processing BV	The system is modular, meaning that users only select the modules they need and can easily add them later.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Cash Register Systems ¹²	administration ⁶⁵⁸⁷ rental ⁷²⁵⁷ software ⁸²⁹¹ webshop ⁸⁶⁴⁸
m-tms.nl	Thom Derks & Rik Verbeek	The MTMS is built from various modules that can be customized to the customer's needs.	Business Software → Accounting Software ⁹⁸⁴	invoicing ²⁹² statistics ³⁹² bookings ⁵²³
zicht-op-gezondheid.nl	Zicht op Gezondheid	With four smart modules, the AO Scan provides detailed analyses of vital functions and other aspects of health.	Alternative Medicine → Biofeedback ¹⁵ Software Development & Engineering → Digitalization ²⁷⁶	frequency ⁷³ scan ⁷⁹⁰ balance ⁴⁵⁸² energy ⁹⁰⁷⁵
engineeringdatamanagement.nl	Polaris Engineering	EDM comprises interconnected modules, each addressing specific plant issues.	Software Development & Engineering → Software ¹¹⁶⁰⁸	edm ¹⁰ requirements ⁹⁴ database ¹¹⁵³ plant ⁴⁵⁰⁹
isolatieacademy.nl	Isolatie Academy	The training courses are divided into modules, each focused on a specific aspect of insulation.	Training → Specialized Training ⁹⁴ Insulation & Glazing → Insulation ¹⁵⁴³	participant ¹⁹³⁴ insulation ²⁴⁴⁸ certification ³³⁸⁰ training ²⁸¹³³
level-x.nl	3minds web/design+	Depending on the subscription, users can add different modules, such as project management, product management or webshop functionality.	Online Marketing → Website Management ³⁶⁹ Enterprise Solutions → Business Software ⁶¹⁵⁶	subscription ³²⁸⁷	Netherlands → Groningen ²³⁷³⁴
autorijschoolmila.nl	Autorijschool Mila	The Steps in Driving Education (RIS) teaches driving lessons in modules to give the learner structure.	Driver & Vehicle → Post-Secondary Education ⁴⁰	refresher course ⁶⁴ driver’s license ⁴³⁸ driving lesson ⁷¹²	Stichtse Vecht → Maarssen ¹⁰⁵¹
brandmeldinstallatieshop.nl	Brandmeldinstallatieshop	The website offers modules that are used in combination with the fire alarm systems.	Safety → Fire Safety ¹⁰⁴⁸ Tools & Equipment → Technical Stores ¹⁴	siren ¹² smoke detector ¹¹³ fire alarm system ¹⁵⁵	Sittard-Geleen → Geleen ⁹⁷⁸
de-dwarsliggers.nl	De Dwarsliggers	The layouts are built on modules, small independent setups.	Model Building → Model Railroading ²⁷³		Drenthe → Emmen ³³⁴⁸
p49.nl	Mail P49	P49 develops various software modules, such as call center and lead software.	Business Software → ERP Systems ¹⁰⁰⁷ Business Software → Productivity Tools ⁴¹⁶	erp ³⁶³ ict ¹⁰⁴⁹ automation ²⁶⁸² software ⁸²⁹¹
promitis.nl	Promitis	Promitis offers modular purchasing solutions that are customized to the specific needs of the client.	Construction & Maintenance → Procurement ⁵⁶⁷	cost reduction ²⁸ contract management ²¹⁰ detachment ²⁶⁶ outsourcing ³⁰⁵ procurement ⁴⁹³
recreatieparkmanager.nl	RecreatieparkManager B.V.	The software is built from various modules, including Personnel, Hours and Revenue.	Business Software → HR Software ⁶⁴⁹	functionality ⁴¹⁷ revenue ⁶⁹³ webinar ⁸⁷⁰ personnel ¹⁰⁸⁴ park ¹⁸⁶³
thefutureballers.nl	The Future Ballers	The website offers the possibility to register for a training module.	Football → Football Training ¹⁰	football school ⁵⁰ atmosphere ⁵⁵⁹¹ training ²⁸¹³³	Lingewaard → Bemmel ⁵⁰⁹
tkwebdiensten.nl	TK Webservices	The website demonstrates the use of modules, a way to add functionality to a website.	Web Design → Content Management ²⁹³ Software Development & Engineering → Content Management Systems ¹⁷	content management system ⁴¹ webdesign ⁴⁰⁹² article ⁶⁰⁰⁰	Gemert-Bakel → Gemert ⁶⁰¹
webfirst.nl	TryFirst	WebFirst! is modular and can be easily extended with new modules for various functionalities.	Online Marketing → Website Management ³⁶⁹ Software Development & Engineering → Web Applications ¹⁰⁰⁵	cms ⁶¹³ server ¹⁰³⁶ database ¹¹⁵³
qlabour.nl	Q-Labour&Partners	The website describes various modules that can be deployed to meet the effort and outcome obligations.	Social Issues → Participation ¹⁰²³ Social Issues & Welfare → Social Affairs ⁶⁰¹	participation act ³⁰ implementation ¹⁰²⁹ candidate ¹⁸⁹⁶ municipality ⁶⁸³⁷
uwkassaonline.nl	Uwkassaonline.nl	The system is built from modules, allowing users to only select the necessary functionality.	Enterprise Solutions → Business Software ⁶¹⁵⁶ E-Commerce → Webshop Integrations ¹⁰	pos system ⁷⁸ inventory ¹⁶¹³ webshop ⁸⁶⁴⁸
grand-case.nl	grand-case.nl	The company can easily add new modules to the developed applications, making them flexible and adaptable.	IT → Software Services ⁵⁹ Technology → Software Development & Engineering ¹⁷⁶⁴⁷	cost ¹⁹⁹⁰ application ³³⁷⁷ software ⁸²⁹¹
wordpresscursusineendag.nl	Yellow Lemon Tree	Additional WordPress modules are available for further deepening of knowledge.	Technology & IT → Computer Training ¹⁴⁰ Software Development & Engineering → Content Management Systems ¹⁷	developer ⁴⁰⁶ wordpress ³⁵⁵¹ course ¹⁴⁷²⁸	Utrecht → Amersfoort ⁸⁰¹¹
prodrivelearning.nl	Prodrive Learning	The program consists of various modules that are regularly updated.	Corporate Training → Safety Training ⁷⁴⁵ Online Courses → E-Learning ⁶⁰⁶	fuel ⁴²⁴ behavior ¹⁷⁷⁹ vehicle ³⁷⁴³ video ⁶⁷¹⁴ training ²⁸¹³³
nomadichome.nl	Nomadic Home	The domes are constructed from modules, enabling flexibility in assembly and disassembly.	Alternative Housing → Tiny Houses ¹⁶¹	dome ⁴⁴ felt ²⁰⁸ fireplace ⁷⁵² frame ⁸⁸³
digitaleimpuls.nl	Site-supply	The website contains various modules that can be used to customize and expand the website.	Online Marketing → Website Management ³⁶⁹ Web Development → Content Management Systems ⁵⁰²	login ¹⁶⁰ functionality ⁴¹⁷ cms ⁶¹³ newsletter ⁶⁵⁰⁴
compoline.nl	Rhythm & Joy	The Compoline system is based on the use of various cabinet modules, making an infinite number of different cabinet designs possible.	Storage → Cabinets ⁶¹²	rhythm ²³¹ cabinet ¹⁷³⁰ design ²⁷²⁰²
paardbewust.nl	Paardbewust	The program is divided into four modules, each with a specific theme.	Horses → Horse Care ⁴⁸⁸	quiz ⁷¹⁰ skills ¹¹⁰⁵ knowledge ³⁵²⁸ horse ⁴³³⁷
im-systems.nl	IM Systems	The systems consist of various modules that work together to form a complete safety system.	Electrical Engineering → Safety Systems ⁶¹ Safety → Fire Safety ¹⁰⁴⁸	communication system ¹⁹ safety system ²² track & trace ³⁴ camera system ¹⁶¹ software ⁸²⁹¹	Houten → Leebrug ²⁰
trainstation.nl	TrainStation	TrainStation’s features are modular, ensuring flexibility and adaptability.	Business Software → HR Software ⁶⁴⁹	engagement ²³⁹ concept ³³³⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
uitgeversgroep.nl	Educatieve Uitgeversgroep	The teaching materials are modularly structured to enable teachers to shape their own training programs.	Primary Education → Educational Materials ⁷¹¹ Curriculum & Resources → Educational Resources ⁴⁰¹	teaching materials ³⁷ teacher ²⁸⁹⁰ webshop ⁸⁶⁴⁸ event ⁴⁵¹⁹⁹
qlic.nl	Qlic	Qlic uses modular building blocks to create unique and successful custom software.	Software Development & Engineering → Custom Software ³⁰⁵	laravel ¹⁸² success ⁶⁰³ connection ⁴⁰⁰⁷ software ⁸²⁹¹
wiser.nl	Wiser	Wiser is modular, allowing users to only use the necessary features.	Web Development → Content Management Systems ⁵⁰² Software Development & Engineering → Content Management Systems ¹⁷	product catalog ¹³ cms ⁶¹³ seo ³⁷⁰⁷ app ⁴⁵⁹⁵
segestia.nl	Segestia Solutions	Segestia Solutions' solutions are modularly built, ensuring flexibility and scalability.	Technology → Software Solutions ²¹⁵ Software Development & Engineering → Custom Software ³⁰⁵	application ³³⁷⁷ software ⁸²⁹¹ webshop ⁸⁶⁴⁸
disy.nl	DiSy	DiSy is built on a modular system, allowing users to select the desired functionalities.	Software → Medical Software ¹⁷ Medical Care & Services → Healthcare Management & Administration ²⁰⁴	epr ¹² patient ⁴⁰⁸²
samvandalen.nl	Sam van Dalen	The SPN-TEC system utilizes a ratchet system and cables to hold the shoes together, creating a flexible and adjustable design.	Design → Product Design ⁷²² Fashion → Footwear ³⁵	shoes ²⁶⁹⁹ design ²⁷²⁰²
zorgflex.nl	Zorgflex	The system’s modular approach, where users select and adapt functionalities, is crucial for flexibility.	Business Software → Accounting Software ⁹⁸⁴ Health → Medical Care & Services ²⁹⁴⁶¹	ecd ³¹ planning ¹⁹⁶⁹ rate ²⁶⁰⁶ care ¹²³³⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
datagate.nl	DataGate b.v.	DataGate is modular, meaning users can select only the functions they need.	Education & Training → Database Management ²⁹⁰ Resources → Databases ³⁴⁸	overview ³²⁹ database ¹¹⁵³ insurance ⁶³⁵⁹	Wijdemeren → Nederhorst den Berg ²⁰⁷
leerpleinomgevingsrecht.nl	LeerpleinOmgevingsrecht	The functionality of the platform can be offered as modular components or customized.	Education & Training → Learning Management Systems ²⁴ Human Resources → Talent Management ⁵³⁷	lms ⁵⁰ talentmanagement ⁵⁵ competency ²²⁸ diploma ⁷⁹⁵
schoolmonitor.nl	Schoolmonitor	The platform utilizes a modular system, allowing users to flexibly select and implement specific components.	Enterprise Solutions → Enterprise Software ¹⁰³ Business & Management → Educational Management ³⁷⁵	quality assurance ¹⁴⁴ planning ¹⁹⁶⁹ policy ²¹⁴⁹
maas-se.nl	Maas Software Engineering B.V.	All Maas-SE products are modular, allowing customers to select only the features they require.	Data Analysis → Business Intelligence ¹⁰⁰² Technology → Software Solutions ²¹⁵	business intelligence ²²⁷ application ³³⁷⁷ software ⁸²⁹¹ maintenance ²⁰⁰⁹³	Netherlands → Groningen ²³⁷³⁴
cimplecms.nl	Cimple B.V.	Cimple is modular, allowing for easy expansion in the future.	Software → Open Source ²¹⁰ Web Development → Content Management Systems ⁵⁰²	cms ⁶¹³ application ³³⁷⁷
smartradio.nl	Smartradio	The platform utilizes modular, pay-as-you-go fees, allowing users to select only the functionalities they require.	Streaming → Streaming Media ²⁰ Entertainment → Radio Broadcasting ¹¹	api ²⁷⁶ stream ⁶⁸⁴ radio ¹²⁰⁰ cloud ¹⁵²⁷
abcrm.nl	ABCrm	ABCrm's modular nature allows users to customize the functionality of the software to meet their specific needs.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	crm ⁵⁹¹ record ¹⁰⁹⁸ cloud ¹⁵²⁷
workbase.nl	Workbase	The program is modular, allowing it to grow with the company’s needs.	Customer Relations → CRM (Customer Relationship Management) ⁴⁶⁸	crm ⁵⁹¹ dashboard ¹³⁷⁴ administration ⁶⁵⁸⁷ software ⁸²⁹¹
plcshop.nl	PLCSHOP.nl	The XLogic SuperRelay is a compact and expandable CPU that replaces current mini PLCs.	Technology → Electronics & Components ¹¹²⁶¹	timer ³⁶ plc ⁹⁸ software ⁸²⁹¹
elementsamsterdam.nl	Elements Amsterdam	Element 01 is a modular design, meaning it can be adapted to changing needs and circumstances.	Business Software → Productivity Tools ⁴¹⁶ IT Services & Consulting → Office Automation ¹⁸⁷	workspace ⁷⁹⁵ cabinet ¹⁷³⁰ app ⁴⁵⁹⁵ design ²⁷²⁰²
manbedrijfswageninrichting.nl	MAN Bedrijfswageninrichting Bott	Bott Vario3 offers a modular system, allowing the interior to be easily adapted to the specific needs of the customer.	Commercial Vehicles & Trucks → Delivery Vans ³⁶	van ²⁰⁰ aluminum ¹¹⁹⁷
dekassa.nl	DeKassa	DeKassa is designed modularly, allowing the system to be easily adapted to the specific needs of the store.	Business Software → Retail Software ⁵⁶ Business Software → POS Systems ¹⁰¹	backoffice ¹¹⁴ article ⁶⁰⁰⁰
impaqt-zorg.nl	Impaqt Zorg	The services are offered as modular training packages.	Technology & Tools → Marketing Technology ³² Management → Team Development ⁶¹⁷	team development ²⁷⁷ leadership ³⁷²⁴ communication ¹⁰¹⁶² collaboration ¹⁶⁰³⁶ coach ²⁵⁸¹⁰
tree-pod.nl	TREE-POD®	The Tree-Pod is modular and can be easily adapted to different needs.	Occupational Medicine → Ergonomics ³²⁹ Computer → Computer Accessories ¹²²	laptop stand ¹⁵ ergonomics ²⁷⁷ position ⁸⁷⁵
tolteek.nl	Tolteek	INDIGO is modularly designed, allowing partnerships to choose which modules they want to use.	Software Development & Engineering → Software ¹¹⁶⁰⁸ Education → Special Needs & Support ⁶³⁷²	requests ¹⁹⁷ partnership ¹⁴⁰⁷ data ⁵⁸⁷²
prodiz.nl	Prodiz	The software is modular and can be extended with various functionalities.	Online Marketing → Narrowcasting ¹⁴ Applications → Business Applications ¹²	template ⁷⁴² audience ⁹⁰¹ screen ¹⁴³⁸ branding ⁴⁶¹⁴	Amersfoort → De Berg-Zuid ¹⁴
vangoedenhuizen.nl	Van Goeden Huizen	The modular elements can be arranged in different ways to create different types of homes.	Sustainable Living → Sustainable Housing ¹⁸⁷ Fabrication & Production → Prefabrication ⁴¹²	modular construction ²⁶ neighborhood ²⁴²⁴ environment ⁴⁸⁷³ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹
liontron-lithium.nl	LIONTRON	The batteries are designed in a modular way, allowing for replacement of parts.	Electronics & Components → Batteries ³⁷⁶	bms ¹⁸ lithium ²¹ battery ¹⁷⁵¹ safety ⁵⁸¹⁹
tiny-town.nl	Tiny-Town B.V.	The houses are based on modular building methods, making them flexible and easy to adapt.	Social Housing → Small-Scale Housing ⁴⁴	target group ⁵⁷⁸ flexibility ⁹⁹⁶ wishes ²⁷¹⁷ home ⁷⁹⁷⁶ sustainability ¹⁸⁴⁵¹	North-Holland → Hilversum ⁴³⁹⁷
elitelabs.nl	Elitelabs	The MAEX Export Modules automate data processing.	Technology → Software Solutions ²¹⁵ Software Development & Engineering → Software Providers ¹⁰	calculator ⁴⁷⁵ ict ¹⁰⁴⁹ document ¹⁶⁷⁸ software ⁸²⁹¹	Overijssel → Twenterand ⁸⁴⁸
anneniemeijer-salesacademy.nl	EK SOLAR ENERGY	Data center micromodules and rack backup batteries are offered as specialized components for power systems.	Electronics & Components → Batteries ³⁷⁶ Electronics & Components → Power Supplies ¹³	lithium battery ¹⁹ energy storage ²⁸¹ cabinet ¹⁷³⁰ battery ¹⁷⁵¹
frontnet.nl	BackNet	The ERP application being developed is modular, offering customers the flexibility to customize their own package.	Business Software → ERP Systems ¹⁰⁰⁷ Business Software → CRM ⁷⁶⁴	business operations ³¹⁰ newsletter ⁶⁵⁰⁴ communication ¹⁰¹⁶²
oskarmedia.nl	OSKARmedia	The website's theme utilizes a modular system, enabling users to easily control and disable features.	Themes → WordPress Themes ¹⁴⁵ Audio → Audio Equipment ⁵⁴⁷	audio ⁹³⁴ wordpress ³⁵⁵¹ theme ⁴⁰¹⁵ video ⁶⁷¹⁴	North-Holland → Amsterdam ⁴¹²⁵³
compliancy4u.nl	Compliancy4U	Services are offered in a modular format, allowing organizations to select the needed services.	Consulting → Privacy Consulting ¹¹ Law → Privacy Law ⁷¹	gdpr ¹⁷⁹ compliance ⁵⁰⁶ privacy ¹²⁸⁶ risk ²⁸⁹⁶

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.