Food, Snacks, and Pet Supplies | All Dutch websites

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳snack ²⁹¹⁶	Food and Snacks Delivery Directory	This category lists online platforms for ordering prepared food and snacks.
↳snack + Other ¹⁸⁶⁶	Food, Snacks, and Pet Supplies	Websites listed offer a diverse range of culinary options, from fast food and restaurant delivery to catering services and bakeries. Many platforms facilitate online ordering for meals, snacks, and beverages, including specialized cuisines like Indonesian, Surinamese, and Asian dishes.

1866 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
cafetariaegmond.nl	Cafetaria Egmond	Cafetaria Egmond is a cafe and restaurant located on the beach of Egmond aan Zee, offering fresh meals and snacks, with delivery services.	Quick Bites → Cafeteria ⁹⁰⁶ Beach → Beach Facilities ³⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Bergen → Egmond aan Zee ³⁶²
quick-snack.nl	Cafetaria Quick Snack	Cafetaria Quick Snack is a snack bar located in Winterswijk that offers a variety of fries and snack products.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	fry ⁵⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Winterswijk ¹²²¹
hetstuupke.nl	Cafetaria 'T Stuupke	The website ‘T Stuupke Online bestellen offers an online webshop where customers can order various products, including fries, snacks, sandwiches, drinks, ice cream, and party snacks. They also offer delivery services.	Quick Bites → Cafeteria ⁹⁰⁶	kidsbox ³⁸ menus ²²¹ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Twenterand → Stationslaan ²⁶⁶
teck-snecks.nl	Teck Snecks	The website is a webshop that offers natural dog snacks, specifically aimed at Teckel and other dog breeds.	Pet Food → Dog Food ³²¹ Web → Websites ²⁰²⁸	teckel ⁵⁶ cat ¹⁵⁷⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ ship ⁵¹⁰³ dog ⁵⁴⁸³
bartelscatering.nl	Bartels Catering	The website of Bartels Catering presents and promotes catering services, including sandwiches, business catering, and catering for various occasions, with a focus on quality and customization.	Cafes & Lunch → Lunchroom ⁴⁴⁶	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶
haakwerk-antoinette.nl	Haakwerk Antoinette	The website of Haakwerk Antoinette provides information and options for renting vending machines.	Games & Play → Games ³⁹¹¹ Family Fun → Family Activities ¹⁴⁹³	craft supplies ³⁸ vending machine ¹²⁷ snack ²⁹¹⁶
patriesnatuurlijkhondenvoeding.nl	PatriesNATUURLIJK Hondenvoeding	PatriesNATUURLIJK Hondenvoeding is a website that sells natural dog food and snacks.	Pet Food → Dog Food ³²¹ Animals → Pet Stores ⁴⁷⁸	dog food ²⁰⁴ treat ³⁷³ shopping cart ¹⁵²¹ snack ²⁹¹⁶	Rotterdam → Pernis ¹⁴²
proeflokaal32.nl	Lokaal 32	Lokaal 32 is a tasting room in Ravenstein that serves beer from brewery 32 and Warsteiner, along with a selection of snacks and dishes, including the famous 'lumberballs'. It offers a setting for enjoyable gatherings and group parties.	Beer → Breweries ³³⁷ Beer → Specialty Beer ¹¹³	tasting room ¹⁰⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ party ⁵⁹²⁸	Oss → Ravenstein ²⁴⁶
sukayaversvoer.nl	Sukaya Vers Voer	The website of Sukaya's Vers Voer presents and sells natural, complete raw food for dogs and cats, as well as related products and accessories.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	barf ¹¹ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ brand ¹⁷⁷³⁷
vannibezorgd.nl	Vanni Eethuis	Vanni Eethuis is a restaurant located in Den Helder that specializes in Sri Lankan cuisine, offering dishes such as curries, roti, grilled items, and snacks.	Fine Dining & Gastronomy → Specialty Restaurant ⁴⁷	roti ³⁰³ curry ³⁵⁵ beverage ⁵⁸⁶ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Den Helder ¹⁸⁸⁶
gildestam.nl	NJF	The NJF’s New Year’s party, organized by the Gildestam Huysmangroep III in Zwolle, aims to celebrate the new year with music, beer, and fellow scouting friends.	Scouting → Scouting Groups ²⁵⁷	scouting ⁸⁶⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ music ¹³¹⁷⁰	Overijssel → Zwolle ⁷³⁹⁵
cafetariateldersweg.nl	Foodticket	The website of Cafetaria Teldersweg is an online platform for ordering meals, snacks, and drinks, offering delivery, pick-up, and self-collection in Rotterdam.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	prize wheel ⁴⁰² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
halalhapjes.nl	Foodking Catering	Foodking Catering is a company providing catering services, including snacks, tapas, and complete meals, with a focus on fresh and Halal options.	Quick Bites → Food Trucks ⁶²³ Delicacies & Specialty Foods → Halal Food ¹²	halal ¹⁶⁵ meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Flevoland → Almere ⁷⁷⁶⁵
speeddateinutrecht.nl	SPEEDDATE UTRECHT	The website SPEEDDATE UTRECHT offers speed dating evenings for singles and couples, with a focus on meeting potential partners in Utrecht.	Social Media → Dating ¹⁶⁴⁴ Entertainment → Social & Events ³³⁸	speeddate ⁵³ hostess ¹⁶⁵ dinner ¹⁵³³ participant ¹⁹³⁴ snack ²⁹¹⁶ match ³⁴⁷¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
verbindt-gezondleven.nl	Verbindt Gezond Leven	Verbindt Gezond Leven is a website offering tips and advice for a healthier lifestyle.	News & Journalism → Health News ²⁷	snack ²⁹¹⁶ article ⁶⁰⁰⁰ health ⁶³⁶⁶ blog ¹³³⁹²
cateringserviceelferink.nl	Catering- and Party Service Elferink Wierden	The website of Catering- and Party Service Elferink Wierden presents a wide range of catering services, including buffets, snacks, gourmet, fondue, barbecue and party services, with a focus on the Wierden region and surrounding areas.	Social & Events → Party Services ¹⁸⁷ Gifts & Souvenirs → Liquor Stores ²³³	party service ²⁸ barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Overijssel → Wierden ⁷⁸¹
speeddatenineindhoven.nl	Speeddaten Eindhoven	The Speeddaten Eindhoven website offers speed dating evenings in Eindhoven, focused on facilitating romantic encounters between singles.	Dating → Speed Dating ²² Community & Social → Social Events ⁴¹⁶	speeddate ⁵³ hostess ¹⁶⁵ evening ²⁸⁷ snack ²⁹¹⁶ match ³⁴⁷¹
gregsschaafijs.nl	Greg's Schaafijs	Greg's Schaafijs is a company specializing in the preparation and delivery of shaved ice, syrups, sandwiches, snacks, and pancakes for events.	Beverages → Tea ⁸²⁹ Quick Bites → Food Trucks ⁶²³	syrup ⁵⁴ ice ¹⁷⁸ pancakes ⁵⁶⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ event ⁴⁵¹⁹⁹
cafetariaklapwijk.nl	Cafetaria Klapwijk	The website of Cafetaria Klapwijk is an online platform where visitors can order homemade fresh fries, snacks, menus, and beer, or pick up the dishes on-site.	Quick Bites → Cafeteria ⁹⁰⁶	kibbeling ¹¹⁵ pickup ⁷³⁶ fries ²⁷⁵³ beer ²⁸⁸⁷ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
martinsplace.nl	Martin’s Place	Martin’s Place is a doner and coffee roastery located in Nijmegen, offering natural products including lunch, ice cream, coffee, and snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	doner ¹³¹ photo gallery ²⁰⁶ ice cream ¹⁰⁰⁰ lunch ¹⁵³⁴ snack ²⁹¹⁶ coffee ³⁸³⁸	Gelderland → Nijmegen ⁹³⁸⁴
snackplaza.nl	Snack Plaza	Snack Plaza Schalkhaar is an online platform and physical snack business that offers delivery and/or rental of fries, burgers, snacks, and various meals.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Deventer → Schalkhaar ¹³⁸
speeddatenindenhaag.nl	Speed Dates The Hague	The website Speed Dates The Hague offers speed dating events in The Hague, where singles meet in a friendly setting with drinks and snacks.	Social Media → Dating ¹⁶⁴⁴	online tool ²¹ speeddate ⁵³ hostess ¹⁶⁵ snack ²⁹¹⁶ match ³⁴⁷¹ atmosphere ⁵⁵⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
beerforgirls.nl	Beer For Girls	Beer for Girls organizes beer tastings, primarily targeting women, in Rotterdam and other locations in the Netherlands, combining beer and delicious food.	Culinary & Tastings → Beer Tasting ⁹¹ Community & Social → Social Events ⁴¹⁶	beer tasting ⁴⁷ beer ²⁸⁸⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-stationsplein.nl	Cafetaria 't Stationsplein	The website 'Cafetaria 't Stationsplein Online bestellen' offers an online web store where customers can place orders for various meals and snacks, which are then delivered to their homes. The menu includes kebab, pizzas, sandwiches and other drinks and desserts.	Quick Bites → Cafeteria ⁹⁰⁶	kebab ²⁷⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Limburg → Weert ²⁰³⁰
cafetariadebank-esbeek.nl	Cafetaria de Bank	Cafetaria de Bank is an online platform where customers in Esbeek can order dishes from the cafeteria. It offers a comprehensive menu with a variety of snacks, sandwiches, meat products, and fries.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	frikandel ¹⁸ croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Hilvarenbeek → Esbeek ⁸⁷
cateringwilliam.nl	Catering William	Catering William is a catering company specializing in providing complete event services, including venue, decoration, and meals, with a focus on creativity and personalized service.	Venues → Event Spaces ⁴³² Venues → Wedding Venues ²³²	personal attention ¹⁹⁴ venue ⁸⁷⁹ snack ²⁹¹⁶ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	North-Brabant → Nuenen ca ⁹⁰⁶
charlykerschoten.nl	Cafetaria Charly Kerschoten	The website of Cafetaria Charly Kerschoten in Apeldoorn offers online ordering for delivery, with the option for online payment and points earning.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
detulp-oldenzaal.nl	Cafetaria De Tulp	Cafetaria De Tulp is an online ordering platform and official website of a cafeteria in Oldenzaal that offers various potato, snack, and meal options, including delivery and pick-up.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	family menu ¹² hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Overijssel → Oldenzaal ¹²¹⁹
dogsdelicious.nl	Dogs Delicious	The website of Dogs Delicious is an online store and market vendor for high-quality dog and cat food, accessories, and grooming products, with the option for home delivery.	Markets → Local Markets ¹⁵³ Pet Food → Dog Food ³²¹	harnesses ⁷⁶ dog food ²⁰⁴ collar ²⁴² snack ²⁹¹⁶ food ³⁸⁷²	North-Brabant → Eindhoven ¹¹⁸⁴⁵
grillhuis-sultan.nl	Eetcafé Sultan IJmuiden	The website of Eetcafé Sultan IJmuiden is an online platform where visitors can order Turkish pizzas, fries and other snacks for delivery or takeaway. The restaurant also offers a menu and information about opening hours and locations.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Velsen → IJmuiden ¹¹⁰⁹
lisefoods.nl	Lise Foods	Lise Foods is a company specializing in coconut chips and related food products.	Snacks → Chips ¹⁹ Quick Bites → Snack Bar ⁵⁸⁰	coconut ²¹ fiber ¹⁶⁷ netherlands ¹³⁷⁶ snack ²⁹¹⁶ marketing ⁷¹⁰⁷	South-Holland → Rotterdam ²⁵⁰⁴⁸
new-kam-yin.nl	New Kam Yin	The website New Kam Yin in Amsterdam South-East offers the possibility to view the menu online and order dishes.	Dishes → Soups ⁸⁷	rice dishes ⁷⁶ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Amsterdam → South ¹⁴⁸⁸
patatoplocatie.nl	Don Snacks	Don Snacks rents professional snack trucks for various events.	Fast Food → Fries ⁹⁴⁹ Freight & Logistics → Trucks ⁸⁹⁹	guide ¹³⁶⁴ truck ¹⁴¹² snack ²⁹¹⁶ package ⁶¹¹² event ⁴⁵¹⁹⁹
pizzacorner-denhaag.nl	Pizza Corner Den Haag	The website Pizza Corner Den Haag allows customers to order pizzas, fries, snacks, and sandwiches online in The Hague.	Fast Food → Fries ⁹⁴⁹	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
eurolines.nl	Eurolines	Eurolines.nl is a website that covers various topics, including travel, food, and online gambling.	Andalusia → Costa Del Sol ¹⁰²	startpage ⁸² snack ²⁹¹⁶ vacation ⁴²³⁴
bakkerbart.nl	Bakker Bart	The website of Bakker Bart offers the possibility to order filled sandwiches, paninis, and other treats, both for personal use and for business lunches.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	panini ¹⁵⁶ shopping cart ¹⁵²¹ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹
desmickel.nl	De Smickel	De Smickel is a restaurant chain with multiple locations offering food, snacks, and fries.	Bars & Pubs → Casual Dining ²¹⁷ Gifts → Gift Cards ⁹⁸¹	gift certificate ⁶⁴⁶ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Laarbeek → Beek and Donk ³⁷³
darf.nl	DARF	DARF is an online shop offering fresh, high-quality meat for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	dry food ¹³ cat ¹⁵⁷⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ ship ⁵¹⁰³ dog ⁵⁴⁸³
pawnatural.nl	For a Better World Feed & Eat Natural	The website offers natural dog and cat food for online ordering.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	dry food ¹³ cat food ⁹⁸ dog food ²⁰⁴ allergy ²⁵⁴ snack ²⁹¹⁶
proloris.nl	Proloris	Proloris is a strategic marketing consultancy offering online store services and product discovery.	Marketing → Market Research & Analysis ⁴⁴⁰	checkout ²⁹ philosophy ⁵⁷⁰ online store ⁹⁰⁵ consultancy ²⁵⁹⁶ snack ²⁹¹⁶ marketing ⁷¹⁰⁷
wmxl.nl	Dedicated Solution B.V.	Warung Mini XL is a restaurant specializing in Surinamese-Javanese cuisine, sandwiches and snacks, with locations in The Hague, Berkel en Rodenrijs, and Rijswijk.	Food Delivery → Indonesian ⁵⁰² Catering & Ready Meals → Asian Cuisine ¹³⁷	ingredients ²³⁴⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ recipe ⁵¹⁴² restaurant ¹¹²¹⁵	Lansingerland → Berkel and Rodenrijs ⁹²⁹
hush.nl	Hush	Hush is a shop and restaurant offering freshly filled sandwiches, pizzas, snacks and gifts.	Cafes & Lunch → Lunch Spots ²³⁷	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ gift ⁶⁴⁴² catering ⁶⁴⁵⁶	Twenterand → Vriezenveen ⁴⁸⁷
suikertuintjevandebetuwe.nl	Bakkerij Het Suikertuintje van de Betuwe	Bakkerij Het Suikertuintje van de Betuwe is an online shop and physical bakery offering a variety of breads, treats, and specialty baked goods.	Bakery & Food Production → Bread ⁷⁶⁵	bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ webshop ⁸⁶⁴⁸ blog ¹³³⁹²	Buren → Maurik ¹⁶²
arnold-online.nl	Cafetaria Arnold Online	Cafetaria Arnold Online is a website where customers can order snacks and meals for delivery in Edam-Volendam and the surrounding area.	Fast Food → Fries Restaurants ⁸⁷	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Edam-Volendam → Volendam ⁹⁴⁸
intersnack.nl	Intersnack Nederland BV	The website of Intersnack Nederland presents the company’s activities, primarily the sale of savory snacks such as chips, nuts, and pretzels, and the focus on sustainability and innovation.	Food & Beverage → Food Industry ⁸³⁵	revenue ⁶⁹³ snack ²⁹¹⁶ brand ¹⁷⁷³⁷ sustainability ¹⁸⁴⁵¹
sultana.nl	Sultana	The website of Sultana presents their product range and the philosophy behind their snacks.	Chocolate & Sweets → Confectionery ¹¹⁹	biscuit ³⁹ fruit ¹¹⁶⁶ snack ²⁹¹⁶
proeflokaaltgelagh.nl	Proeflokaal ‘t Gelagh	Proeflokaal ‘t Gelagh is a cozy meeting place in Oisterwijk specializing in the sale and tasting of beers and whiskies.	Bars → Pubs ⁵⁴⁶ Gifts & Souvenirs → Liquor Stores ²³³	whisky ³⁷³ taste ⁹³³ beer ²⁸⁸⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	North-Brabant → Oisterwijk ¹⁴²²
cowporation.nl	Cowporation	Cowporation is an online farmshop that sells naturally raised Limousin meat and related products, and offers a farm visit experience.	Farms & Farm Businesses → Organic Farms ⁶⁷ Meat → Beef ¹⁸³	limousin ¹⁷ farm shop ²⁰⁴ visit ³⁸⁰ meat ²⁰⁵⁵ snack ²⁹¹⁶	South-Holland → Alblasserdam ⁸²⁶
en-garde.nl	En Garde	The website En Garde provides culinary inspiration and information on dishes from various cuisines around the world.	Blogs → Food Blogs ²⁴⁶ Food → Cooking & Recipes ³⁹⁸⁹	dim sum ⁸⁷ croquette ¹³⁶ cuisine ⁶⁶⁶ snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶
jongfood.nl	Jongfood	The Jongfood website showcases traditional soups and snacks, targeted towards professional kitchens.	Dishes → Soups ⁸⁷ Administrative Support → Family Businesses ⁶⁶⁴	cooks ¹¹ soup ¹⁰⁴³ snack ²⁹¹⁶ hospitality ³⁴⁹¹ family ⁶⁴⁶²	Gilze and Rijen → Rijen ⁴⁹³
kippenpakket.nl	Kippenpakket	Kippenpakket.nl is an online shop offering high-quality chicken feed, snacks, and supplements, focused on the health and well-being of chickens.	Poultry → Chicken ⁴⁹ Animals → Animal Welfare ¹³⁷²	feed ⁶⁷² supplement ¹⁹⁶⁸ wellbeing ²⁶²⁰ snack ²⁹¹⁶
food2smile.nl	Food2Smile	Food2Smile sells sugar-free candy and vegan snacks.	Healthy Food → Snacks ²²	candy ²⁰⁵ benefit ²⁴⁷ vegan ⁵⁰⁸ snack ²⁹¹⁶ recipe ⁵¹⁴² blog ¹³³⁹²
nightshopmaastricht.nl	Night Shop Maastricht	Night Shop Maastricht is an online shop that delivers various products, including drinks, snacks, drugstore items, animal food and electronics, to homes in Maastricht.	Pharmacies → Online Pharmacies ¹⁹²	drugstore ²¹ electronics ⁹⁷¹ online shop ¹³¹⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹ shop ⁶⁴⁸³	Limburg → Maastricht ⁶⁰⁰⁸
compliment.nl	Compliment.nl	The website Compliment.nl is an online wholesaler offering a wide range of products for cafeterias, cleaning, offices, and individuals. The site provides various categories, from beverages and snacks to food products and office supplies, with a focus on fast delivery and fixed prices.	Wholesale → Food Products ³⁰³ Coffee & Tea → Beverages ⁴⁴⁵³	office supplies ⁴³³ beverage ⁵⁸⁶ soup ¹⁰⁴³ snack ²⁹¹⁶
rundenkip.nl	Rund & Kip	Rund & Kip is an online supermarket specializing in daily meat products.	Fish & Seafood → Fish ³⁸⁸ Food → Meat ¹¹²³	meat package ³⁴ burger ¹⁴³¹ meat ²⁰⁵⁵ snack ²⁹¹⁶ recipe ⁵¹⁴²
frietboutique.nl	Frietboutique & IJsboutique	The website of Frietboutique and IJsboutique presents a variety of snacks, including fresh fries, tasty snacks, and ice cream, and offers locations in Rotterdam and Amsterdam.	Quick Bites → Cafeteria ⁹⁰⁶ Chocolate & Sweets → Ice Cream ⁷⁷⁴	founder ⁵² ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Rotterdam → Center ³⁸²
hayesbrothers.nl	Hayes Brothers	The website offers a wide selection of dog and cat food, including kibble, sausages, and snacks, catering to different ages and needs.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ age ²⁵⁶ sausage ²⁵⁶ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷²
d-drinks.nl	D-drinks	The website of D-drinks is an online platform providing information about the company, its products, and services, and offering an ordering option for natural, non-alcoholic drinks and snacks.	Nutrition → Superfoods ⁴¹ Freight & Logistics → Courier Services ⁸³⁹	distribution network ¹⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ brand ¹⁷⁷³⁷ sustainability ¹⁸⁴⁵¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
onlinepakhuis.nl	OnlinePakhuis	The OnlinePakhuis is an online shopping center offering a variety of products and services across several categories.	Dogs → Supplies ¹⁰⁰⁵	foam rubber ¹⁸ palette ³⁹ toy ²²⁹⁵ snack ²⁹¹⁶ furniture ⁸⁷⁵¹ blog ¹³³⁹²	North-Brabant → Breda ⁹⁰⁰³
restaurantmetro.nl	Metro City Kitchen	Metro City Kitchen is a restaurant in Utrecht offering breakfast, lunch, dinner, and snacks for an evening drink in a stylish setting, with a video available for events.	Cafes → Beer Cafes ²⁰⁹ Community & Social → Pub Quizzes ¹⁹⁵	pub quiz ¹¹⁷ breakfast ¹⁸²² snack ²⁹¹⁶ video ⁶⁷¹⁴ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Netherlands → Utrecht ⁴⁸⁹⁰¹
newwavecatering.nl	New Wave Catering	The website of New Wave Catering presents a sustainable catering company offering catering services for both businesses and events.	Events & Hospitality → Corporate Catering ²⁶⁷	corporate catering ³⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ sustainability ¹⁸⁴⁵¹ event ⁴⁵¹⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
huisdieren.nl	Huisdieren.nl	The website Huisdieren.nl is an online shop and magazine dedicated to all necessities for pets, including food, toys, accessories, and information.	Fashion → Accessories ⁵⁶³⁷ Animals → Dogs ⁵⁸⁷⁹	leashes ⁴⁰ collar ²⁴² bed ¹³⁸⁴ snack ²⁹¹⁶ food ³⁸⁷²
koemanssnacks.nl	Koemans Snacks and Sandwiches	The website of Koemans Snacks and Sandwiches presents a range of snacks, sandwiches, and hamburgers, with special attention to vegetarian and gluten-free options, and offers the possibility to order online and pick up in store.	Cafes & Lunch → Lunch ⁵⁹¹	panini ¹⁵⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
bestbuddy-pets.nl	BestBuddy Pets	BestBuddy Pets is a website that sells tasty, natural snacks for dogs and cats.	Pet Food → Dog Food ³²¹	natural ²³⁵ cat ¹⁵⁷⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³
haguehash.nl	The Hague Hash House Harriers	The Hague Hash House Harriers is a running club that organizes regular runs, often accompanied by beer and snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Outdoor Activity → Running ¹⁸²⁹	hare ¹⁶ run ⁸⁰⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶	Haarlemmermeer → Zwanenburg ²⁹⁵
bakkerijvanheeswijk.nl	Bakkerij van Heeswijk	The website of Bakkerij van Heeswijk showcases their bread and baked goods assortment, opening hours, job vacancies, business ordering options, and a fan club.	Bakery & Food Production → Bread ⁷⁶⁵	baked goods ¹⁴⁸ waffle ²¹⁸ bread ¹⁶²² snack ²⁹¹⁶	Eindhoven → Strijp ⁵²⁷
drankkoning.nl	DrankKoning	DrankKoning.nl is a webshop selling drinking games, drink gadgets, bar tools and accessories.	Games → Drinking Games ¹³	drinking game ²² beverage ⁵⁸⁶ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
jimmiesleiden.nl	Jimmie’s Catering	Jimmie’s Catering is a catering service specializing in business events and receptions in Leiden and the surrounding area.	Quick Bites → Food Trucks ⁶²³ Parties → Themed Parties ⁵⁸³	reception ²⁹¹ foodtruck ⁶¹³ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	South-Holland → Leiden ⁷⁰⁸⁹
homeko.nl	Homeko	The website of Homeko presents the company as a long-standing supplier of meat, meat products, snacks and ready-to-eat meal components, with a focus on customized solutions for customers.	Plastics → Manufacturing ⁷⁷⁰⁸ Meat → Meat Products ²¹¹	meat products ²⁷² meat ²⁰⁵⁵ snack ²⁹¹⁶ production ⁴⁵⁸² brand ¹⁷⁷³⁷
robbyssnacks.nl	Robby's Snacks	The website of Robby's Snacks presents a cafeteria in Raalte that offers a variety of snacks, sandwiches and salads, as well as ice cream, and describes the history and the focus on customer satisfaction.	Quick Bites → Cafeteria ⁹⁰⁶ Food → Foodservice & Catering ⁵⁷⁷	ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ sandwich ⁴⁰⁹⁸	Overijssel → Raalte ¹⁷⁷¹
gelukkigedieren.nl	Gelukkige dieren	Gelukkige dieren is a new webshop that sells pet toys, accessories, and snacks to make pets happy.	E-Commerce → Pet Supplies ¹⁰¹³	pet ¹⁶¹⁷ box ¹⁹⁸² toy ²²⁹⁵ snack ²⁹¹⁶
dogmeat.nl	Dogmeat BV	Dogmeat BV is an online store selling food and supplies for dogs, cats, and other animals, utilizing the PrestaShop platform.	Pet Food → Dog Food ³²¹	kibble ⁴⁶ supplement ¹⁹⁶⁸ animal ²⁹⁰⁸ snack ²⁹¹⁶ food ³⁸⁷²
bakkerbas.nl	Bakker Bas	Bakker Bas’ webshop offers a selection of bakery products and snacks to customers.	Bakery & Food Production → Bread ⁷⁶⁵ Pastry → Cakes ⁸²⁶	bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸	South-Holland → Gorinchem ¹⁹⁴⁷
uniekcatering.nl	Uniek Catering	The website of Uniek Catering presents catering services for various occasions, including corporate lunches, family lunches and parties, with a focus on sandwiches, meals, snacks and buffets.	Social & Events → Party Services ¹⁸⁷	meal service ⁶⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
perron3-reeshof.nl	Vers Friethuys	Vers Friethuys is a fast-food restaurant and online store located in Tilburg, Netherlands, offering delicious fries and other artisanal products, with an emphasis on fresh ingredients and a family-run atmosphere.	Turkish Cuisine → Fast Food ³²²² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
snackbartebritten.nl	Snackbar te Britten	The website of Snackbar te Britten is an online platform for ordering snacks, dishes, kapsalons (a type of Dutch snack), and sandwiches, with the option for delivery in Katwijk aan Zee.	Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Katwijk → Katwijk aan Zee ⁶¹⁶
nerus.nl	Nerus	Nerus is a specialist in private label pet food and snacks, with nearly 30 years of experience.	Engineering → Product Development ⁵⁴³ Animals → Pet Food ⁵⁸⁴	pet food ¹¹⁰ private label ¹⁸⁴ packaging ²²³⁶ snack ²⁹¹⁶
cafetaria-langweer.nl	Cafetaria-IJssalon 't Hoekje	Cafetaria-IJssalon 't Hoekje is a cafeteria and ice cream parlor located in Langweer, offering a variety of meals, snacks, and ice cream, with special options for dietary restrictions and vegetarians/vegans. The website provides information about opening hours, delivery and special menu options.	Quick Bites → Cafeteria ⁹⁰⁶ Chocolate & Sweets → Ice Cream ⁷⁷⁴	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	De Fryske Marren → Langweer ⁹³
defrituurhal.nl	De Frituurhal	De Frituurhal is a fast food restaurant in Eindhoven that has been operating since 1977 and is closed from July 21st to August 5th due to vacation.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ restaurant ¹¹²¹⁵	North-Brabant → Eindhoven ¹¹⁸⁴⁵
samsplace.nl	Sam's Place	Sam’s Place Snackbar in Heerhugowaard offers a diverse range of food, snacks, and fries, with options for ordering and pickup.	Quick Bites → Snack Bar ⁵⁸⁰ Fine Dining & Gastronomy → Fixed Restaurants ¹⁴	hour ³⁶⁵ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
buulke.nl	Cafetaria 't Buulke	The website of Cafetaria 't Buulke presents the menu of the family restaurant and cafeteria, with the option to order online and takeaway various dishes.	Outdoor → Terraces ¹⁸⁸ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ terrace ⁴⁸⁴⁷	Cranendonck → Budel ³⁸⁵
harryssnackcounter.nl	Harry’s Snackcounter	The website of Harry’s Snackcounter presents the menu, location and opening hours of a snack stall in Eibergen that has been operating for 28 years and is known for fresh fries and snacks.	Fast Food → Burger Restaurants ³⁴⁶	schnitzel ⁶¹ instagram ¹²¹⁶ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Berkelland → Eibergen ⁴¹¹
classiquesnacks.nl	Classique Snacks	The website of Classique Snacks showcases its range of snacks, catering services, and contact information for the snack bar located on the Fred in The Hague.	Quick Bites → Snack Bar ⁵⁸⁰ Travel → Tourism ³⁷⁵⁴	virtual tour ²²⁰ instagram ¹²¹⁶ promotion ²⁰⁶² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
furry-friends.nl	Hademax	Furry Friends is a pet specialty store and online shop located in Medemblik, selling animal supplies, food, and fishing equipment.	E-Commerce → Pet Supplies ¹⁰¹³ Animals → Pet Stores ⁴⁷⁸	animal food ¹⁵ animal supplies ²¹ fishing equipment ³⁰ meat ²⁰⁵⁵ snack ²⁹¹⁶ brand ¹⁷⁷³⁷	North-Holland → Medemblik ¹⁵³⁵
jannyscafetaria.nl	Jannys Cafetaria	Janny’s Cafetaria is a café and snack bar in Linne offering fries and other meals. Visitors can view the menu and order online for delivery.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	café ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Maasgouw → Linne ¹⁰¹
eterijdering.nl	Eterij de Ring	Eterij De Ring is a restaurant located in Ouddorp, offering traditional, fresh fries and snacks, with vegetarian and gluten-free options available.	Quick Bites → Cafeteria ⁹⁰⁶	saté ³⁷ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Goeree-Overflakkee → Ouddorp ⁴³⁸
tikitakatoko.nl	Tiki Taka Toko	Tiki Taka Toko is an Indonesian caterer based in Almere that offers catering, takeaway, and delivery services, focusing on Indonesian dishes and snacks.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	menus ²²¹ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ shop ⁶⁴⁸³	Amsterdam → Weesp ¹⁰⁰⁵
elsmoss.nl	Elsmoss Oldenzaal	Elsmoss is a cafeteria in Oldenzaal that accepts orders both on-site and online.	Quick Bites → Cafeteria ⁹⁰⁶ Events → Places ¹²¹⁹	milkshake ¹⁹⁵ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ beer ²⁸⁸⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	Overijssel → Hengelo ³⁴⁹⁹
deworstgroothandel.nl	De Worstgroothandel	De Worstgroothandel is a B2B website that acts as an importer and wholesaler of various types of sausage, including French, Spanish, and Italian dried sausage.	Dairy & Cheese → Delicatessens ⁶¹⁷ Meat → Sausage ³⁰	salami ¹⁰ deli ¹¹ ham ⁴⁰ sausage ²⁵⁶ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹
pandfriet.nl	PAND Friet	The website of PAND Friet presents a snack bar in Schalkwijk, Netherlands, offering freshly fried fries, snacks, and sandwiches, and accepting online and telephone orders.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	potato ⁵⁴² sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Haarlem → Schalkwijk ²¹⁴
stanleysemmeloord.nl	Stanley's Emmeloord	Stanley's For Burgers and More is an American Dining & lunchroom located in Emmeloord that offers hamburgers and other dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Grilling & Steaks → American ⁸⁵	lunchroom ³¹² hamburger ³⁶⁴ takeaway ⁶⁵³ burger ¹⁴³¹ snack ²⁹¹⁶	Noordoostpolder → Emmeloord ¹⁶⁴⁹
cafetaria-tparkhuys.nl	Cafetaria ‘t Parkhuys”	The website of Cafetaria ‘t Parkhuys presents the range and opening hours of a cafe located in Utrecht, where customers can order and pick up fresh fries, snacks, grill burgers, and sandwiches.	Fast Food → Fries ⁹⁴⁹ Commerce → Shopping Centers ¹⁰⁰¹	oil ⁹⁷⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Southwest ²⁴⁷
toonseten.nl	Toon's Eten	Toon's Eten is a snack bar specializing in homemade, organic and vegetarian snacks, including a special type of fries called Nature's Goodness.	Quick Bites → Snack Bar ⁵⁸⁰ Cuisine → Vegetarian ⁶⁹⁷	croquettes ¹⁰⁸ vegetarian ³³⁷ organic ⁴⁷¹ fries ²⁷⁵³ snack ²⁹¹⁶
frietuitmade.nl	Shirley’s Friture	The website of Shirley’s Friture offers the rental of a mobile chip cart and chip wagon on location to individuals, companies, and organizations for various events.	Fast Food → Fries ⁹⁴⁹ Hospitality → Suppliers ¹⁰⁵⁷	snack ²⁹¹⁶ app ⁴⁵⁹⁵ event ⁴⁵¹⁹⁹
vandenbroekbrunssum.nl	Van den Broek \| Het Smulhuis	The website of 't Smulhuis/ van den Broek showcases the cafeteria, restaurant, and catering services of the company, as well as news and the ability to order online.	Quick Bites → Cafeteria ⁹⁰⁶ Bars & Pubs → Casual Dining ²¹⁷	buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ news ¹⁵²⁹³
blazee.nl	Blazee	Blazee is a affordable snack terrace on the boulevard of Bloemendaal aan Zee offering fresh, responsible, and high-quality products with fast and cheerful service.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ sustainability ¹⁸⁴⁵¹	Bloemendaal → Overveen ⁴¹⁴
tresjolicatering.nl	Très Joli Catering	The Très Joli Catering website offers complete catering services for various parties and events, ranging from small snacks to comprehensive corporate catering and children's parties.	Cooking & Recipes → Culinary ³³⁸	corporate catering ³⁰ guest ¹³³⁴ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶
trefpunt-didam.nl	Cafetaria Trefpunt Didam	The website of Cafetaria Trefpunt Didam presents the menu, opening hours, and information about the cafeteria, which has been a well-known place in Didam and the surrounding area for years.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶	Montferland → Didam ⁷⁵⁹
bakkerijmans.nl	Bakkerij Mans	Bakkerij Mans is an online bakery offering a variety of bread, waffles, cakes, and snacks for sale.	Pastry → Waffles ¹⁷	waffle ²¹⁸ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸
eetsalonanderz.nl	Eetsalon Anderz	Eetsalon Anderz is a cafeteria offering snacks, ice cream, and complete meals in a cozy atmosphere, with a focus on sustainability.	Quick Bites → Cafeteria ⁹⁰⁶ Foodservice & Catering → Canteens ¹¹	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ snack ²⁹¹⁶ sustainability ¹⁸⁴⁵¹
defrietzaakkampen.nl	The Frietzaak Kampen	The Frietzaak Kampen is a fast-food restaurant in Kampen specializing in fresh fries and traditional snacks.	Fast Food → Fries ⁹⁴⁹	potato ⁵⁴² burger ¹⁴³¹ bag ²³⁹⁹ fries ²⁷⁵³ snack ²⁹¹⁶	Overijssel → Kampen ²¹⁶¹
parola61.nl	Parola 61	The website Parola 61 is an online shop selling various dishes, including pizzas, sandwiches, and snacks. The company offers both takeaway and delivery services.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Online & Digital → Online Shops ²⁹	kapsalon ⁵⁰⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Flevoland → Zeewolde ¹²⁴³
happyroosendaal.nl	Happy Grill Roosendaal	The Happy Grill Roosendaal website allows customers to order food online, including Italian pizzas, Turkish meat dishes, and snacks. It is a well-established restaurant in Roosendaal known for its quality and fast service.	Fast Food → Grill Restaurant ¹²⁹ International → Turkish ⁴¹⁶	kapsalon ⁵⁰⁹ grill ⁵⁶² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Roosendaal ²⁶⁷⁷
eetcounter2000.nl	Eetcounter2000	Eetcounter2000 is a snack bar located in Bellingwolde offering sandwiches, snacks and soft ice cream.	Quick Bites → Snack Bar ⁵⁸⁰ Ice Cream → Ice Cream Parlors ⁵²¹	soft ice cream ¹⁶ milkshake ¹⁹⁵ snack ²⁹¹⁶ opening hours ²⁹⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Westerwolde → Bellingwolde ⁹⁷
jordysplaza.nl	Jordy's Plaza Eindhoven	Jordy's Plaza Eindhoven is a cafeteria and lunchroom offering a wide variety of snacks, sandwiches, and fries.	Quick Bites → Cafeteria ⁹⁰⁶	cafeteria ¹⁶⁹ lunchroom ³¹² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²	North-Brabant → Eindhoven ¹¹⁸⁴⁵
koningsnack.nl	Koning Snack	The Koning Snack website offers a platform for colleagues and friends to easily order snacks during breaks, integrating with platforms like Telegram and Workspace365.	Business Software → Planning Software ²³ Applications → Business Applications ¹¹⁰	margin ⁴¹ dashboard ¹³⁷⁴ integration ¹⁴⁵¹ snack ²⁹¹⁶ account ⁵⁷⁸¹ order ⁶⁹¹²
leidschetaptocht.nl	Leidsche Taptocht	The Leidse Taptocht is a guided beer walking tour through Leiden, taking participants to six cafes and offering a selection of specialty beers and snacks.	Beverages → Beer ¹⁰⁹⁵ Events → Walking Tours ¹⁶⁶	walking tour ⁹² cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶	South-Holland → Leiden ⁷⁰⁸⁹
mannekebunt.nl	Manneke Bunt	Manneke Bunt is a snack bar in Amersfoort that offers sandwiches, meals, and snacks with a focus on quality and hospitality.	Quick Bites → Snack Bar ⁵⁸⁰ Food → Direction ⁴⁹	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ atmosphere ⁵⁵⁹¹	Utrecht → Amersfoort ⁸⁰¹¹
mycandystore.nl	MY Candy Store	The website, ‘MY Candy Store’, is an online shop that sells a wide assortment of candy, snacks, and beverages, including international treats.	Sweets → Candy ⁷⁷	candy ²⁰⁵ mix ³⁷⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹
kirpa.nl	Kirpa International	Kirpa International is a Dutch supplier of confectionery, beverages, and snacks, focused on wholesale.	Wholesale → Food Products ³⁰³	confectionery ⁴¹ pallet ⁵⁵³ beverage ⁵⁸⁶ snack ²⁹¹⁶
kellys-expat-shopping.nl	Kellys Expat Shopping	Kellys Expat Shopping is an online supermarket offering British and American groceries with locations in Amsterdam, The Hague, and Wassenaar.	Supermarkets & Grocery → Online Supermarkets ⁵³	baking ¹¹⁹ groceries ³⁵⁸ snack ²⁹¹⁶ store ³⁹⁰¹ drink ⁵¹⁹¹ brand ¹⁷⁷³⁷	South-Holland → Wassenaar ¹³⁷²
healthyvega.nl	Healthy Vega	Healthy Vega is a website offering recipes, ebooks, tips and basic vegan products, focused on healthy and tasty vegan food, including snacks.	Physical Fitness & Exercise → Veganism ⁶³	veganism ⁸⁵ e-book ¹⁰⁶⁰ snack ²⁹¹⁶ recipe ⁵¹⁴²	North-Holland → Amsterdam ⁴¹²⁵³
jamin.nl	Jamin	The website of Jamin is an online store where customers can order candy, chocolate, snacks, and gifts.	Chocolate & Sweets → Confectionery ¹¹⁹ Chocolate & Sweets → Ice Cream ⁷⁷⁴	candy ²⁰⁵ online store ⁹⁰⁵ chocolate ⁹¹¹ snack ²⁹¹⁶ gift ⁶⁴⁴²
cafedegeneraal.nl	Café De Generaal	Café De Generaal Boxmeer is a café in Boxmeer catering to adults who enjoy drinks, snacks, and dancing, particularly on Friday and Saturday evenings.	Entertainment → Leisure Activities ³³⁸ Bars & Pubs → Bars ¹⁹³⁸	dance floor ¹¹⁴ café ⁹⁴⁴ instagram ¹²¹⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Land van Cuijk → Boxmeer ⁸⁶¹
eetgoedvoeljegoed.nl	Eet Goed Voel Je Goed	Eet Goed Voel Je Goed is a website that provides healthy recipes and health tips to promote a happier and healthier life.	Cuisine → Vegetarian ⁶⁹⁷ Cooking & Recipes → Healthy Cooking ⁴²	blog posts ²⁸⁸ snack ²⁹¹⁶ recipe ⁵¹⁴² health ⁶³⁶⁶
geusdiervoeding.nl	Geusdiervoeding	Geusdiervoeding.nl is an online store that offers a wide range of pet food, snacks, and accessories for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	snack ²⁹¹⁶ reviews ³¹⁷² food ³⁸⁷² accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
snackbarhennieris.nl	Snackbar Hennie Ris	Snackbar Hennie Ris in Heerenveen offers online ordering with delivery and a loyalty points program.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Friesland → Heerenveen ²⁵⁷⁸
hond.nl	Hond.nl	Hond.nl is a website that provides information and products for dogs.	Animal Care → Dog Care ¹³⁹⁸ Animals → Pet Stores ⁴⁷⁸	blanket ⁴⁹⁵ bed ¹³⁸⁴ snack ²⁹¹⁶ dog ⁵⁴⁸³ training ²⁸¹³³
sophieglutenvrij.nl	Sophie Glutenvrij	The website offers a collection of gluten-free summer recipes focused on easy and quick preparation.	Vegan & Vegetarian → Vegan ³⁹⁰ Nutrition → Diets ⁹⁵¹	gluten-free ¹⁵⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶ webshop ⁸⁶⁴⁸
ursie.nl	Ursie	The website Newest Recipes presents a collection of recipes for breakfast, lunch, main courses, and snacks.	Food → Cooking & Recipes ³⁹⁸⁹	casserole ¹² pasta ¹³⁸⁹ breakfast ¹⁸²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ recipe ⁵¹⁴²
sihamdaily.nl	Siham Daily	Siham Daily offers a website with recipes and food photography.	Commercial Work → Food Photography ⁶⁷ Hobbies → Baking ³²⁹	food photography ³⁵ snack ²⁹¹⁶ recipe ⁵¹⁴² portfolio ⁶⁸⁵⁴
krux.nl	KRUX	The KRUX website is a bar and brewery in Amsterdam that organizes drinks and beer events, and offers snacks.	Beer → Breweries ³³⁷	cocktail ⁹²⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
carnis.nl	Carnis	The website of Carnis offers natural food and care products for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	coat ⁴⁶⁰ cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
indewildeman.nl	In De Wildeman	Bierproeflokaal In De Wildeman is a café in Amsterdam specializing in serving a wide selection of beers, both on tap and in bottles, and offering a unique atmosphere in a historic building.	Cafes → Beer Cafes ²⁰⁹ Beverages → Beer ¹⁰⁹⁵	distillery ¹¹² tap ¹³⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
kwekkeboom.nl	Kwekkeboom	The website of Kwekkeboom presents a range of traditionally prepared oven and air fryer snacks, including bitterballs, croquettes and other appetizers, and provides information about sales points and tips for using the appliances.	Frying Appliances → Air Fryers ¹⁶ Kitchen Appliances → Ovens ¹⁰	bitterballs ⁴¹ airfryer ⁷⁴ croquettes ¹⁰⁸ oven ³²⁴ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹
tomscafetaria.nl	Tom's Cafetaria Leeuwarden	The website of Tom's Cafetaria Leeuwarden offers an online ordering system for snacks, burgers, and other dishes, with options for home delivery and point accumulation.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Food Businesses ⁵⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
konino.nl	Konino	Konino is an online store specializing in products for rabbits and cavies, offering these for sale online with shipping and pick-up options.	Pets → Rabbits ⁸⁹ Animals → Pet Stores ⁴⁷⁸	toy ²²⁹⁵ snack ²⁹¹⁶ housing ⁴³⁷⁸ ship ⁵¹⁰³	Netherlands → Groningen ²³⁷³⁴
deuylvanhoogland.nl	Café De Uyl van Hoogland	The website aims to present Café De Uyl van Hoogland, a well-known pub in the historic center of Leiden, providing information about its location, opening hours, and offered products.	Quick Bites → Snack Bar ⁵⁸⁰ Travel → Historical Places ¹⁶	cafe ¹⁶²² snack ²⁹¹⁶ church ³⁴³⁹ terrace ⁴⁸⁴⁷	South-Holland → Leiden ⁷⁰⁸⁹
reitz.nl	Reitz	Reitz is a fast-food restaurant in Maastricht that offers traditional fries and sauces, also during the holidays.	Fast Food → Fries ⁹⁴⁹ Context ¹⁶¹³⁹⁴	tradition ⁷³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Maastricht ⁶⁰⁰⁸
dekofferbakker.nl	De Kofferbakker	The website of De Kofferbakker is a mobile catering business that primarily offers coffee, sweets, and savory snacks, particularly for parties and events. The website provides information about the business, contact options and a brief description of the services.	Sandwiches & Salads → Snacks ⁶⁹³	pancakes ⁵⁶⁸ snack ²⁹¹⁶ coffee ³⁸³⁸ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Midden-Drenthe → Hoogersmilde ⁷⁰
extremewatersport.nl	Extremewatersport	The Extremewatersport website provides information and the option to book tickets for various watersports activities, including flyboarding, jet skiing, and boat tours, with a focus on a fun and memorable experience.	Water Activity → Water Sports ²⁹⁴⁴	boat tour ⁹⁴ snack ²⁹¹⁶
ugala3.nl	Cafetaria Ugala 3	The website of Cafetaria Ugala 3 in Nijmegen allows customers to order online for pickup or delivery. It also provides information on opening hours, promotions, and general terms and conditions.	Quick Bites → Cafeteria ⁹⁰⁶ Websites → Ordering Sites ⁷⁵	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
muffinsbakken.nl	Muffins Bakken	The website muffinsbakken.nl offers a blog with various muffin recipes and links to other websites featuring culinary experiences and interesting topics.	Blogs → Food Blogs ²⁴⁶ Cooking & Recipes → Cooking Blogs ¹⁰	muffin ²² bbq ⁹⁰⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ coffee ³⁸³⁸ recipe ⁵¹⁴²	Loon op Zand → Kaatsheuvel ⁶⁸⁸
snoepdog.nl	Snoepdog	The website Snoepdog.nl offers a wide range of 100% natural dog snacks, chew treats, and training supplements, aimed at providing happy and healthy food for dogs.	Animals → Dogs ⁵⁸⁷⁹	dog snacks ³⁵ meat ²⁰⁵⁵ snack ²⁹¹⁶ package ⁶¹¹²
teaguys.nl	Tea Guys Amsterdam	The Tea Guys Amsterdam website is an online platform where customers can place orders for pickup at the store in De Pijp, Amsterdam. It offers a menu with various tea drinks and snacks, and a loyalty program for earning points with each purchase.	Beverages → Tea ⁸²⁹ Family → Gifts ²⁵⁷⁰	points ⁶¹² tea ¹¹⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶
dutchpetfood.nl	Dutch Petfood	The website of Dutch Petfood is a wholesaler specializing in natural pet food and related non-food products for professionals in the pet industry.	E-Commerce → Pet Supplies ¹⁰¹³ Animals → Pet Food ⁵⁸⁴	pet food ¹¹⁰ private label ¹⁸⁴ wholesaler ²²⁵ supplement ¹⁹⁶⁸ packaging ²²³⁶ snack ²⁹¹⁶
snackwagenmaasbree.nl	Fûske	The website of Snackwagen Maasbree provides information about renting a snack truck and presents the offerings of fries and snacks.	Quick Bites → Cafeteria ⁹⁰⁶	snack truck ³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Peel and Maas → Maasbree ²⁴⁸
iterijbydemune.nl	Snackbar & Lunchroom Iterij by de Mûne	The website of Snackbar & Lunchroom Iterij by de Mûne in Anjum describes a combination of a pick-up point for snacks and fish, a lunchroom and a restaurant, and offers various dishes, snacks, sandwiches and catering services.	Cafes & Lunch → Lunchroom ⁴⁴⁶	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ coffee ³⁸³⁸ terrace ⁴⁸⁴⁷ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵	Northeast-Friesland → Eanjum ⁶⁶
hollandshopper.nl	Hollandshopper	Hollandshopper is an online store offering a wide assortment of food, beverages, snacks, cookies, and other products, catering to both daily breakfasts and dinners as well as baking ingredients and mixes.	Hobbies → Baking ³²⁹	baking mixes ⁴¹ cookie ⁶⁰² ingredients ²³⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹
fungifactory.nl	Fungi Factory	Fungi Factory cultivates mushrooms on waste streams with the goal of promoting a sustainable future.	Environment → Waste Management ²⁶⁸⁰ Essential → Food ⁴⁷⁹⁹⁹	coffee grounds ¹⁸ grow kit ³² fungus ⁷² mushroom ²²³ snack ²⁹¹⁶ workshop ¹⁹³²⁵	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariakoning.nl	Cafetaria Koning	Cafetaria Koning is a family-run snack bar in Groningen offering snacks and salads.	Quick Bites → Snack Bar ⁵⁸⁰	address ⁹⁰¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³	Netherlands → Groningen ²³⁷³⁴
wijnbarvinvin.nl	VinVin	The website of Wijnbar VinVin Utrecht presents the wine bar, its location, opening hours and its wine and snack offerings, as well as information on wine courses and tastings.	Wine → Wine Tasting ⁷³⁰ Bars → Wine Bars ¹⁷⁰	wine course ⁵⁵ wine bar ¹²⁸ tastings ¹⁵⁸ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
degezondetoer.nl	University of Utrecht	The website describes a University of Utrecht research project aimed at promoting healthier eating habits by offering healthy snacks.	Universities → Utrecht University ⁹⁵ Catering & Ready Meals → Indonesian Restaurant ³⁹²	snack ²⁹¹⁶ app ⁴⁵⁹⁵ research ⁸⁹⁶⁷	City Center → City Center & Shopping Area ²³¹
cafeanneke.nl	Café Anneke	Café Anneke is a meeting place in Wijchen where visitors can drink, eat lunch, chat, and celebrate.	Fast Food → Fries ⁹⁴⁹	lunch ¹⁵³⁴ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ atmosphere ⁵⁵⁹¹	Gelderland → Wijchen ¹⁵⁷⁹
defretpot.nl	The Fretpot	The Fretpot cafetaria in Hollum on Ameland offers a wide selection of snacks, sandwiches, and ice cream, with options for takeaway and delivery.	Quick Bites → Cafeteria ⁹⁰⁶ Nature & Outdoors → Outdoor Recreation ⁶⁰	ice cream ¹⁰⁰⁰ wifi ¹³⁷² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Ameland → Hollum ⁷⁸
snackbardebokkesprong.nl	Snackbar De Bokkesprong	The website of Snackbar De Bokkesprong presents the snack bar, its opening hours, menu, and appealing customer reviews, and informs visitors about the history of the snack bar.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	snack bar ¹⁶² bread ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸	North-Holland → Uithoorn ⁹⁴⁰
depitstopputten.nl	Pitstop Putten	Pitstop Putten is a cafeteria/lunchroom located near tankstation De Roos in Putten, offering lunch, takeaway, and delivery services.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	lunchroom ³¹² salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Putten ¹⁰⁶⁹
gezondlevendietisten.nl	Gezond Leven Diëtisten	Gezond Leven Diëtisten is a dietetics practice that guides clients in weight loss, both on-site in The Hague and online.	Nutrition → Dietetics ⁸¹⁶ Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷	carbohydrates ⁶⁶ dietetics ¹⁹⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ workshop ¹⁹³²⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
artikelbegin.nl	Amsterdam Wine Academy	This website provides tips and ideas for organizing hen parties for women.	Telecommunications → Mobile Services ¹⁵⁰ Women’s Issues → Women ¹⁸¹	bride ⁷⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹ party ⁵⁹²⁸	North-Holland → Amsterdam ⁴¹²⁵³
barkkingdogsnacks.nl	BarkKing Dog Snacks	BarkKing Dog Snacks is a webshop specializing in snacks and accessories for dogs and cats.	Dogs → Supplies ¹⁰⁰⁵	packaging ²²³⁶ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² gift ⁶⁴⁴²
bfreez.nl	Bfreez.nl	Bfreez.nl is a webshop specializing in gluten-free products, including bread, snacks, pastries, pasta, pizza, and ice cream.	Dairy & Cheese → Dairy ⁷⁶³ Supermarkets & Grocery → Online Supermarkets ⁵³	gluten-free ¹⁵⁶ pastries ⁹⁴⁶ bread ¹⁶²² market ²⁷⁷² snack ²⁹¹⁶ pizza ⁴¹⁵⁸
americanfoodcenter.nl	International Brands Distribution B.V.	American Foodcenter is a distributor of American and Asian soft drinks, snacks, and candy products.	Food & Beverage → Beverages ⁶⁴ Wholesale → Food Wholesalers ²⁴	candy ²⁰⁵ warehouse ¹⁰²⁷ snack ²⁹¹⁶ transport ⁶¹⁰⁵ order ⁶⁹¹²	Overijssel → Enschede ⁵⁵⁵⁴
cafecheckpointcharlie.nl	CPC	The CPC website is an entertainment venue in Amsterdam offering a combination of music, DJs, live performances, comedy, and quizzes.	Entertainment → Nightclubs ¹²¹ Performing Arts → Comedy ²¹⁴	comedy ⁸⁹ djs ¹⁹⁹ quiz ⁷¹⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹ music ¹³¹⁷⁰	Amsterdam → West ⁷⁷⁷
bakkergroffen.nl	Bakker Groffen	The website of Bakker Groffen in Bergen op Zoom offers the opportunity to order a variety of bakery products online, including Groffenkoeken and other treats.	Bakery & Food Production → Bread ⁷⁶⁵ Community & Social → Personal Events ¹⁸	children’s parties ⁹⁵ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Bergen op Zoom ²²⁷⁴
candyonline.nl	CandyOnline.nl	CandyOnline.nl is an online confectionery store offering a wide selection of sweets, biscuits, soft drinks, and other snacks, with the option of afterpay and delivery via PostNL. The store has been active for 17 years.	Chocolate & Sweets → Sweets ²⁵⁷ Gifts → Gift Cards ⁹⁸¹	sweets ²²⁹ category ²³¹⁶ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
menkenorlando.nl	Menken Orlando	Menken Orlando is a company that develops and supplies unique snacks, delicious ingredients, and high-quality enhancers, enriching the day with flavor.	Hospitality → Suppliers ¹⁰⁵⁷	ingredients ²³⁴⁶ idea ²³⁶⁷ snack ²⁹¹⁶ relationship ⁴²⁰⁵ sustainability ¹⁸⁴⁵¹
cafedebeurs.nl	Café de Beurs	Café de Beurs is a specialty beer café in Oosterhout offering a wide selection of beers and complementary snacks in a welcoming atmosphere.	Cafes → Beer Cafes ²⁰⁹ Community & Social → Pub Quizzes ¹⁹⁵	beer ²⁸⁸⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	North-Brabant → Oosterhout ²⁰⁸⁶
lowcarbcenter.nl	Lowcarbcenter.nl	The website Lowcarbcenter.nl offers a wide range of low-carb products with fast delivery and various categories.	Healthy & Dietary → Healthy Food ⁶³	bread ¹⁶²² meal ¹⁶³⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
murphysjazz.nl	Murphy's Law	The website of Murphy's Law in The Hague presents the menu, beer selection, and events of the café.	Cafes → Beer ⁵⁹ Theme Parks & Entertainment → Going Out ⁷¹	pub ¹⁸⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
danoontje.nl	Danoontje	The Danoontje website offers a daily yogurt portion for children, focusing on healthy and responsible growth.	Nutrition → Natural Foods ⁷¹ Healthy & Dietary → Children’s Food ¹⁰	calcium ²³ vitamin d ³⁸ yogurt ⁶³ plant-based ⁸⁰ flavor ¹⁰³² snack ²⁹¹⁶
hetwalhalla.nl	Studievereniging Thor	The Walhalla is the faculty pub of the Electrical Engineering faculty at the Eindhoven Technical University.	Culinary & Tastings → Tastings ¹²⁷	snack ²⁹¹⁶ drink ⁵¹⁹¹	Eindhoven → Center ¹⁰⁸
wapenvanilpendam.nl	Wapen van Ilpendam	The Wapen van Ilpendam is a café offering a variety of meals and drinks.	Quick Bites → Cafeteria ⁹⁰⁶ Activities → Dining Out ¹⁸¹	café ⁹⁴⁴ meal ¹⁶³⁸ snack ²⁹¹⁶ reservation ³³⁷³ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Waterland → Ilpendam ⁷⁸
substitute.nl	Biercafé Substitute	Biercafé Substitute is a cozy beer café located in Ede offering a wide selection of beers, both local and international, in a relaxed and friendly atmosphere.	Hobbies → Whisky ²³⁵ Gifts & Souvenirs → Liquor Stores ²³³	whisky ³⁷³ beer ²⁸⁸⁷ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹ party ⁵⁹²⁸ webshop ⁸⁶⁴⁸	Gelderland → Ede ⁵¹⁰⁴
hondjekoek.nl	Hondjekoek	Hondjekoek.nl is an online shop specializing in natural food and supplies for dogs and cats.	Pet Supplies → Dog Supplies ¹¹² Pet Food → Dog Food ³²¹	supply ⁹⁶¹ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
vitakraft.nl	Vitakraft Benelux B.V.	The website of Vitakraft Nederland offers pet owners a wide range of snacks, food, and accessories for various pet species, with the goal of increasing the happiness of pets and their owners.	E-Commerce → Pet Supplies ¹⁰¹³ Sandwiches & Salads → Snacks ⁶⁹³	pet ¹⁶¹⁷ tips ²⁷⁸⁹ snack ²⁹¹⁶ food ³⁸⁷² event ⁴⁵¹⁹⁹	Gelderland → Arnhem ⁸⁶⁸⁰
pombar.nl	Intersnack	The website of POM-BÄR presents and sells vegetarian and gluten-free snacks, primarily bear chips, in various flavors and varieties.	Fast Food → Fries ⁹⁴⁹	snack ²⁹¹⁶
petitcafemoriaan.nl	Petit Café Moriaan	Petit Café Moriaan is a cafe-restaurant in Maastricht that offers a cozy atmosphere for enjoying drinks, food, and relaxation.	Brasseries & Bistros → Bistro ⁵⁹⁴ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	cafe ¹⁶²² snack ²⁹¹⁶ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵	Limburg → Maastricht ⁶⁰⁰⁸
persee.nl	Persee Deventer	Persee Deventer is a beer café in Deventer offering beers, snacks, and activities.	Games → Quizzes ³⁴⁴ Bars → Pubs ⁵⁴⁶	quiz ⁷¹⁰ game ²⁸⁰⁷ beer ²⁸⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹	Overijssel → Deventer ⁴⁷⁵¹
eetblog.nl	Eetblog.nl	Eetblog.nl offers tips and hacks focused on healthy and smart eating, with a particular emphasis on coffee brewing methods and nutritional values.	Financial Services → Advice ¹⁰⁰³ Coffee & Tea → Coffee ¹⁰⁶⁴	nutritional value ³⁴ protein ²⁹⁹ coffee beans ⁴⁵² snack ²⁹¹⁶ coffee ³⁸³⁸
meatandbones.nl	Natural Animal Food	The website Natural Animal Food offers healthy, grain-free food (dry, canned, and fresh meat) for dogs and cats, with a pickup location in Malden and possible shipping.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ assortment ⁷⁷⁹⁹	Heumen → Malden ³⁹¹
restaurantdapper.nl	Bistro Dapper	Bistro Dapper in Assen is a restaurant and bar offering an informal atmosphere and serving coffee, drinks, and dinner, with special attention to children.	Restaurants By Location → Restaurants in Drenthe ¹⁵	dinner ¹⁵³³ snack ²⁹¹⁶ reservation ³³⁷³ coffee ³⁸³⁸ pizza ⁴¹⁵⁸ atmosphere ⁵⁵⁹¹	Drenthe → Assen ³⁵¹⁶
fitnesscandy.nl	Fitness Candy Company	The Fitness Candy website is a webshop that offers a variety of healthy snacks, protein bars, supplements, and drinks, geared towards an active lifestyle and sports nutrition.	Nutrition → Sports Nutrition ²⁴⁶ Nutrition → Supplements ¹⁵⁵⁷	supplement ¹⁹⁶⁸ promotion ²⁰⁶² snack ²⁹¹⁶ drink ⁵¹⁹¹
dancing-party.nl	Organization	The website offers dance parties for adults (aged 30+) with music from various decades, including the 70s, 80s, 90s and current hits. The parties take place in various locations across the Netherlands.	Parties → Dance Parties ²³¹ Theme Parks & Entertainment → Going Out ⁷¹	dance party ³⁸ adults ⁶¹⁷ ticket ²⁷⁸⁵ snack ²⁹¹⁶ music ¹³¹⁷⁰	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
denoterij.nl	De Noterij	The website of De Noterij offers an online store where various types of nuts and snacks can be ordered.	Vegetables → Nuts ¹⁰⁴ Food → Gifts & Souvenirs ²⁴²¹	almond ¹¹ cracker ²⁵ yogurt ⁶³ nuts ⁴¹⁷ chocolate ⁹¹¹ snack ²⁹¹⁶	Southwest-Friesland → Bolsward ⁵⁶⁶
buitensportvoeding.nl	Buitensportvoeding.nl	Buitensportvoeding.nl is an online shop that supplies food and accessories for outdoor activities such as hiking, trail running, and expeditions.	Chronic Diseases → Diabetes ³⁴⁹	meal ¹⁶³⁸ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵
cafetariathielen.nl	Cafetaria Eethuis Thielen	The website of Cafetaria Thielen is an online platform where visitors can easily order snacks, fries, and meals. It’s the website of a cafeteria with a long tradition, existing for 75 years and a fixed part of the Venray community.	Quick Bites → Cafeteria ⁹⁰⁶	online order ⁷¹ cafeteria ¹⁶⁹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Limburg → Venray ¹⁶⁰¹
eland-snackbar.nl	Eland Snackbar Den Haag	The Eland Snackbar Den Haag website offers online ordering for Turkish dishes, such as pizzas, döner kebab, and fries, in the city of The Hague.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
westriksnack.nl	Westrik Snack	The Westrik Snack website offers a rental service for fry and snack trucks for various occasions, and provides information about the company, its products, and employment opportunities.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	truck ¹⁴¹² snack ²⁹¹⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
keetsmakelijk.nl	Keet Smakelijk	Keet Smakelijk is an online platform providing healthy recipes and children's cookbooks, with a humorous approach.	Fine Dining & Gastronomy → Gastronomy ⁵⁹⁹ Cooking & Recipes → Cooking Classes ²⁹²	cookbook ²⁶⁰ chef ⁶³¹ diploma ⁷⁹⁵ snack ²⁹¹⁶ recipe ⁵¹⁴²
beleef.nl	Beleef.nl	Beleef.nl is a website offering content around food, drinks, outdoor activities, and lifestyle, with a focus on affordable solutions and practical tips.	Reviews → Product Reviews ¹¹⁹	espresso ¹³¹ snack ²⁹¹⁶ machine ³⁷²⁷ coffee ³⁸³⁸ recipe ⁵¹⁴² dog ⁵⁴⁸³
gunshies.nl	Gunshies	The website Gunshies is a natural pet store offering a wide range of snacks, meat products, food, accessories, and supplies for dogs and cats.	Animals → Pet Stores ⁴⁷⁸ Pet Supplies → Pet Nutrition ¹⁸	bone ³⁵ meat ²⁰⁵⁵ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² care ¹²³³⁸
dogline.nl	Dogline	Dogline is an online store that sells premium dog food, snacks, and accessories.	Pet Supplies → Dog Supplies ¹¹² Pet Food → Dog Food ³²¹	snack ²⁹¹⁶ food ³⁸⁷² health ⁶³⁶⁶ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
be-doodle.nl	Be-Doodle	Be-Doodle is an online shop selling products for Doodles.	Pet Supplies → Dog Supplies ¹¹² Household & Cleaning → Household Goods ¹⁶⁴²	basket ²⁷⁵ puzzle ⁸¹¹ grooming ⁸⁹⁶ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
jetdrinks.nl	Jetdrinks	Jetdrinks is a wholesaler that offers sustainable and innovative beverages and snack products, primarily aimed at the hospitality industry.	Coffee → Coffee Beans ¹⁷⁸ Food & Beverage → Food Industry ⁸³⁵	syrups ³⁰ snack ²⁹¹⁶ hospitality ³⁴⁹¹ drink ⁵¹⁹¹
lifetimepetfood.nl	Lifetime Petfood	Lifetime Petfood is an online pet store offering food and accessories for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	feeder ⁵¹ collar ²⁴² toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² health ⁶³⁶⁶
fritssnacks.nl	Frits Snacks	The website of Snackbar Terschelling provides information about the snack bar, its menu, history, location, and opening hours, aiming to inform and welcome visitors.	Vacations → Island Vacations ²⁴³ Quick Bites → Snack Bar ⁵⁸⁰	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Terschelling → Formerum ⁴⁰
vitaria-eeterij-family-schiphol.nl	Family Schiphol	The Family Schiphol website offers the opportunity to order food online in Schiphol. It presents an extensive menu with various sandwiches, burgers, salads, and other snacks.	Fast Food → Fries Restaurants ⁸⁷	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Haarlemmermeer → Schiphol ²¹⁶³
roelievuitton.nl	Roelie Vuitton	The website Roelie Vuitton is a blog featuring travel and activity tips, aimed at inspiring people for vacations, events, and challenges.	Cooking & Recipes → Dishes ³³⁵	snack ²⁹¹⁶ travel ⁷²¹⁰ photography ⁹⁵⁰³ blog ¹³³⁹²	Netherlands → Groningen ²³⁷³⁴
antilliaanse-toko.nl	Antilliaanse Toko	Antilliaanse Toko Online Winkel is a webshop specializing in Caribbean products.	Household & Cleaning → Household Goods ¹⁶⁴²	cooking ⁸⁰¹ category ²³¹⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ brand ¹⁷⁷³⁷	Overijssel → Zwolle ⁷³⁹⁵
smaakverkenners.nl	Smaakverkenners	The Smaakverkenners website offers city tours that guide visitors through the most beautiful places, businesses, and flavors of a city, including an exclusive box with delicious snacks and drinks.	Tourism → City Tours ⁴⁶⁸	city ¹⁸⁷⁵ box ¹⁹⁸² tour ²³¹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	Gelderland → Zutphen ²⁶⁹⁰
weekvansnoepgoed.nl	Stichting Week van Snoep Goed	The website aims to encourage people to avoid unhealthy snacks and make healthier choices during the Week of Candy Good.	Societal Change → Social Movements ¹¹⁴ Nutrition → Healthy Eating ⁶³⁴	week ⁷⁹ candy ²⁰⁵ participant ¹⁹³⁴ magazine ²¹⁸² snack ²⁹¹⁶
cafeconstant.nl	Café Constant	Café Constant is a café in Amsterdam offering a diverse lunch and dinner menu with a variety of sandwiches, meat dishes, fish dishes, and appetizers.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	meat dishes ⁶⁶ appetizer ⁵⁵⁶ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
nicetomeatyou.nl	Nice To Meat You	Nice To Meat You is an online butcher offering fresh meat delivered directly to your door and a wide assortment of meat products, BBQ supplies, and recipes.	Dogs → Supplies ¹⁰⁰⁵ Food → Supermarkets & Grocery ³⁵⁶⁸	label ⁸¹⁹ bbq ⁹⁰⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ recipe ⁵¹⁴² assortment ⁷⁷⁹⁹
co-s.nl	Co’s Foodbar	The website of Co’s is a foodbar in ‘s-Hertogenbosch where visitors can enjoy a relaxed atmosphere together with friends and family, enjoying drinks, food, and music.	Bars → Foodbars ²² Conferences & Meetings → Meeting Places ¹⁹²	foodbar ²¹ snack ²⁹¹⁶ reservation ³³⁷³ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
animalfoodexpress.nl	Animal Food Express	Animal Food Express is an online shop specializing in raw and fresh pet food for dogs, cats, and ferrets.	Animals → Pet Food ⁵⁸⁴	barf ¹¹ pet food ¹¹⁰ ingredients ²³⁴⁶ snack ²⁹¹⁶
huisvanburgh.nl	Huis van Burgh	The website of Huis van Burgh describes a recreation center offering various sports and games, events, food and drink, and a childcare facility near the beach and nature areas.	Family Gatherings → Family Events ¹³⁴ Sport Facility → Sports Centers ⁴³⁹	minigolf ⁵⁸ padel ⁶⁰² tennis ⁸³⁶ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Schouwen-Duiveland → Burgh-Haamstede ⁴⁰¹
cafetariatcentrum.nl	Cafetaria 't Centrum	Cafetaria ’t Centrum is a café and lunchroom located in Arcen that serves fries, snacks, and meals and offers online ordering.	Fast Food → Fries ⁹⁴⁹ Food & Dining → Outdoor Seating ²²⁸	cafeteria ¹⁶⁹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ order ⁶⁹¹²	Venlo → Arcen ²³⁴
scholtesnoten-deli.nl	Scholtes Noten & Deli	Scholtes Noten & Deli is an online and physical store that sells nuts, natural foods, and chocolate.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	natural food ²⁴ nuts ⁴¹⁷ seed ⁵⁹⁹ chocolate ⁹¹¹ snack ²⁹¹⁶
slijterijdekruik.nl	Slijterij de Kruik	Slijterij de Kruik is a liquor store in Brunssum offering a wide range of beer, wine, spirits, and related products, including snacks and tap rental.	Gifts & Souvenirs → Liquor Stores ²³³	beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ gift ⁶⁴⁴²	Amsterdam → Center ⁹⁹⁰
hondenetengezond.nl	Hondeneten Gezond	The online shop ‘Hondeneten Gezond’ offers high-quality dog food, including KVV meals and kibble, and arranges shipping.	Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ dog food ²⁰⁴ snack ²⁹¹⁶ ship ⁵¹⁰³
thuysinschelluinen.nl	Thuys Eten & Drinken	The website of Thuys Eten & Drinken is an online platform that informs visitors about the restaurant, cafeteria, catering services, and delivery options in Schelluinen.	Sandwiches & Salads → Prepared Foods ³⁹	cafeteria ¹⁶⁹ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	Molenlanden → Schelluinen ⁵¹
brasseriedebuurman.nl	Brasserie De Buurman	Brasserie De Buurman is a brasserie in Poederoijen offering various services including coffee, lunch, high tea, snacks, and the organization of parties and events.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Performances & Entertainment → Celebrations ⁵⁶⁰	brasserie ⁷⁵² lunch ¹⁵³⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ party ⁵⁹²⁸ menu ¹³⁸⁵⁶	Zaltbommel → Poederoijen ⁵⁶
frietexpress.nl	Frietexpress	Frietexpress offers a service where mobile fry trucks are rented out on location.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
betere-diervoeding.nl	Betere Diervoeding	The website is an online store specializing in natural animal feed and related products.	Animals → Pet Food ⁵⁸⁴	feed ⁶⁷² supplement ¹⁹⁶⁸ snack ²⁹¹⁶ store ³⁹⁰¹ brand ¹⁷⁷³⁷
smulpets.nl	Smulpets	The website Smulpets offers an online shop for dog and cat food and related products.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ category ²³¹⁶ snack ²⁹¹⁶ food ³⁸⁷² shop ⁶⁴⁸³	Laarbeek → Beek and Donk ³⁷³
aluminet.nl	Aluminet	The Aluminet website is an online shop offering various types of shade cloths and accessories primarily for dogs, focusing on training and care.	Pet Supplies → Dog Supplies ¹¹² Garden → Garden Furniture ⁸⁶⁴	shade cloth ³³ leash ⁶⁹ snack ²⁹¹⁶	Bronckhorst → Baak ⁶⁷
k9snacks.nl	K9 Snacks	K9 Snacks is an online shop specializing in natural, dried dog treats and supplements.	Pet Supplies → Dog Supplies ¹¹²	supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ toy ²²⁹⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³
mickers-lunchroom.nl	Lunchroom Mickers 2.0	Lunchroom Mickers 2.0 is a lunchroom in Uden offering a variety of coffee, breakfast, lunch, and snacks, including Puro Fairtrade coffee, and providing options for online ordering and reservations.	Cafes & Lunch → Lunch ⁵⁹¹	salad ²⁴⁴⁴ snack ²⁹¹⁶ reservation ³³⁷³ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ atmosphere ⁵⁵⁹¹
dezoetezee.nl	Strandpaviljoen De Zoete Zee	Strandpaviljoen De Zoete Zee is a recreation pavilion located on the IJsselmeer, near EuroParcs IJsselmeer in Medemblik, offering visitors a relaxing day by the water with facilities for eating, drinking, and recreation.	Beach → Beach Pavilions ¹⁶² Outdoor → Recreation Areas ³⁸	pavilion ¹³⁰ recreation ⁷⁹⁹ walk ²¹⁶¹ snack ²⁹¹⁶ drink ⁵¹⁹¹	Medemblik → Andijk ²⁴²
proeflokaalgoesting.nl	Proeflokaal Goesting	Proeflokaal Goesting is a tasting room in Venray offering a wide selection of beers, wines, whiskeys, and gins, and providing guests with an experience.	Beverages → Beer ¹⁰⁹⁵ Bars & Pubs → Bars ¹⁹³⁸	whiskey ⁷⁸ gin ¹⁴¹ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	Limburg → Venray ¹⁶⁰¹
elite-neede.nl	Elite B.V.	The website of Elite BV introduces a range of artisanal snacks, salads, and sauces, aimed at hospitality businesses and food professionals.	Food & Beverage → Food Industry ⁸³⁵	artisanal ⁵⁶ sauce ¹¹⁴¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹	Berkelland → Neede ³⁰⁰
daawatrestaurant.nl	Daawat Restaurant	Daawat Restaurant is an Indian restaurant and takeaway located in Amstelveen that serves authentic Indian cuisine and offers catering services.	Turkish Cuisine → Takeout Restaurant ⁸¹ Food Delivery → Indian Cuisine ⁵⁴³	curry ³⁵⁵ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	North-Holland → Amstelveen ³¹⁸⁰
goood-petfood.nl	Goood Petfood	Goood Petfood is a website that offers natural, ethically produced dog food and accessories.	Gardening → Soil Improvement ¹²⁹ Pet Food → Dog Food ³²¹	dog food ²⁰⁴ ingredients ²³⁴⁶ snack ²⁹¹⁶ food ³⁸⁷² sustainability ¹⁸⁴⁵¹
siermarkt.nl	Siermarkt	The Siermarkt in Amsterdam-West is a diverse market that offers fresh products, clothing and various treats daily on Wednesdays, providing a cozy atmosphere.	Markets → Local Markets ¹⁵³	cheese ¹²⁰⁵ bread ¹⁶²² market ²⁷⁷² snack ²⁹¹⁶	Amsterdam → Nieuw-West ⁸⁴⁴
gembiraamstelveen.nl	Gembira Amstelveen	The website Gembira Amstelveen provides an online ordering service for Indonesian food and drinks in Amstelveen, offering various menu options and a rijsttafel option.	Food Delivery → Indonesian ⁵⁰² Mediterranean & Middle Eastern → Ethnic ³⁹⁴	rijsttafel ⁴⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Amstelveen ³¹⁸⁰
totaalcateringgorinchem.nl	Totaal Catering Gorinchem	The website of Totaal Catering Gorinchem showcases the catering services of the company, focused on the Gorinchem region and beyond, for various events.	Events & Hospitality → Corporate Catering ²⁶⁷	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → Gorinchem ¹⁹⁴⁷
lislovescooking.nl	Lislovescooking	The Lislovescooking website shares recipes, primarily focusing on gluten-free options, and distributes them through Instagram and Pinterest.	Social Media → Instagram ²² Healthy & Dietary → Healthy Food ⁶³	smoothie bowl ¹⁷ gluten-free ¹⁵⁶ instagram ¹²¹⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
filmweide.nl	Filmweide	The Filmweide is an open-air and drive-in cinema that organizes film evenings in the Achterhoek region.	Live Music → Cover Bands ⁴³³ Film → Film Festivals ¹³⁹	drive-in ¹⁹ cinema ²⁵³ evening ²⁸⁷ snack ²⁹¹⁶	Nijkerk → Achterhoek ¹⁷³⁰
deheerenhelvoirt.nl	Brasserie De Heeren	The website of Brasserie De Heeren showcases the location, opening hours, menus, and services of the brasserie, cafetaria, and d’n Trappist hall in Helvoirt.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Venues → Historic Venues ³³	brasserie ⁷⁵² hall ¹⁷⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Vught → Helvoirt ²⁴¹
eetit.nl	EETIT by Edith	The website of EETIT by Edith presents a catering company that offers various culinary services, including lunches, buffets, dinners, high teas, party food, and cooking workshops.	Cooking & Recipes → Cooking Classes ²⁹² Events & Hospitality → Corporate Catering ²⁶⁷	foodtruck ⁶¹³ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶ workshop ¹⁹³²⁵
macroy.nl	Mac Roy Nieuwegein	The website of Mac Roy Nieuwegein allows customers to order burgers, snacks, and drinks online for delivery or pickup.	Fast Food → Burger Restaurants ³⁴⁶ Ice Cream → Ice Cream Parlors ⁵²¹	ice cream ¹⁰⁰⁰ burger ¹⁴³¹ promotion ²⁰⁶² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
tnncatering.nl	T&N Catering	The website of T&N Catering presents a catering company specializing in the production and delivery of sandwiches, lunches, luxury snacks and salads in the Greater Rotterdam – Haaglanden region.	Hospitality → Suppliers ¹⁰⁵⁷ Events & Hospitality → Corporate Catering ²⁶⁷	lunch ¹⁵³⁴ customization ¹⁷²³ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Rotterdam → IJsselmonde ¹⁸⁴
kwispelenrelax.nl	Kwispel & Relax	Kwispel & Relax is an online store specializing in pet nutrition, supplements, and accessories for dogs and cats.	Pet Food → Dog Food ³²¹	supplement ¹⁹⁶⁸ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² gift ⁶⁴⁴² accessories ¹²⁹⁷⁵
natuurlijkvooruwhond.nl	Natuurlijk voor uw hond	The website, Natuurlijk voor uw hond, is an online store specializing in 100% natural dog and cat food.	Pet Supplies → Dog Supplies ¹¹² Pet Food → Dog Food ³²¹	cat food ⁹⁸ dog food ²⁰⁴ supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷²
bakkerijvandersteen.nl	Van der Steen, De Echte Bakker	The website of Van der Steen, De Echte Bakker presents its range of bread and baked goods, including special offers and an online store.	Bakery & Food Production → Bread ⁷⁶⁵ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	low-carb ¹⁸ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶
foodlink.nl	Foodlink	Foodlink develops and supplies specialty snacks and plant-based ingredients in bulk and portion packs.	Preserved Foods → Food Processing ¹⁴⁷ Supermarkets & Grocery → Food Distributors ¹⁵	food concept ¹² supply chain ⁴¹³ ingredients ²³⁴⁶ snack ²⁹¹⁶ sustainability ¹⁸⁴⁵¹
puntzakfriet.nl	Puntzakfriet B.V.	The website Puntzakfriet.nl offers the rental of mobile french fry wagons for various occasions, including parties, weddings and corporate events, with a focus on fresh fries and a wide range of snacks.	Fast Food → Fries ⁹⁴⁹ Food → Foodservice & Catering ⁵⁷⁷	fry wagon ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ package ⁶¹¹² event ⁴⁵¹⁹⁹
hollanddiervoeders.nl	Holland Diervoeders BV	The website of Holland Diervoeders BV presents various brands of dog, cat, bird, rodent, park animal and garden/outdoor animal food and snacks.	Pet Food → Dog Food ³²¹	animal species ²⁶ raw materials ⁴⁴⁶ composition ⁶³⁹ ingredients ²³⁴⁶ snack ²⁹¹⁶ food ³⁸⁷²	South-Holland → Dordrecht ⁴⁵³¹
vrieskoop.nl	Vrieskoop	Vrieskoop is a shop specializing in frozen products and offers a wide range of items for consumption and barbecues.	Food → Supermarkets & Grocery ³⁵⁶⁸	frozen products ¹⁶ barbecue ¹¹⁷⁵ vegetables ¹⁴¹⁶ meal ¹⁶³⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶
charlies.nl	Proeflokaal Charlies	Proeflokaal Charlies is a tasting room in Hoorn specializing in beers, wine, jenevers, whiskey and gins, and is also a venue for organizing parties and events.	Beverages → Beer ¹⁰⁹⁵ Personal Care & Services → Enjoyment ¹²	distillate ²⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	North-Holland → Hoorn ³⁰⁹⁰
frietfeest.nl	Frietfeest	The Frietfeest website offers a mobile snack wagon service for events, parties, and gatherings, providing delicious snacks and fresh potato fries.	Wholesale → Food Products ³⁰³ Quick Bites → Snack Bar ⁵⁸⁰	snack wagon ²⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Peel and Maas → Maasbree ²⁴⁸
grewada.nl	Grewada	Grewada is a mobile catering company that provides food and catering solutions for events and parties of all sizes.	Quick Bites → Food Trucks ⁶²³ Transportation → Transportation Vehicles ¹⁵	foodtruck ⁶¹³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Bergen → Aijen ¹⁸
ikwileenbuffetbestellen.nl	Slump Food	The website Slump Kookt is a catering company that offers seasonal menus and diverse food, including sandwiches, buffets, and snacks. The company focuses on providing culinary experiences for both individuals and businesses.	Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶
cater-inn.nl	Cater-Inn Zagershof	Cater-Inn Zagershof provides food catering services and accessories for hosting parties at home.	Parties → Party Supplies ¹¹⁰⁸ Parties → Themed Parties ⁵⁸³	karaoke ¹⁷⁶ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	North-Brabant → Asten ⁸⁰⁷
mariekeskitchen.nl	Marieke's Kichen	Mariekeskitchen is a catering business based in Druten specializing in preparing artisan snacks and dishes, emphasizing fresh, organic and responsibly sourced ingredients. They provide catering services for tapas, lunch and desserts, with delivery services to the surrounding area.	Entertainment → Leisure Activities ³³⁸ Sandwiches & Salads → Snacks ⁶⁹³	ingredients ²³⁴⁶ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	West-Maas en Waal → Dreumel ¹¹⁵
dolle-dries.nl	Dolle Dries	The website of Dolle Dries offers the possibility to order various products online, including fries, snacks, sandwiches, and other specialties. Delivery is also offered.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Delivery ²²²⁷	turkish pizza ⁶³ milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Zeist → Den Dolder ²⁴²
massadabestellen.nl	Massada Roelofarendsveen	The website of Massada Roelofarendsveen offers online ordering for a wide range of dishes, including Turkish pizzas, sandwiches, snacks, and vegetarian options, with the aim of enabling quick and easy online ordering.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Kaag en Braassem → Roelofarendsveen ³⁴⁸
thewhiskymen.nl	The Whisky Men & Monsieur Armagnac	The website ‘The Best Whisky Tastings and Ambassadors’ offers unique whisky and armagnac tastings, delivered at home or on-site.	Hobbies → Whisky ²³⁵ Culinary & Tastings → Tastings ¹²⁷	terroir ⁵⁰ whisky ³⁷³ taste ⁹³³ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹
monami-lunchroom.nl	Lunchroom Mon Ami	Lunchroom Mon Ami Roosendaal is a lunchroom and brasserie that offers homemade lunch and breakfast dishes, with influences from Turkish cuisine.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵	crêpe ¹⁶ lunchroom ³¹² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Roosendaal ²⁶⁷⁷
mamamieppiehapjesservice.nl	Mamamieppie Hapjesservice	Mamamieppie Hapjesservice provides catering services for parties and events, offering a variety of snacks, salads, and other dishes.	Fast Food → Fries ⁹⁴⁹	box ¹⁹⁸² salad ²⁴⁴⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
toko-elly.nl	Toko Elly	Toko Elly in Sittard is a store specializing in Indonesian food products and ingredients, offering items for preparing a rijsttafel (Indonesian feast) and a selection of hair care products.	Food Delivery → Indonesian ⁵⁰² Arts → Decorative Arts & Crafts ⁸²⁵	haircare products ¹⁴ rijsttafel ⁴⁷ spices ³⁴⁰ snack ²⁹¹⁶	Sittard-Geleen → Sittard ¹⁹⁹⁷
grandcafehesseln.nl	Grand Café Hesseln	Grand Café Hesseln is a café-restaurant-snackbar in Oosterhesselen, Netherlands, where visitors can enjoy various dishes, snacks, and drinks in a cozy atmosphere.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	snack bar ¹⁶² cafe ¹⁶²² snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵	Coevorden → Oosterhesselen ⁶⁶
snackbardewalenburger.nl	Snackbar De Walenburger Rotterdam	The website of Snackbar De Walenburger Rotterdam presents the menu, delivery options, and opening hours of a cafeteria located in Rotterdam that has been serving tasty snacks and meals for three generations.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Rotterdam → North ³³²
best4bulls.nl	Best4bulls	Best4bulls is an online store that sells food and accessories specifically for Bulldogs.	Pet Food → Dog Food ³²¹	bulldog ¹⁶ dog food ²⁰⁴ supply ⁹⁶¹ snack ²⁹¹⁶ food ³⁸⁷²
lynakant.nl	Lyna Kant	Lyna Kant is a catering company that provides catering services for both businesses and private individuals.	Hospitality → Bar Supplies ¹⁷ Quick Bites → Food Trucks ⁶²³	bbq ⁹⁰⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Aarlanderveen ⁹⁵
admiraal-bezorgt.nl	Partycentrum de Admiraal	Partycentrum Admiraal is an online shop delivering snacks and fries in Assendelft.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ party ⁵⁹²⁸	Zaanstad → Assendelft ⁵²⁴
geefhetcadeau.nl	Janfleur	The website GeefHetCadeau.nl provides a platform for creating and ordering corporate gifts and hampers, consisting of snacks, drinks, and lasting gifts.	Gifts → Gift Cards ⁹⁸¹	qr code ¹⁸⁹ snack ²⁹¹⁶ theme ⁴⁰¹⁵ drink ⁵¹⁹¹
blokkerdiervoeding.nl	Blokker Dierenvoeding	The website of Dierenwinkel Den Helder, a part of Blokker Dierenvoeding, offers a wide selection of animal feed and accessories for various animal species.	Pet Food → Dog Food ³²¹	medicine ⁴³⁵ feed ⁶⁷² animal ²⁹⁰⁸ snack ²⁹¹⁶ accessories ¹²⁹⁷⁵	North-Holland → Den Helder ¹⁸⁸⁶
tokogoedendag.nl	Toko Goedendag	Toko Goedendag is a store specializing in the sale of Asian food products and various other items.	Kitchen → Kitchenware ⁶⁹¹ Sauces & Condiments → Asian Food ¹⁵	canned goods ¹⁷ frozen ³¹ spices ³⁴⁰ beverage ⁵⁸⁶ snack ²⁹¹⁶
broodjesexpress.nl	Broodjesexpress BV	The Broodjesexpress website offers online ordering of sandwiches, lunch packs and snacks, with delivery throughout the Netherlands.	Lunch → Sandwiches ⁴⁶⁶ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	lunch ¹⁵³⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²	Haarlemmermeer → Zwanenburg ²⁹⁵
quichekeurig.nl	Quichekeurig Catering	Quichekeurig Catering is a catering company based in Amsterdam that offers various catering services, including bakery cakes, snacks, and cocktail/reception catering.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Tea & Coffee → Tea Rooms ²²⁹	reception ²⁹¹ bakery ⁷¹⁸ cake ¹⁷³⁰ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
jobo-koffie.nl	Jobo Coffee Groothandel	Jobo Coffee Groothandel is a coffee wholesale supplier that offers a wide assortment of coffee, tea, snacks, and accessories to businesses and restaurants.	Beverages → Tea ⁸²⁹ Hospitality → Suppliers ¹⁰⁵⁷	coffee machine ⁴¹⁵ tea ¹¹⁴⁶ snack ²⁹¹⁶ coffee ³⁸³⁸ assortment ⁷⁷⁹⁹	Drenthe → Hoogeveen ²²⁹⁴
lavinos.nl	Lavinos	Lavinos.nl is a website offering recipes and tips for students looking to cook easy, affordable meals.	Nutrition → Healthy Eating ⁶³⁴	healthy ¹⁰⁶ curry ³⁵⁵ pasta ¹³⁸⁹ snack ²⁹¹⁶ recipe ⁵¹⁴²
tasteweb.nl	TastyShop	The website Tastyshop.nl offers a wide assortment of ingredients, decoration materials, and other supplies for baking and preparing treats.	Dogs → Supplies ¹⁰⁰⁵ Food → Supermarkets & Grocery ³⁵⁶⁸	cake decoration ¹² ingredients ²³⁴⁶ snack ²⁹¹⁶ recipe ⁵¹⁴² event ⁴⁵¹⁹⁹
dedoerakterschelling.nl	Eetcafé De Doerak	De Doerak is a café and eetcafé in West-Terschelling that offers specialty beers, snacks, and meals.	Cafes → Cozy Cafes ¹² Theme Parks & Entertainment → Going Out ⁷¹	cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶ food ³⁸⁷² atmosphere ⁵⁵⁹¹	Terschelling → West-Terschelling ¹¹⁴
cafescheffers.nl	Café Scheffers	Café Scheffers is a café located in Dordrecht, Netherlands, offering drinks, dancing, or a snack, with the aim of providing a cozy evening for its guests.	Cafes → Brown Cafés ⁵⁹⁹	cafe ¹⁶²² snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → Dordrecht ⁴⁵³¹
dailyinlochem.nl	Dailyin	The website of Dailyin Lochem presents the menu, opening hours and address of a café and snack bar located in the center of Lochem, which has been a well-known place for over 35 years.	Cafes & Lunch → Lunchroom ⁴⁴⁶	center ¹¹¹⁵ lunch ¹⁵³⁴ snack ²⁹¹⁶ opening hours ²⁹⁵³ coffee ³⁸³⁸ menu ¹³⁸⁵⁶	Gelderland → Lochem ¹⁵⁸⁷
cafetaria-pakhuis.nl	't Pakhuis	't Pakhuis is a cafe and restaurant that offers quality food and drinks, with options for takeaway and delivery.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	Gelderland → Ede ⁵¹⁰⁴
hillies.nl	Hillies Familierestaurant	Hillies Familierestaurant in Staphorst is a family restaurant offering a wide range of snacks, sandwiches, fries, ice cream, and drinks to visitors.	Family & Themed Dining → Family Restaurants ¹⁶⁹ Events → Places ¹²¹⁹	ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Staphorst ⁷²²
cafetariathoekje.nl	Eetwinkel ‘t Hoekje	The website of Eetwinkel ‘t Hoekje is an online platform and physical snack bar that focuses on offering fresh food and drinks, catering services, and delivery in Ouddorp and surrounding areas.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Goeree-Overflakkee → Ouddorp ⁴³⁸
cafetariadeschakel.nl	Cafetaria De Schakel	Cafetaria De Schakel is a cafeteria located in Loosdrecht that offers delivery and a variety of sandwiches, salads, drinks, and snacks.	Quick Bites → Cafeteria ⁹⁰⁶ Events → Places ¹²¹⁹	meat products ²⁷² bread ¹⁶²² salad ²⁴⁴⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Wijdemeren → Loosdrecht ⁶⁷⁸
cafe-deviersprong.nl	Café de Viersprong	Café de Viersprong is a café and snackbar located in Heerhugowaard, offering visitors a place for lunch, dinner, drinks and celebrating parties.	Quick Bites → Snack Bar ⁵⁸⁰ Venues & Rentals → Hall Rental ¹⁹⁷	café ⁹⁴⁴ hall ¹⁷⁸⁶ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ party ⁵⁹²⁸	Dijk en Waard → Heerhugowaard ²⁰¹¹
anytymewestenholte.nl	AnyTyme snack&dine Westenholte	The website of Snackbar Westenholte Zwolle (Cafetaria De Weste) showcases a cafeteria that serves delicious snacks with a focus on sustainability and healthy ingredients, specifically using 100% vegetable frying oil.	Quick Bites → Snack Bar ⁵⁸⁰ Cycling → Cycling Routes ¹⁰⁰²	frying oil ¹⁸ seat ²¹⁸ snack ²⁹¹⁶ route ³⁴²⁵ coffee ³⁸³⁸ order ⁶⁹¹²	Overijssel → Zwolle ⁷³⁹⁵
grote-patatten.nl	Grote Patatten	The website of Grote Patatten presents the snack bar and provides information about the menu, opening hours, contact details, and online ordering.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Katwijk → Katwijk aan Zee ⁶¹⁶
kaasboerderijculemborg.nl	Kaasboerderij Culemborg (van Leeuwen-van Doesburg)	Kaasboerderij Culemborg is a farm that sells artisanal cheeses and regional products, with a focus on providing a personal experience for its customers.	Cheese → Farm Cheese ¹⁶ Farms & Farm Businesses → Cheese Farms ³⁶	regional products ³⁹¹ gift package ⁵³⁰ cheese ¹²⁰⁵ snack ²⁹¹⁶ opening hours ²⁹⁵³	Gelderland → Culemborg ¹²⁶⁴
frietwagensomeren.nl	Frietwagen Someren	The website of Frietwagen Someren presents the services of a snack truck specializing in delivering fries and snacks for various occasions, such as parties and events.	Restaurants & Dining → Fries Kiosks ³³ Food → Foodservice & Catering ⁵⁷⁷	snack truck ³⁵ snack ²⁹¹⁶ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	North-Brabant → Someren ⁸⁵⁰
vandoornhoreca.nl	Horecagroothandel - Van Doorn Horeca	The website of Horecagroothandel - Van Doorn Horeca is a wholesale supplier offering a variety of products for the kitchen to the hospitality industry.	Hospitality → Restaurant Supplies ³¹ Food → Meat ¹¹²³	dairy ²⁷⁴ beverage ⁵⁸⁶ bread ¹⁶²² meat ²⁰⁵⁵ snack ²⁹¹⁶	Zeeland → Middelburg ²³⁴²
thehideaway.nl	Café The Hide Away	Café The Hide Away Dordrecht is a cozy brown café with a semi-British atmosphere in Dordrecht, offering a relaxed environment for guests, with options for socializing, watching sports, and enjoying live music.	Performance → Live Music ¹⁶¹² Cafes → Brown Cafés ⁵⁹⁹	guinness ¹⁰ café ⁹⁴⁴ snack ²⁹¹⁶ sport ⁴²²⁸ agenda ⁴³⁷⁴ music ¹³¹⁷⁰	South-Holland → Dordrecht ⁴⁵³¹
cinebat.nl	Cinebat	Cinebat is a filmhouse in Bathmen that offers a program of films and news, and sells tickets through various channels.	Film → Film Houses ¹³ Institutions → Cultural Institutions ⁴⁷⁵	ticket ²⁷⁸⁵ snack ²⁹¹⁶ film ³⁰⁰⁷ newsletter ⁶⁵⁰⁴	Deventer → Bathmen ²⁵⁶
cafetariademarkt.nl	De Markt Simpelveld	The De Markt Simpelveld website is an online ordering platform for fries, snacks, and other dishes, offering delivery and a downloadable app.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Limburg → Simpelveld ²⁶⁰
noynuts.nl	NoyNuts	The NoyNuts website presents a range of sustainable and healthy snacks, nuts, and citrus fruits, based on the values of nature, health, and pure taste.	Nutrition → Healthy Eating ⁶³⁴	nuts ⁴¹⁷ farmer ⁶⁶¹ snack ²⁹¹⁶	South-Holland → Barendrecht ¹⁶⁵³
r-racing.nl	De Smulpijp	The website of De Smulpijp showcases a mobile fry truck and hamburger stand providing catering services for events and parties, primarily in the Antwerp and West Flanders region.	Catering → Mobile Catering ⁸⁷ Online Retail → Food Retail ³⁴⁰	fry truck ³⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Eersel → Knegsel ¹³⁵⁹
haringpartyzvl.nl	Haring Party Lions’ Oost Zeeuwsch Vlaanderen	The website of Haring Party Lions’ Oost Zeeuwsch Vlaanderen provides information about an annual networking event with snacks, live music, and a focus on supporting a good cause in the region.	Volunteering → Lions Clubs ¹¹³ Local & Regional → Regional Events ⁸²¹	haringparty ¹⁶ lions club ¹⁰⁶ networking ⁸⁴² snack ²⁹¹⁶	Terneuzen → Sas van Gent ¹²⁵
vishandelsierenjonk.nl	Viswinkel Sier & Jonk	Viswinkel Sier & Jonk is a seafood specialist shop offering cold seafood platters, fish dishes, and other fish products for sale online and in store.	Fish → Fishmongers ⁸³	platter ⁶⁶ delicacies ²⁷³ fish ¹¹²¹ snack ²⁹¹⁶ order ⁶⁹¹²	North-Holland → Purmerend ²⁶²⁰
dentommes.nl	Den Tommes	The website of Café den Tommes presents information about the village café, located in Merselo, Venray, including opening hours, contact details, and the menu offering.	Cafes → Brown Cafés ⁵⁹⁹ Context ¹⁶¹³⁹⁴	cafe ¹⁶²² snack ²⁹¹⁶ opening hours ²⁹⁵³ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹	Venray → Merselo ⁵¹
happastapasexpress.nl	Happas Tapas Express	The website of Happas Tapas Express presents a catering service that delivers warm and cold snacks and meals to private events and businesses in Strijen and the Hoeksche Waard.	Catering & Ready Meals → Chinese Restaurants ³⁰³ Performances & Entertainment → Celebrations ⁵⁶⁰	christmas ³²⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶	Hoeksche Waard → Strijen ²³⁶
foodiesenzo.nl	Foodies & Zo	Foodies & Zo is a catering and lunchroom that offers various meals, snacks, and drinks, with delivery options and event organization services.	Cafes & Lunch → Lunch Spots ²³⁷ Tea & Coffee → Tea Rooms ²²⁹	lunch ¹⁵³⁴ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	North-Brabant → Boekel ⁴⁷⁹
bigbread-almere.nl	BB Kitchen Almere	The website of BB Kitchen Almere offers the possibility to order meals and snacks, both for takeaway and delivery.	International → Middle Eastern ¹¹⁶ Food Delivery → Delivery ²²²⁷	takeaway ⁶⁵³ meal ¹⁶³⁸ promotion ²⁰⁶² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
biedesjmeed.nl	Fietscafé Biej De Sjmeed	Fietscafé Biej De Sjmeed in Linne is a cafe where visitors can enjoy coffee, pastries and a variety of sandwiches and snacks, with a focus on a scenic walking route in the area.	Cafes → Dutch Restaurants ¹⁰³¹ Hiking → Walking Routes ²²⁶	walking route ³⁴⁰ pastries ⁹⁴⁶ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Maasgouw → Linne ¹⁰¹
roestwineandfoodbar.nl	Roest Wine & FoodBar	Roest Wine & FoodBar is a cozy wine bar offering relaxation and conviviality with an extensive wine selection and delicious snacks.	Cafes → Cozy Cafes ¹² Bars → Wine Bars ¹⁷⁰	conviviality ¹¹⁷ gin ¹⁴¹ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ atmosphere ⁵⁵⁹¹
nikio.nl	Nikio Internationale online Supermarkt	Nikio Internationale online Supermarkt is an online supermarket offering a wide range of exotic and traditional products, with a focus on providing a seamless ordering and delivery experience.	Coffee & Tea → Beverages ⁴⁴⁵³ Supermarkets & Grocery → Online Supermarkets ⁵³	noodles ¹⁹¹ beverage ⁵⁸⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
foodforthemood.nl	Food for the Mood Catering & Events	The website of Food for the Mood Catering & Events presents a full-service catering company that caters to various events and occasions in Alkmaar and the surrounding area, including buffets, walking dinners, and live cooking concepts.	Parties → Private Events ⁹⁷ Events & Hospitality → Corporate Catering ²⁶⁷	live cooking ¹⁵ reception ²⁹¹ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	North-Holland → Alkmaar ⁶⁵⁰⁷
mini-wok-stadhuisplein.nl	Mini Wok Stadhuisplein	The website Mini Wok Stadhuisplein offers the possibility to order meals online from the restaurant in Tilburg.	Food Delivery → Asian ²⁷²³ Catering & Ready Meals → Takeaway ⁴⁰⁹	bubble tea ¹⁵³ poké bowl ¹⁶⁹ wok ²³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
mrbarley.nl	Mr. Barley	The website of Mr. Barley is a pub in Breda focusing on craft beers, comfort food, and a relaxed atmosphere, featuring a terrace and picnic tables.	Bars → Pubs ⁵⁴⁶ Food & Dining → Outdoor Seating ²²⁸	beer ²⁸⁸⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ atmosphere ⁵⁵⁹¹	North-Brabant → Breda ⁹⁰⁰³
amazingindia.nl	Amazing India	Amazing India is an online retailer specializing in authentic Indian groceries and essentials, delivering them directly to customers in the Netherlands.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Essential → Health ⁹¹⁵⁸⁹	spices ³⁴⁰ groceries ³⁵⁸ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ festival ³⁸⁰⁴
beja-leerdam.nl	Beja Leerdam	The Beja Leerdam website is an online shop where customers can order snacks and various products, such as fries, sandwiches, and drinks, directly online.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	points ⁶¹² promotion ²⁰⁶² snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
woofandbarker.nl	Woof & Barker	The website Woof & Barker offers natural dog food, hypoallergenic options, and accessories, aiming to provide dogs with healthy and happy nutrition and care.	Pet Stores → Online Pet Stores ¹⁶	toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ accessories ¹²⁹⁷⁵
frituurrecepten.nl	frituurrecepten.nl	The Frituur Recepten website offers a collection of recipes for various types of fried snacks, with a focus on homemade and healthier frying.	Quick Bites → Snack Bar ⁵⁸⁰	frituur ¹² frying oil ¹⁸ churros ³⁰ croquettes ¹⁰⁸ snack ²⁹¹⁶ recipe ⁵¹⁴²
jipsvoeding.nl	Jip's Voeding	Jip's Voeding is an online store that specializes in providing natural dog and cat food, along with related products such as snacks, stamps, and cushions.	Upholstery & Fabrics → Cushions ²⁴⁵ Digital & Technology → E-Commerce ⁴¹⁴⁸	cat food ⁹⁸ dog food ²⁰⁴ cushion ⁸²³ snack ²⁹¹⁶ food ³⁸⁷²
defriettentrooi.nl	Fabien & Julia	De Friettent Rooi is a fast-food restaurant in Sint-Oedenrode that sells fries, snacks, burgers, and ice cream.	Sandwiches & Salads → Snacks ⁶⁹³ Context ¹⁶¹³⁹⁴	meat products ²⁷² burger ¹⁴³¹ fries ²⁷⁵³ market ²⁷⁷² snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	Meierijstad → Sint-Oedenrode ⁶³²
restariadepatrijs.nl	Restaria de Patrijs	Restaria de Patrijs is a snack bar and meeting place in Zwijndrecht.	Quick Bites → Snack Bar ⁵⁸⁰ Outdoor → Terraces ¹⁸⁸	family business ⁷⁹³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	South-Holland → Zwijndrecht ¹⁴⁵⁵
kidsplayland.nl	Kids Play Land	Kids Play Land is a mobile children's spring paradise that travels through the Netherlands and offers children the opportunity to jump and play.	Children’s Activities → Playgrounds ⁷⁰²	bouncer ¹¹ parcours ²⁶ slides ⁸⁸ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Deventer → Colmschate ¹²⁴
kiobas.nl	Kiobas Dieren	The website of Kiobas Dieren offers online ordering for a variety of dishes and drinks, as well as delivery and takeaway options.	International Cuisine → Turkish Cuisine ²² Quick Bites → Snack Bar ⁵⁸⁰	chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Rheden → Dieren ⁴⁶²
cateringbywarda.nl	Catering by Warda	The website of Catering by Warda showcases a catering company that prepares fresh spring rolls and snacks for various occasions, emphasizing homemade dishes.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	spring rolls ¹⁴¹ sauce ¹¹⁴¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
thebasemaasland.nl	The Base Maasland	The website of The Base Maasland presents the youth center, its activities, rules, and contact information, with the goal of providing a relaxed space for young people, students, and residents of the village.	Logistics → Transportation ¹¹⁰² Youth Development → Youth ¹⁰³³	youth center ⁴⁴ young people ¹⁰⁴⁵ snack ²⁹¹⁶ agenda ⁴³⁷⁴ volunteer ⁸³⁶⁷	Midden-Delfland → Maashorst ²⁷⁵
pips.nl	Pip's	Pip's is a shop that offers a wide range of products for pets.	Pets → Cats ⁶³⁹ Animals → Pet Food ⁵⁸⁴	toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵
venster33.nl	Venster 33	Venster 33 is a café-restaurant located in De Pijp, Amsterdam, offering lunch, dinner, drinks, and a diverse menu.	Fast Food → Fries ⁹⁴⁹ Outdoor → Terraces ¹⁸⁸	snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Amsterdam → South ¹⁴⁸⁸
cha-house.nl	Mister Chen X Cha House	Mister Chen X Cha House is a Japanese-Chinese cafe in Amsterdam that combines the atmosphere of Hong Kong ‘yam cha’ restaurants and Japanese Izakayas.	Food Delivery → Asian ²⁷²³	dim sum ⁸⁷ ramen ¹⁰⁶ coziness ²³⁵ tea ¹¹⁴⁶ sushi ¹⁶⁹⁵ snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
pawsandpupper.nl	Paws & Pupper	Paws & Pupper is a webshop specializing in natural products and toys for dogs.	E-Commerce → Pet Supplies ¹⁰¹³ Animals → Pet Stores ⁴⁷⁸	toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
tokogembira.nl	Toko Webshop	The website Tokogembira.nl is an online shop and physical store specializing in offering Asian and Surinamese food and products.	Food → Supermarkets & Grocery ³⁵⁶⁸	flour ¹⁴³ noodles ¹⁹¹ spices ³⁴⁰ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
stadscafezaltbommel.nl	Stadscafé Zaltbommel	't Stadscafé Zaltbommel is a central meeting point and catering establishment in Zaltbommel, offering a wide range of activities and menu options, from dining to drinks and business events.	Outdoor → Terraces ¹⁸⁸ Travel → Tourism ³⁷⁵⁴	seasonal ²⁶ allergen ⁶⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶	Gelderland → Zaltbommel ¹²³¹
topdogs-advies.nl	T.O.P. Dogs	The T.O.P. Dogs website offers dog behavior therapy, training, and a shop with dog snacks and accessories, aiming to help people and dogs in Middelburg and the surrounding area build a positive relationship and provide behavioral guidance.	Dog Training → Behavior ⁴¹³ Dogs → Dog Training ⁸⁸¹	pup ⁶⁵ behavior ¹⁷⁷⁹ snack ²⁹¹⁶ environment ⁴⁸⁷³ dog ⁵⁴⁸³ training ²⁸¹³³	Zeeland → Vlissingen ¹⁶¹⁴
dogzoo.nl	Dogzoo Dierenspeciaalzaak	Dogzoo Dierenspeciaalzaak is a pet store specializing in the sale of products and supplies for dogs and cats.	Animals → Pet Stores ⁴⁷⁸	dog toy ²¹ toy ²²⁹⁵ snack ²⁹¹⁶ care ¹²³³⁸
cafebax.nl	Cafe BAX	Cafe Bax is a neighborhood cafe located in Amsterdam, Netherlands, offering a variety of beverages, snacks, and a welcoming atmosphere.	Bars → Pubs ⁵⁴⁶ Beer → Breweries ³³⁷	beer ²⁸⁸⁷ snack ²⁹¹⁶ coffee ³⁸³⁸ terrace ⁴⁸⁴⁷ atmosphere ⁵⁵⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
keetjes.nl	Keetjes	Keetjes Natural Dog Food is an online shop that offers natural dog food, snacks, and supplements.	Pet Food → Dog Food ³²¹	supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷²
petfactor.nl	PetFactor	PetFactor is a specialist in pet food and accessories, focusing on high-quality snacks and advice.	Animals → Pet Food ⁵⁸⁴ Animals → Pets ¹³⁸²	snack ²⁹¹⁶ ship ⁵¹⁰³ dog ⁵⁴⁸³ order ⁶⁹¹² brand ¹⁷⁷³⁷
boxbites.nl	BoxBites	The BoxBites website offers a service for ordering healthy snacks delivered directly to customers’ mailboxes, with options for individual boxes, subscriptions, and gift boxes.	Food Delivery → Delivery ²²²⁷	choice ⁸²⁷ box ¹⁹⁸² snack ²⁹¹⁶ subscription ³²⁸⁷
bigdog.nl	BigDog.nl	The website BigDog.nl offers a wide range of high-quality dog food and accessories, focused on the well-being of dog owners.	Breed → Rhodesian Ridgeback ¹⁸ Animals → Pet Stores ⁴⁷⁸	dog food ²⁰⁴ snack ²⁹¹⁶ accessories ¹²⁹⁷⁵
hondenvoer-winkel.nl	Hondenvoer-winkel	The website is an online store offering dog and cat food, accessories, and other pet supplies.	Animals → Pet Food ⁵⁸⁴ Animals → Dogs ⁵⁸⁷⁹	dog food ²⁰⁴ cushion ⁸²³ toy ²²⁹⁵ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ accessories ¹²⁹⁷⁵
tippyblueshop.nl	TippyBlueShop	TippyBlueShop is an online shop that sells natural dog snacks and other pet supplies.	Animals → Pet Stores ⁴⁷⁸ Pet Supplies → Animal Food ¹⁸	dog snacks ³⁵ pet supplies ¹¹⁰ meat ²⁰⁵⁵ snack ²⁹¹⁶ shop ⁶⁴⁸³	Utrecht → Houten ¹⁶⁷⁷
marries-hondenenkattenvoer.nl	Marries Honden & Kattenvoer	Marries Honden & Kattenvoer is an online store selling Cenaturio dog and cat food, focusing on high-quality and natural nutrition for pets.	Pet Supplies → Dog Supplies ¹¹² Pet Food → Dog Food ³²¹	cat food ⁹⁸ dog food ²⁰⁴ snack ²⁹¹⁶ food ³⁸⁷²
kauwsnacks.nl	Kauwsnacks	The website, Kauwsnacks, is an online store offering natural and high-quality dog snacks.	Pet Food → Dog Food ³²¹	dog snacks ³⁵ natural ²³⁵ trainer ¹⁹⁶⁶ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹
lunasupport.nl	Luna Support	The website Luna Support offers natural probiotic and glucosamine supplements for dogs, focused on improving their health, energy, and well-being.	Nutrition → Supplements ¹⁵⁵⁷ Pet Supplies → Pet Nutrition ¹⁸	glucosamine ¹⁷ probiotics ⁸⁶ formula ²⁸⁷ supplement ¹⁹⁶⁸ wellbeing ²⁶²⁰ snack ²⁹¹⁶
nutridog.nl	Nutridog	Nutridog is an online store specializing in specially formulated food and supplies for dogs.	Pet Food → Dog Food ³²¹	deals ¹⁰⁷⁰ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
tjins.nl	Tjin’s	The website showcases a Surinamese sandwich shop, Tjin's, which has been operating for over 40 years and offers traditional Surinamese flavors, including sandwiches, snacks, drinks, and catering.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Sandwich Shops ²²⁹	surinamese ⁴¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
greetbana.nl	Greetbana	Greetbana is a website that sells gluten-free and vegan banana bread.	Bakery & Food Production → Bread ⁷⁶⁵ Healthy & Dietary → Healthy Food ⁶³	baker ⁹⁰ gluten-free ¹⁵⁶ vegan ⁵⁰⁸ snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
flemmings.nl	Flemmings B.V.	The website of Flemmings B.V. presents the company, its products, and activities related to the production and assembly of snacks for the retail market.	Metalworking → Milling ⁴²⁶ Food & Beverage → Food Industry ⁸³⁵	assemble ²⁹ snack ²⁹¹⁶	Drenthe → Emmen ³³⁴⁸
izkaya.nl	Diverse companies and platforms	The website presents a collection of news articles and links to various companies across sectors including project management, sustainable energy, food, medical innovation, recruitment, and investments.	Business → Economy ³⁶⁶⁶⁶	gold ⁸⁰⁵ candidate ¹⁸⁹⁶ snack ²⁹¹⁶ energy ⁹⁰⁷⁵
naamlooz.nl	Naamlooz	The website provides information about informal, free Friday afternoon gatherings called ‘Naamlooz’ which take place in various cities, including Utrecht and Arnhem.	Local & Regional → City Events ²² Community & Social → Social Events ⁴¹⁶	gathering ³⁹⁴ people ⁶²⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Gelderland → Arnhem ⁸⁶⁸⁰
wonderfuldrinks.nl	Wonderful Drinks	The website of Wonderful is a platform for the marketing and sale of premium drinks and snacks in the Netherlands, primarily focused on the Dutch hospitality industry and the distribution of innovative brands.	Hospitality → Suppliers ¹⁰⁵⁷	distribution ¹⁰¹¹ snack ²⁹¹⁶ hospitality ³⁴⁹¹ drink ⁵¹⁹¹ brand ¹⁷⁷³⁷	North-Holland → Amsterdam ⁴¹²⁵³
nutland.nl	Nutland	Nutland is a supplier of nuts, dried fruits, seeds, pulses, and snacks, offering a wide selection and reliable delivery services.	Food & Beverage → Beverages ⁶⁴ Vegetables → Nuts ¹⁰⁴	dried fruit ¹¹ pricing ¹⁸⁹ nuts ⁴¹⁷ partnership ¹⁴⁰⁷ snack ²⁹¹⁶
cafetariadeben.nl	Cafetaria de Ben	Cafetaria de Ben is a coffeehouse-eatery in Anna Paulowna that offers a wide range of meals and drinks.	Quick Bites → Cafeteria ⁹⁰⁶	dinner ¹⁵³³ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Hollands Kroon → Anna Paulowna ²⁹¹
smaakatelierzoetenzout.nl	Smaakatelier Zoetenzout	Smaakatelier Zoetenzout is an online shop offering a wide range of food products and gifts, aimed at foodies.	Commerce → Gift Baskets ²⁹¹ Gifts → Gift Cards ⁹⁸¹	gift basket ⁷² nuts ⁴¹⁷ bread ¹⁶²² snack ²⁹¹⁶ drink ⁵¹⁹¹ blog ¹³³⁹²
blieketen-drinken.nl	Bliek Eten & Drinken	Bliek Eten & Drinken is a café and restaurant located in Veere, Zeeland, offering breakfast, lunch, and various Zeelandic specialties including bakery products and snacks.	European → Dutch ⁴⁸ Bakery & Food Production → Bread ⁷⁶⁵	bolus ¹⁰ pancakes ⁵⁶⁸ bread ¹⁶²² breakfast ¹⁸²² snack ²⁹¹⁶ coffee ³⁸³⁸	Zeeland → Veere ¹⁴²⁴
gastrobarvelluto.nl	Gastrobar Velluto	Gastrobar Velluto is a restaurant and bar located in Leiden offering an informal atmosphere for enjoying food, drinks, and cocktails, with a focus on shared dining and happy hour.	Food → Restaurants & Dining ²⁷³²⁵	happy hour ¹⁵ cocktail ⁹²⁵ dinner ¹⁵³³ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵	South-Holland → Leiden ⁷⁰⁸⁹
taartenvanromaike.nl	Taarten en cupcakes Silvolde	The website ‘Taarten en cupcakes Silvolde’ is an online shop selling a variety of cakes, cupcakes, and other sweet treats, with a focus on handcrafted and personalized options for different occasions.	Pastry → Cakes ⁸²⁶ Food → Gifts & Souvenirs ²⁴²¹	cupcakes ²⁷⁴ high tea ⁵⁸⁵ cake ¹⁷³⁰ snack ²⁹¹⁶ workshop ¹⁹³²⁵
deheervarsseveld.nl	De Heer IJs en Snacks	The website of De Heer IJs en Snacks presents the menu, opening hours, and contact information of the snack bar.	Quick Bites → Snack Bar ⁵⁸⁰ Outdoor → Terraces ¹⁸⁸	ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Oude IJsselstreek → Varsseveld ³⁰¹
snackspert.nl	Snackspert	The Snackspert website is an online platform dedicated to sharing information and recommendations about delicious snacks and restaurants, with a particular focus on the Amsterdam area.	Wholesale → Food Products ³⁰³ Quick Bites → Snack Bar ⁵⁸⁰	mayonnaise ²⁷ recommendation ¹²⁰ chip ¹³⁸ snack ²⁹¹⁶ restaurant ¹¹²¹⁵ blog ¹³³⁹²	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
bombinadelft.nl	Bombina	Bombina is a restaurant located in Delft that offers breakfast, lunch, and drinks.	Cafes & Lunch → Lunch Spots ²³⁷	lunch ¹⁵³⁴ breakfast ¹⁸²² snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Delft ⁵³⁰⁹
darlingdogcenter.nl	Darling Petcenter	Darling Petcenter is a dog daycare and resort located in Drenthe, offering day and vacation care for dogs, along with nutritional advice and a showroom featuring natural snacks.	Dogs → Dog Daycare ²²	resort ²⁷⁹ living room ¹³²⁵ daycare ¹³⁶⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³	Netherlands → Drenthe ²⁰⁰⁶²
dehaagschecroquetterij.nl	The Haagsche Croquetterij	The Haagsche Croquetterij offers traditional Dutch croquettes, bitterballs, and snacks.	Cuisine → Dutch Cuisine ¹⁷⁹	bitterballs ⁴¹ croquettes ¹⁰⁸ ingredients ²³⁴⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²	South-Holland → The Hague ¹⁹⁸⁹⁸
wijnfestival-groningen.nl	Wijnfestival Groningen	The Wijnfestival Groningen is an annual event taking place in the Akerk in Groningen from September 26th to 28th, 2025, offering visitors the opportunity to taste exceptional wines and enjoy tasty snacks in a convivial atmosphere.	Festivals → Wine Festivals ⁴²	taste ⁹³³ ticket ²⁷⁸⁵ snack ²⁹¹⁶ church ³⁴³⁹ wine ⁴⁴⁷⁶ atmosphere ⁵⁵⁹¹	Netherlands → Groningen ²³⁷³⁴
lostaqueros.nl	Los Taqueros	Los Taqueros is a company specializing in producing and selling warm, Mexican-inspired snacks.	Mexican & South American → Mexican ¹⁵¹ Meal Solutions → Food Businesses ⁵⁷	empanadas ¹⁷ beef ³¹⁹ oven ³²⁴ chicken ⁹⁴⁴ snack ²⁹¹⁶
mollyandme.nl	Molly&Oos	Molly&Oos is an online store offering a wide range of toys, accessories, clothing, and other products for dog owners.	Children’s Clothing → Baby Clothing ⁶⁰⁴ Entertainment → Humor ²¹⁶	tumbler ¹⁴ sweater ⁴¹³ t-shirt ⁶⁹⁸ snack ²⁹¹⁶ print ⁵⁵¹¹	Zuidplas → Moordrecht ³³²
piethuisman.nl	Café Piet Huisman	Café Piet Huisman is a specialty beer café located in Nijmegen, offering a wide selection of drinks and snacks and organizing events.	Bars & Pubs → Bars ¹⁹³⁸ Event Resources → Event Organizers ³⁶	drink menu ²⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ room ³⁴¹¹ event ⁴⁵¹⁹⁹	Gelderland → Nijmegen ⁹³⁸⁴
ikredmijnwereld.nl	None	The website ‘I Save the World’ presents and promotes sustainable and fun initiatives and activities, primarily aimed at children and families, that contribute to a better, fairer, and healthier planet.	Gifts & Souvenirs → Gift Items ³⁴² Family → Children ²⁷⁹⁸	street art ⁸¹ daycare center ¹⁸⁰ diy ⁴⁴³ snack ²⁹¹⁶ concert ⁴⁴⁰⁹ exhibition ⁵³³²	Almere → Almere City ⁹³⁴
broodjeszaakdenieuwerai.nl	Broodjeszaak De Nieuwe Rai	Broodjeszaak De Nieuwe Rai is a family-run restaurant in Amsterdam offering sandwiches, snacks, and catering services, with a focus on fresh, homemade products and a terrace for customers.	Cafes & Lunch → Deli ²³ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
grieksehuis.nl	The Greek House	The Greek House is a liquor store, mini-market and delicatessen offering Greek products.	Dairy & Cheese → Delicatessens ⁶¹⁷	delicacies ²⁷³ olive oil ³⁴⁶ cheese ¹²⁰⁵ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
speeltuindevogelenzang.nl	Speeltuinvereniging Hattemerbroek	Speeltuinvereniging Hattemerbroek is a playground open to the public, offering various facilities and activities for children and parents.	Children’s Activities → Playgrounds ⁷⁰² Parks & Gardens → Parks ¹⁰⁴³	lemonade ³³ playground ¹⁰⁸⁸ snack ²⁹¹⁶ association ⁸⁵⁶²	Oldebroek → Hattemerbroek ⁷⁸
tothemoen.nl	Tothemoen	The website tothemoen offers easy and healthy recipes.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	healthy ¹⁰⁶ bowl ⁴⁸² cooking ⁸⁰¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
club40plus.nl	Club40+ The Evening Party	Club40+ The Evening Party is a weekly dance party aimed at 30+ year olds, blending disco, soul, funk, and house music with a festive atmosphere.	Nightlife → Clubs ³⁵⁸ Music & Performance → Music Events ⁷⁵⁸	dance floor ¹¹⁴ djs ¹⁹⁹ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹ music ¹³¹⁷⁰	Netherlands → Groningen ²³⁷³⁴
besteveganproducten.nl	Beste Vegan Producten Sander	The Beste Vegan Producten is a website that presents the latest and best vegan products in the Netherlands and offers information about veganism and a vegan lifestyle.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	veganism ⁸⁵ candle ⁷⁹² snack ²⁹¹⁶ clothing ⁹⁴⁴³ blog ¹³³⁹²
bunnyteaandmore.nl	Bunny Tea & More	Bunny Tea & More is a shop in Enschede that sells Bubble Tea, exclusive snacks, and gifts. The shop also offers the opportunity to create a personalized Bubble Tea DIY kit and sell a Boba machine with special flavors.	Beverages → Tea ⁸²⁹ Food → Gifts & Souvenirs ²⁴²¹	boba ¹⁴ diy kit ⁹⁴ bubble tea ¹⁵³ snack ²⁹¹⁶ gift ⁶⁴⁴²	Overijssel → Enschede ⁵⁵⁵⁴
oldfashionedbar.nl	The Old Fashioned Bar	The website of ‘The Old Fashioned’ presents a bar and restaurant in Rijssen specializing in cocktails, whisky's, classic beers, wines and an extensive bites menu, as well as cocktail workshops and on-location catering.	Bars → Cocktail Bars ²³⁶ Beverages → Cocktails ¹⁴⁴	whisky ³⁷³ cocktail ⁹²⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ menu ¹³⁸⁵⁶ workshop ¹⁹³²⁵	Rijssen-Holten → Rijssen ¹⁰⁴⁸
josephinesbar.nl	Josephines Bar	Josephines Bar is a cocktail bar and bistro in Hoofddorp, offering a Roaring Twenties and New York chic atmosphere where guests can order cocktails and snacks and make reservations.	Bars → Cocktail Bars ²³⁶ Beverages → Cocktails ¹⁴⁴	cocktail ⁹²⁵ bar ¹²¹⁶ snack ²⁹¹⁶ reservation ³³⁷³ party ⁵⁹²⁸	Haarlemmermeer → Hoofddorp ²⁷³⁹
route-damuse.nl	De Heunsberg bv i.o.v.	The Route d'Amuse website offers culinary walking routes and treasure hunts in Valkenburg aan de Geul and the South Limburg Heuvelland, focused on providing a pleasant and active exploration of the region.	Walking → Walking Events ¹³⁷ Cycling → Cycling Routes ¹⁰⁰²	treasure hunt ⁵² south limburg ⁸⁶ walk ²¹⁶¹ snack ²⁹¹⁶ route ³⁴²⁵ newsletter ⁶⁵⁰⁴	Limburg → South-Limburg ¹²²⁵
strandhuisdemaashorst.nl	Strandhuis de Maashorst	't Strandhuis is a restaurant and bar located next to a swimming lake and campsite, offering meals, lunches, drinks and events in a pleasant environment.	Entertainment → Leisure Activities ³³⁸	dinner ¹⁵³³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Maashorst → Schaijk ³¹⁰
panachezevenbergen.nl	Cafetaria & Broodjeszaak Panaché	Cafetaria & Broodjeszaak Panaché is a food establishment in Zevenbergen offering various dishes and sandwiches, including a delivery service.	Sandwiches & Salads → Sandwich Shops ²²⁹ Quick Bites → Cafeteria ⁹⁰⁶	delivery service ²³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ kitchen ⁶⁴⁴³	Moerdijk → Zevenbergen ⁵⁰²
cafetariadetoren.nl	Cafetaria de Toren	Cafetaria de Toren is a café in Breda that offers fresh fries and snacks, emphasizing quality and fresh ingredients.	Sandwiches & Salads → Snacks ⁶⁹³	farmer ⁶⁶¹ ingredients ²³⁴⁶ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	North-Brabant → Breda ⁹⁰⁰³
christfrituur.nl	Frituur Christ Breda	The website of Frituur Christ Breda presents a traditional frituur (fast food restaurant) with a long history, offering homemade fries, snacks, and drinks in Breda and surrounding areas.	Asian → Chinese ⁴¹⁵ Quick Bites → Cafeteria ⁹⁰⁶	takeaway ⁶⁵³ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
deniesfriet.nl	Denies Public Catering	The website of ‘Denies Public Catering’ offers the service of delivering fries, doughnuts, and snacks to various locations, emphasizing quality and a long-standing tradition.	Local Businesses → Artisan Products ⁵⁶ Sandwiches & Salads → Snacks ⁶⁹³	doughnuts ⁴³ fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹²
johnsonpetfoods.nl	JohnsonPetfoods NL	The website, JohnsonPetfoods NL, is an online store offering pet food, snacks, and non-food products for dogs and cats, and operates as a distributor for various reputable brands.	Animals → Pet Food ⁵⁸⁴	distribution ¹⁰¹¹ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
sarandie.nl	Sarandie Sri Lankaanse Producten	Sarandie Sri Lankaanse Producten is an importer and distributor of Sri Lankan food and non-food items.	Trade → Import ⁸⁵⁴ Dairy & Cheese → Dairy ⁷⁶³	kitchenware ¹²⁵ spices ³⁴⁰ seed ⁵⁹⁹ tea ¹¹⁴⁶ snack ²⁹¹⁶
leclerque.nl	le Clerque Frites	The website of 'le Clerque Frites' is an online ordering platform for fries and other snacks, offering the option for takeout orders and quote requests.	International → Middle Eastern ¹¹⁶ Websites → Ordering Sites ⁷⁵	takeout ¹¹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Altena → Wijk en Aalburg ²²⁰
dejongewees.nl	Café De Jonge Wees	Café De Jonge Wees is a neighborhood pub in the Jordaan district of Amsterdam offering a cozy atmosphere with beer, jenevers, bitterballs, and sports (Ajax on TV) to its patrons.	Bars → Pubs ⁵⁴⁶ Cafes → Brown Cafés ⁵⁹⁹	bitterballs ⁴¹ jenever ⁴³ ajax ⁸⁷ beer ²⁸⁸⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	North-Holland → Amsterdam ⁴¹²⁵³
tokowardi.nl	Toko Wardi	Toko Wardi Zoetermeer is a Surinamese shop offering a wide assortment of Indonesian, Asian, and Surinamese products, including sandwiches, takeaway meals, and snacks.	Food Delivery → Indonesian ⁵⁰² Supermarkets & Grocery → Specialty Stores ⁷⁰	meal ¹⁶³⁸ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸
theelief.nl	Theelief	theelief.nl is an online store specializing in the sale of loose tea, tea packages, snacks and tea-related accessories.	Healthy & Dietary → Health Food ²²	tea ¹¹⁴⁶ office ²⁸⁹⁸ snack ²⁹¹⁶ subscription ³²⁸⁷ ship ⁵¹⁰³
grillenchill-utrecht.nl	Grill and Chill Utrecht	The website of Grill and Chill Utrecht offers an online ordering system for fries, snacks, burgers, and other dishes, with the option for delivery.	Quick Bites → Hair Salon ¹¹²	wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
snacksdewiers.nl	Snackwagen De Wiers	The website of Snackwagen De Wiers in Nieuwegein offers an online ordering system for fries, snacks, and other popular Dutch snacks, with the option for home delivery.	Quick Bites → Hair Salon ¹¹² Coffee & Tea → Beverages ⁴⁴⁵³	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
cafetariaoostvoorne.nl	Cafetaria Oostvoorne	Cafetaria Oostvoorne is a family-run snack bar established in 1972 in Oostvoorne, offering a variety of snacks and meals.	Quick Bites → Snack Bar ⁵⁸⁰	cafetaria ²¹ fry ⁵⁹ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²
italiaans-restaurant-gusto.nl	Entrada Restaurants	The Gusto restaurant, located in The Hague, offers Italian cuisine, drinks and special events to visitors.	Culinary & Tastings → Gastronomic Events ³⁰	italian cuisine ⁷³ snack ²⁹¹⁶ coffee ³⁸³⁸ wine ⁴⁴⁷⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
bolkedebeer.nl	Bolke de Beer Catering and Snacks Zaandam	The website of Bolke de Beer Catering and Snacks Zaandam offers professional catering services and a selection of snacks and meals, focusing on providing solutions for events and complete meal arrangements.	Quick Bites → Snack Bar ⁵⁸⁰	rib ¹⁹¹ meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Zaanstad → Zaandam ²⁷⁴⁰
dutchbakery.nl	Dutch Bakery	The Dutch Bakery website showcases their range of bread and snack products, with a focus on promoting enjoyable meals and offering products that are easy to bake at home.	Personal Websites → Family ¹⁹¹ Bakery & Food Production → Bread ⁷⁶⁵	puff pastry ¹² baking ¹¹⁹ cozy ²²⁷ bread ¹⁶²² snack ²⁹¹⁶
bouhofhoreca.nl	Bouhof	The website of Bouhof is a wholesaler specializing in products for the hospitality industry.	Kitchenware → Tableware ⁴²⁶ Dogs → Supplies ¹⁰⁰⁵	cleaning supplies ¹⁴⁰ tableware ⁶¹³ packaging ²²³⁶ snack ²⁹¹⁶ hospitality ³⁴⁹¹ equipment ⁴¹⁴³
bmlfoodgroup.nl	BML Food Group Holland BV	BML Food Group's website showcases their brand offering authentic and innovative frozen shrimp, fish, and snack products, focusing on sourcing quality from certified factories.	Restaurants & Dining → Seafood Restaurants ⁶¹² Food & Beverage → Food Industry ⁸³⁵	shrimp ²¹⁹ factory ⁵²⁶ packaging ²²³⁶ snack ²⁹¹⁶ brand ¹⁷⁷³⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
petsfish.nl	PetsFish	PetsFish is a company specializing in the production of high-quality, sustainable fish snacks for dogs and cats.	Pet Food → Dog Food ³²¹	sustainable ⁷³⁹ fish ¹¹²¹ snack ²⁹¹⁶ production ⁴⁵⁸² dog ⁵⁴⁸³	Flevoland → Urk ⁷⁶²
madmollysirishpub.nl	Mad Mollys Irish Pub	Mad Molly's Irish Pub is a traditional Irish pub located in the center of Breda, Holland, offering live sports and music.	Performance → Live Music ¹⁶¹² Bars & Pubs → Bars ¹⁹³⁸	live music ¹²⁹ pub ¹⁸⁵ snack ²⁹¹⁶ party ⁵⁹²⁸	North-Brabant → Breda ⁹⁰⁰³
frietpanters.nl	Friet Panters	Friet Panters is a french fry restaurant in Breda that offers fresh fries and artisanal snacks.	Quick Bites → Cafeteria ⁹⁰⁶ Cooking & Recipes → Cuisine ¹¹⁴⁷	foodtruck ⁶¹³ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ interior ⁸⁰⁹³ event ⁴⁵¹⁹⁹	North-Brabant → Breda ⁹⁰⁰³
wijcknijmegen.nl	Lunch café Wijck	Lunch café Wijck is a café that offers a place for coffee, lunch, and drinks, with a focus on a cozy atmosphere and fresh, daily products.	Mediterranean & Middle Eastern → Spanish Restaurants ²¹⁴	platters ⁵⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Nijmegen → Nijmegen-Old-West ²⁴
stephaniesbierwereld.nl	Stephanie's Bierwereld	The website of Stephanie's Bierwereld offers customized beer tasting experiences, hosted by a Biersommelier, with accompanying snacks, primarily targeted at groups in the Ronde Venen and Uithoorn region.	Beverages → Beer ¹⁰⁹⁵ Culinary & Tastings → Beer Tasting ⁹¹	beer tasting ⁴⁷ instagram ¹²¹⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶	North-Holland → Haarlem ⁸⁶⁷⁴
joannusmolen.nl	Joannusmolen	The website of Joannusmolen is an online platform focused on the production and sale of organic extrusion snacks, breakfast cereals, and wafers, both under its own brands and as private label products for various target groups.	Healthy Eating → Organic Food ²¹⁹ Wholesale → Food Products ³⁰³	raw materials ⁴⁴⁶ organic ⁴⁷¹ snack ²⁹¹⁶ production ⁴⁵⁸² recipe ⁵¹⁴² brand ¹⁷⁷³⁷
wijnbardeavonden.nl	Bistro Wijnbar De Avonden	Bistro-Wijnbar De Avonden is a cozy wine bar in Rotterdam offering a wide variety of wines, beers, cocktails, snacks, and meals from across Europe.	Bars → Wine Bars ¹⁷⁰ Themed Events → Special Events ²³	wednesday ²⁰ cocktail ⁹²⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ party ⁵⁹²⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
swaentjerotterdam.nl	Gieterij 't Swaentje	Gieterij ‘t Swaentje is a brown café in Rotterdam that serves as a welcoming public space for diverse individuals to gather and socialize.	Cafes → Brown Cafés ⁵⁹⁹	café ⁹⁴⁴ visitors ¹⁰⁴⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹	Rotterdam → North ³³²
doggysfriend-shop.nl	Doggy's friend natuurwinkel	Doggy's friend natuurwinkel is an online pet store specializing in providing natural and organic products for pets, primarily dogs.	Pet Food → Dog Food ³²¹ Pet Stores → Online Pet Stores ¹⁶	butter ⁶¹ basket ²⁷⁵ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² care ¹²³³⁸
epicerienl.nl	Epicerie NL	The website is an online store specializing in gourmet and delicatessen products.	Dairy & Cheese → Delicatessens ⁶¹⁷	gourmet ⁴⁰ olive oil ³⁴⁶ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ gift ⁶⁴⁴²	Nissewaard → Zuidland ¹⁸¹
greatindianflavours.nl	Great Indian Flavours	Great Indian Flavours is a business offering catering services and selling Indian snacks, sweets, and powders.	Chocolate & Sweets → Sweets ²⁵⁷ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	pickles ¹² powder ⁹⁸ sweets ²²⁹ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Gelderland → Tiel ¹⁶⁶²
keetjespro.nl	Keetjes Pro	Keetjes Pro is a wholesale supplier focused on professionals in the animal industry, offering a wide range of natural dog food, snacks, and care products.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	dog food ²⁰⁴ dealership ²⁹² snack ²⁹¹⁶ care ¹²³³⁸
sweetsandgifts.nl	Sweets&Gifts B.V.	The Sweets&Gifts webshop offers a wide assortment of sweets, chocolate, snacks, and gifts.	Chocolate & Sweets → Chocolate ⁵⁸⁷	sweets ²²⁹ chocolate ⁹¹¹ box ¹⁹⁸² snack ²⁹¹⁶ drink ⁵¹⁹¹ gift ⁶⁴⁴²
eg-catering.nl	E&G Partyverzorging	E&G partyverzorging offers catering services for various events and occasions.	Fast Food → Fries ⁹⁴⁹	meal ¹⁶³⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
mijnhondenvoer.nl	Mijnhondenvoer B.V.	Mijnhondenvoer.nl is an online shop offering dog and cat food, supplements, and snacks with the option for home delivery through a pet store.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	cat food ⁹⁸ dog food ²⁰⁴ supplement ¹⁹⁶⁸ ingredients ²³⁴⁶ snack ²⁹¹⁶ blog ¹³³⁹²
delibert.nl	Delibert	The Delibert website is an online platform where customers can order sandwiches, lunch, and catering in and around Rotterdam. The company offers fresh and homemade products, including breakfast, fruit, salads, sandwiches and catering for events.	Cafes & Lunch → Lunch Restaurants ⁶⁰ Sandwiches & Salads → Snacks ⁶⁹³	lunch ¹⁵³⁴ breakfast ¹⁸²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
sterkfood.nl	Sterk Seafood b.v.	Sterk Seafood is a wholesale office and importer of frozen fish, and also produces high-quality finished products.	Wholesale → Fish Wholesalers ¹⁵ Restaurants & Dining → Seafood Restaurants ⁶¹²	shellfish ⁴⁶ fish ¹¹²¹ snack ²⁹¹⁶ production ⁴⁵⁸² assortment ⁷⁷⁹⁹	De Fryske Marren → Lemmer ¹¹⁸⁸
naturedogfood.nl	Nature Dog Food	The website offers natural and hypoallergenic dog food and snacks, focused on the well-being of dogs with sensitive systems.	Pet Food → Dog Food ³²¹ Health → Animal & Veterinary ³⁹⁰	wet food ¹² kibble ⁴⁶ allergy ²⁵⁴ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
bilal.nl	Bilal Group	The website of Bilal Group is an online platform providing information and products related to halal food production, particularly poultry products, snacks, and seafood, and their distribution in the Netherlands and Europe.	Wholesale → Food Wholesalers ²⁴ Supermarkets & Grocery → Butchers ⁷⁴⁷	seafood ¹⁴⁸ poultry ¹⁸⁰ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ production ⁴⁵⁸²
snackbarpontje.nl	CeLa Design	The website of 't Pontje Snackbar in Valkenburg provides information about its snack and fries offerings, contact details, and opening hours.	Quick Bites → Snack Bar ⁵⁸⁰	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Valkenburg aan de Geul → Valkenburg ⁹²²
beachbarmarnemoende.nl	Beachbar Marnemoende	The website of Beachbar Marnemoende presents a beach bar located on the Hollandsche IJssel, where visitors can relax, eat and drink, and organize events.	Event & Party Venues → Beach Restaurants ²¹⁰ Water Sports → Water Recreation ⁵⁹⁹	sunset ⁶² bar ¹²¹⁶ snack ²⁹¹⁶ beach ³²¹⁰ drink ⁵¹⁹¹ party ⁵⁹²⁸	South-Holland → Hollandsche IJssel ⁴⁸
chewiesdierenwinkel.nl	Chewies XL Dierenwinkel	The website of Chewies XL Dierenwinkel offers a wide range of pet food, accessories, and care products for dogs and cats.	Essential ²⁴¹⁰¹⁶	animal ²⁹⁰⁸ snack ²⁹¹⁶ food ³⁸⁷² ship ⁵¹⁰³ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
snackbarbinnenburg.nl	Snackbar Binnenburg / Chinees Afhaal Binnenburg	Snackbar Binnenburg / Chinees Afhaal Binnenburg is a restaurant in Den Burg offering both snack food and Chinese takeaway meals.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Asian ²⁷²³	chinese ⁶⁸ rice ⁶³⁵ sauce ¹¹⁴¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Texel → Den Burg ¹⁸⁴
divinebites.nl	Divine Bites	Divine Bites is an online retailer specializing in luxury Indian mithai (sweets), Ayurvedic wellness blends, and handmade snacks, offering gift boxes and spice blends.	Alternative Medicine → Ayurveda ²⁸¹ Chocolate & Sweets → Sweets ²⁵⁷	gift box ²⁴³ ayurveda ³⁰¹ snack ²⁹¹⁶ recipe ⁵¹⁴²
pizzeriadellachef.nl	Della Chef Veenendaal	The website of Della Chef Veenendaal is an online platform where customers can order snacks, pizzas, dishes, and breads for home delivery or takeaway.	Career → Job Postings ¹⁸⁰	snack ²⁹¹⁶ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → Veenendaal ²⁶⁴¹
lafontana-leerdam.nl	LA FONTANA LEERDAM	La Fontana Leerdam is an online restaurant in Leerdam where customers can order food and snacks for delivery.	Fast Food → Fries ⁹⁴⁹ Online Ordering → Delivery Restaurants ⁷²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Vijfheerenlanden → Leerdam ⁶⁷²
speeddate.nl	Speeddate Specialist DatingNight	The website is a specialist in speed dating in the Netherlands, organizing events in various cities. The goal is to facilitate introductions for singles in a friendly and informal environment.	Dating → Speed Dating ²² Tourism → City Tours ⁴⁶⁸	speeddate ⁵³ singles ¹⁴⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
zainabfoods.nl	Zainab Foods	Zainab Foods is a Surinamese company that produces and sells authentic Surinamese snacks and meals.	Wholesale → Food Products ³⁰³ Food & Diet → Food Production ¹⁹⁸	roti ³⁰³ snack ²⁹¹⁶ innovation ⁴⁶⁵⁹
cafetaria-delicious.nl	Cafetaria Delicious	Cafetaria Delicious is an online shop and takeaway restaurant in Dordrecht offering various meals, snacks and drinks.	Quick Bites → Snack Bar ⁵⁸⁰ Web → Websites ²⁰²⁸	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Dordrecht ⁴⁵³¹
wijnbarvintage.nl	Wijnbar Vintage	Wijnbar Vintage is a wine bar located in the Gooi offering a selection of over 100 open wines, accompanying snacks, and a pleasant atmosphere.	Bars → Wine Bars ¹⁷⁰	snack ²⁹¹⁶ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷	Gooise Meren → Bussum ²²⁰¹
gezond-tussendoortje.nl	Gezond-tussendoortje.nl	The website Gezond-tussendoortje.nl provides inspiration, recipes, and tips for healthy snacks, with the goal of helping visitors lose weight and eat healthier.	Healthy Food → Snacks ²²	diet ⁷⁴⁷ tips ²⁷⁸⁹ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ recipe ⁵¹⁴² blog ¹³³⁹²
cafetariadebulldog.nl	Cafetaria de Bulldog	Cafetaria de Bulldog is a snack bar in Waddinxveen offering delivery, takeaway options, and catering services.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶	South-Holland → Waddinxveen ¹⁰⁴⁶
barvangogh.nl	Bar van Gogh	Bar van Gogh is a bar and restaurant in the Netherlands that organizes various tastings and events, including wines, beers and whisky, as well as special dinners.	Bars → Beer Bars ³⁵ Culinary & Tastings → Gastronomic Events ³⁰	mashed potato ¹⁰ whisky ³⁷³ taste ⁹³³ bar ¹²¹⁶ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
degroenepeper.nl	De Groene Peper	Catering regio Rotterdam - Eerlijk & Heerlijk is a catering company based in Rotterdam that provides a wide range of food services for various occasions.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Gluten-Free ⁴¹	gluten-free ¹⁵⁶ vegan ⁵⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
bbeesz.nl	bbeesz.nl	The Bbeesz.nl website provides information and inspiration for parents regarding the care, feeding, and development of babies and toddlers, with a focus on loving care and healthy nutrition.	Nutrition → Baby Nutrition ¹⁰	baby ¹⁸⁹⁵ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ recipe ⁵¹⁴² blog ¹³³⁹²
partycentrumdemolenhelmond.nl	Partycentrum ‘De Molen””	Partycentrum De Molen in Helmond is a versatile event venue offering various facilities, including a café, hall, and spaces for meetings and weddings.	Venues → Party Venues ³⁶³ Conferences & Meetings → Meeting Venues ⁷²⁹	cafe ¹⁶²² hall ¹⁷⁸⁶ snack ²⁹¹⁶ space ³⁸⁴⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	North-Brabant → Helmond ³⁰⁵⁸
cafetariainkies-rotterdam.nl	Cafetaria Inkie's	The website of Cafetaria Inkie's provides an online ordering system for dishes from the cafeteria in Rotterdam. Visitors can view the menu and easily place orders.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetariabornerbroek.nl	Cafetaria Bornerbroek	The website of Cafetaria Bornerbroek in Bornerbroek offers an online ordering platform for fries, snacks, and other dishes, with home delivery options.	Websites → Travel ²³ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² dish ⁵⁹³⁶ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶	Almelo → Bornerbroek ⁹⁰
bierpreuvenement.nl	Bier Preuvenement Zevenaar	The website provides information about the annual Beer Tasting Event in Zevenaar.	Beer → Breweries ³³⁷ Festivals → Beer Festivals ¹⁷⁵	brewery ⁴⁹⁸ ticket ²⁷⁸⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Gelderland → Zevenaar ¹⁵⁰⁸
proefparade.nl	Vlinderfestival Reigersbergen	The Vlinderfestival, celebrating the 25th anniversary of the Vlindertuin Reigersbergen, offers a day of activities centered around the nettle plant, including live music, workshops, tours, and local products.	Animal Encounters → Zoos ¹¹⁴	butterfly ¹⁴⁰ tour ²³¹⁵ snack ²⁹¹⁶ music ¹³¹⁷⁰ workshop ¹⁹³²⁵	The Hague → Haagse Hout ³⁴⁷
snackpointkieentj.nl	Snackpoint Kieëntj	The Snackpoint Kieëntj website is an online ordering platform for food and drinks, featuring promotional activities such as a prize wheel and lotteries.	Websites → Ordering Sites ⁷⁵	prize wheel ⁴⁰² promotion ²⁰⁶² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Limburg → Weert ²⁰³⁰
snackbar-dekolk.nl	Plaza de Kolk	The Plaza de Kolk website is a cafeteria in Bakkeveen catering to all ages, offering a wide variety of food and drinks, including fries, snacks, complete meals, burgers, salads, sandwiches, and ice cream.	Quick Bites → Cafeteria ⁹⁰⁶ Children’s Activities → Playgrounds ⁷⁰²	playground ¹⁰⁸⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶	Opsterland → Bakkeveen ¹⁰⁷
deheerijsensnacks.nl	de Heer IJs & Snackspecialiteiten	The website of de Heer IJs & Snacks presents the assortment of ice cream, snacks, and catering services in Winterswijk.	Quick Bites → Food Trucks ⁶²³ Chocolate & Sweets → Ice Cream ⁷⁷⁴	ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Gelderland → Winterswijk ¹²²¹
frederikambachtelijkefriet.nl	Frederik IJmuiden	Frederik Ambachtelijke Friet is a fast-food restaurant in IJmuiden that offers fresh, traditionally prepared fries, snacks, and sandwiches.	Bakery & Food Production → Bread ⁷⁶⁵ Local Events → Markets ¹⁰⁹⁷	traditional ⁴¹ potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Velsen → IJmuiden ¹¹⁰⁹
jpversepatat-hellevoetsluis.nl	JP Verse Patat	The website JP Verse Patat allows customers to order fresh fries, snacks, and various sides online for delivery or pickup in Hellevoetsluis.	Quick Bites → Hair Salon ¹¹²	beverage ⁵⁸⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Voorne aan Zee → Hellevoetsluis ⁹⁷²
bella-vesting.nl	Bella Vesting	The Bella Vesting website allows customers to order food and snacks online for delivery. The website presents a comprehensive menu including hamburgers, fries, snacks, and a children's menu.	Food Delivery → Delivery ²²²⁷ Restaurants & Dining → Fries Kiosks ³³	menus ²²¹ hamburger ³⁶⁴ beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Voorne aan Zee → Hellevoetsluis ⁹⁷²
sportcafedemeerkamp.nl	Sportcafé De Meerkamp	Sportcafé De Meerkamp is a recreation café in Amstelveen offering swimming, food, and party options for all ages.	Garden → Swimming Pools ⁶⁰¹	swimming pool ¹⁶⁶⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ opening hours ²⁹⁵³ coffee ³⁸³⁸ party ⁵⁹²⁸	North-Holland → Amstelveen ³¹⁸⁰
dollydimple.nl	Dolly Dimple Haulerwijk	The website of Dolly Dimple in Haulerwijk provides the opportunity to order and have delivered fries and snacks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Ooststellingwerf → Haulerwijk ¹⁰³
hetbikkertje.nl	't Bikkertje	Snackbar ’t Bikkertje is a long-established snack bar located in the center of Ugchelen offering a variety of snacks and sandwiches.	Quick Bites → Snack Bar ⁵⁸⁰ Events → Places ¹²¹⁹	ice cream ¹⁰⁰⁰ bar ¹²¹⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Apeldoorn → Ugchelen ¹⁹⁷
tokobagoes.nl	Toko Bagoes	Toko Bagoes is an Indonesian restaurant and takeaway in Doetinchem that offers Indonesian snacks, rijsttafels (rice tables), and buffets.	Food Delivery → Indonesian ⁵⁰² Restaurants & Dining → Takeaway Restaurants ²⁴⁰	rijsttafel ⁴⁷ takeaway ⁶⁵³ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	Gelderland → Doetinchem ²⁷⁰⁶
seabites.nl	Seabites	Seabites is a company that produces and sells delicious snacks made from fish from the North Sea, offering a local and convenient alternative to traditional fish products.	Essential → Food ⁴⁷⁹⁹⁹	north sea ⁸⁷ fish ¹¹²¹ snack ²⁹¹⁶ order ⁶⁹¹²	Velsen → IJmuiden ¹¹⁰⁹
dewaterkantstappegoor.nl	De Waterkant	De Waterkant is a restaurant located next to the Stappegoor Recreation Pool in Tilburg, offering food and drinks.	Swimming → Pools ³¹⁰ Family & Themed Dining → Family Restaurants ¹⁶⁹	pool ¹⁵³² snack ²⁹¹⁶ party ⁵⁹²⁸ restaurant ¹¹²¹⁵	North-Brabant → Tilburg ⁸⁷⁵⁹
devriendenheerlen.nl	De Vrienden Heerlen	De Vrienden Heerlen is a meeting place for people of all ages.	Bars & Pubs → Bars ¹⁹³⁸ Brasseries & Bistros → Bistro ⁵⁹⁴	gathering ³⁹⁴ dinner ¹⁵³³ lunch ¹⁵³⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Limburg → Heerlen ²⁷⁵⁵
cafetaria-franka.nl	Cafetaria Franka	Cafetaria Franka’s online webshop allows customers to order a variety of snacks, sandwiches, fries, and drinks for takeout or delivery in the region.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Velsen → Santpoort-Noord ⁶⁰⁶
ntip.nl	Café 'n Tip	Café 'n Tip is an eetcafé and cafetaria in Daarle offering a variety of services including snack and meal sales, catering for events, and a daily meal service.	Quick Bites → Cafeteria ⁹⁰⁶ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	meal service ⁶⁵ café ⁹⁴⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Hellendoorn → Daarle ⁵⁸
smulhoekje-tiel.nl	t Smulhoekje	't Smulhoekje Tiel is an online snack bar where customers can order snacks and meals for delivery or pickup.	Local & Regional Products → Foreign Cuisine ¹⁹	pickup ⁷³⁶ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
delekkeredingenbakker.nl	The Lekkere Dingen Bakker	The Lekkere Dingen Bakker is a bakery that sells a wide variety of bread, snacks, and pastries.	Bakery & Food Production → Bread ⁷⁶⁵ Pastries & Baked Goods → Pastry ¹²¹⁰	bakery ⁷¹⁸ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶ store ³⁹⁰¹ assortment ⁷⁷⁹⁹
lafresh.nl	La Fresh	La Fresh is a chip shop located in Leiden specializing in the offering of fresh, hand-cut fries, snacks, and coffee, emphasizing quality and local ingredients.	Quick Bites → Snack Bar ⁵⁸⁰	potato ⁵⁴² oil ⁹⁷⁰ cheese ¹²⁰⁵ fries ²⁷⁵³ snack ²⁹¹⁶	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
friturekonings.nl	Friture Konings	The website of Friture Konings is a fast-food restaurant in Tegelen, Limburg, specializing in the sale of fries, snacks, sandwiches, and beverages. The website’s purpose is to inform customers about opening hours, the menu, and the location.	Quick Bites → Cafeteria ⁹⁰⁶ Internet → Food Retailers ¹⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Venlo → Tegelen ³²⁴
cafetaria-grill-aboe.nl	Cafetaria Grill Aboe	The website of Cafetaria Grill Aboe in Eindhoven offers the possibility to order Turkish and Dutch dishes, such as grilled meat and snacks, for pickup or delivery.	Fast Food → Fries Restaurants ⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
dik-en-lang-verse-vlaamse-friet-eindhoven.nl	Dik en Lang Verse Vlaamse Friet	The website of Dik en Lang Verse Vlaamse Friet is an online platform where customers in Eindhoven can order meals. It offers a comprehensive menu with fries, snacks, vegetarian options, burgers, and various sauces and drinks.	Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
mamacafedelft.nl	Mamacafe Delft	Mamacafe Delft is a website that provides information and suggestions for parents with children, including information about outings, healthy food, and practical parenting tips.	Family Fun → Children’s Activities ¹⁹⁰⁶ Family → Parents ⁵²⁵	diaper bag ⁴³ outing ⁹⁸² snack ²⁹¹⁶
petalsandpals.nl	Urban Hotel The Golden Stork	Petals and Pals is a restaurant in Rijswijk, Netherlands, offering shared snacks, comfort food classics, and Instagrammable cocktails. It’s located in Urban Hotel The Golden Stork and is known for its homemade dishes and free parking.	Food Delivery → Indonesian ⁵⁰²	cocktail ⁹²⁵ burger ¹⁴³¹ beer ²⁸⁸⁷ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵	South-Holland → Rijswijk ²⁰⁵⁴
peysdoggyfood.nl	Peys Doggyfood B.V.	Peys Doggyfood B.V. is a wholesale company specializing in the distribution of frozen food and BARF products to pet stores in the Netherlands and Belgium.	Animals → Pet Food ⁵⁸⁴ Pet Supplies → Pet Nutrition ¹⁸	barf ¹¹ pet store ⁴⁷ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
cafetaria-t-vosje-groningen.nl	Cafetaria 't Vosje Groningen	Cafetaria 't Vosje Groningen is an online platform allowing customers to view menus and order dishes from the Groningen-based cafetaria online.	Quick Bites → Cafeteria ⁹⁰⁶ Grilling & Steaks → Grillroom ⁸⁷	shoarma ²⁵⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
rjjcatering.nl	RJJ Catering	RJJ Catering is a catering company offering various services, including home catering, meal delivery, snacks, and event catering.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	snack ²⁹¹⁶ partner ⁴²⁷² catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Westerwolde → Vriescheloo ³²
3linden.nl	Herberg De Drie Linden	The website of Herberg De Drie Linden and Dorpscafé Bij Baans presents the locations and offers information about the facilities, opening hours, and possibilities for parties, dinners, and other events.	Hotels → Country Hotels ¹²² Conferences & Meetings → Meetings ²⁹⁵	inn ⁸² farmhouse ⁸⁷⁸ snack ²⁹¹⁶ party ⁵⁹²⁸ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Gilze and Rijen → Molenschot ⁷⁶
bierhalle.nl	Bierhalle Grou	Bierhalle Grou is a traditional brown café located in the center of Grou, offering food, drinks, and a social atmosphere.	Cafes → Brown Cafés ⁵⁹⁹	coziness ²³⁵ billiard ³⁴¹ pool ¹⁵³² cafe ¹⁶²² snack ²⁹¹⁶ drink ⁵¹⁹¹	Leeuwarden → Grou ³⁶⁶
blinifood.nl	Blini Hospitality Catering	Blini Catering & Events is a company that provides catering and event organization services in and around Venlo.	Communication → Presentations ³⁴⁵ Business & Professional → Speakers ¹⁶⁵	happiness ⁶⁵³ presentation ¹⁷⁸⁵ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Limburg → Venlo ⁴¹⁵⁸
bij-bram.nl	Bij Bram	The website of ‘Bij Bram’ is a cafe located in Utrecht offering a variety of snacks, dishes, beers, and wines.	Cuisine → Dutch Cuisine ¹⁷⁹ Beverages → Beer ¹⁰⁹⁵	sinterklaas ⁴⁵⁶ dinner ¹⁵³³ cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
debeemdweert.nl	Cafetaria de Beemd	Cafetaria de Beemd is a cafe in Weert that offers freshly prepared snacks and meals, with the option for online ordering and takeaway.	Asian → Chinese ⁴¹⁵ Quick Bites → Cafeteria ⁹⁰⁶	peanut sauce ²⁵ eating ⁸³ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Weert ²⁰³⁰
ty-le.nl	Ty-Le	Ty-Le is a family-run business that has been producing and supplying high-quality Asian snacks since 1981, primarily known for its Vietnamese spring rolls.	Distribution → Food Distribution ¹⁵ Coffee & Tea → Specialties ¹⁶⁴	spring roll ⁸² snack ²⁹¹⁶ hospitality ³⁴⁹¹ recipe ⁵¹⁴² assortment ⁷⁷⁹⁹
rfvending.nl	R&F Vending	The website offers vending machines and related services, including custom solutions and full service maintenance.	Beverages → Soft Drinks ⁹² Metalworking → Machines ³⁰⁷	vending machine ¹²⁷ beverage ⁵⁸⁶ snack ²⁹¹⁶ machine ³⁷²⁷
grillhuispaddepoel.nl	Grillhuis Paddepoel	Grillhuis Paddepoel is a restaurant located in Groningen that offers meals, BBQ, gourmet, snack platters and other dishes, including homemade mashed potatoes and rice dishes.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Outdoor → Barbecues ⁷⁴⁴	bbq package ²⁴ gourmet ⁴⁰ sausage ²⁵⁶ bbq ⁹⁰⁸ meal ¹⁶³⁸ snack ²⁹¹⁶	Netherlands → Groningen ²³⁷³⁴
perron1.nl	Perron 1 Kampen	Perron 1 Kampen is a location at the Kampen train station that sells drinks and food with a focus on quality and sustainability.	Trains → Stations ⁴⁸	station ⁴²⁰ tea ¹¹⁴⁶ snack ²⁹¹⁶ coffee ³⁸³⁸ sustainability ¹⁸⁴⁵¹	Overijssel → Kampen ²¹⁶¹
vleesenvega.nl	Vlees & Vega	Vlees & Vega is an online store that sells meat, vegan products, meat products, healthy meals, and snacks.	Supermarkets & Grocery → Online Supermarkets ⁵³ Food → Meat ¹¹²³	vegan ⁵⁰⁸ meal ¹⁶³⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶
lasergamecoevorden.nl	Lasergame Coevorden	Lasergame Coevorden is a location in Coevorden that offers laser games and various packages for groups, families, and individuals.	Outdoor Activities → Laser Tag ⁴³ Parties → Bachelor Parties ¹²²	laser tag ²⁸ arena ¹²⁴ beverage ⁵⁸⁶ snack ²⁹¹⁶ package ⁶¹¹²	Drenthe → Coevorden ¹⁴⁹²
degraafpetfood.nl	de Graaf petfood b.v.	De Graaf Petfood is a family-run business that has been supplying high-quality food for dogs and cats since 1962, with a focus on fair trading and animal welfare.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	mvo ⁶¹ snack ²⁹¹⁶ food ³⁸⁷² transport ⁶¹⁰⁵ assortment ⁷⁷⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
cafetariadebank.nl	Cafetaria de Bank	Cafetaria de Bank is a fast-food restaurant in Esbeek that serves fresh fries, artisanal snacks, and hamburgers.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
huntershomegroup.nl	Huntershome Hondenvoer	Huntershome Hondenvoer offers a wide range of dog food, cleaning products, and snacks, and delivers them throughout the Netherlands.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	dog food ²⁰⁴ snack ²⁹¹⁶ ship ⁵¹⁰³ dog ⁵⁴⁸³ webshop ⁸⁶⁴⁸	North-Brabant → Roosendaal ²⁶⁷⁷
nicefoodhouse.nl	Nice Food House	The website of Nice Food House presents a traditional sandwich shop with locations in Delfzijl and Groningen, offering fresh and high-quality sandwiches, salads, and snacks.	Sandwiches & Salads → Sandwich Shops ²²⁹ Events → Places ¹²¹⁹	bread ¹⁶²² ingredients ²³⁴⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Eemsdelta → Delfzijl ⁶¹⁵
tokoina.nl	Toko Ina	Toko Ina is a shop in Gouda that offers Indonesian dishes, meals, and ingredients, specializing in authentic Javanese flavors and catering services.	Food Delivery → Indonesian ⁵⁰² Restaurants & Dining → Takeaway Restaurants ²⁴⁰	indonesian cuisine ⁴⁶ rijsttafel ⁴⁷ ingredients ²³⁴⁶ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	South-Holland → Gouda ³⁵²¹
bakkerakershoek.nl	Bakkerij Akershoek	The website of Bakkerij Akershoek is an online shop where customers can order bread, pastries, and special cakes for pickup or delivery.	Bakery & Food Production → Bread ⁷⁶⁵	pickup ⁷³⁶ pastries ⁹⁴⁶ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶	Goeree-Overflakkee → Goedereede ⁸⁷
desmul.nl	De Smul	The website of Cafetaria & Lunchroom De Smul presents the menu, catering options, and opening hours of a cafeteria and lunchroom located in Oeffelt, which has been a popular destination since 1963.	Quick Bites → Cafeteria ⁹⁰⁶ Outdoor → Terraces ¹⁸⁸	ice ¹⁷⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Land van Cuijk → Oeffelt ⁹⁶
dekroeginloenen.nl	The Kroeg in Loenen	The Kroeg in Loenen is a hospitality venue offering a diverse range of activities and drinks and food options.	Cafes → Brown Cafés ⁵⁹⁹ Quick Bites → Cafeteria ⁹⁰⁶	billiard ³⁴¹ ice cream ¹⁰⁰⁰ meeting ²³⁸¹ snack ²⁹¹⁶ drink ⁵¹⁹¹	Apeldoorn → Loenen ²²⁰
snackcentrum-groningen.nl	Snackcentrum	The Snackcentrum website in Groningen offers the possibility to order food online, with a comprehensive menu including fries, snacks, sandwiches, vegetarian options, drinks, and milkshakes.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Takeaway ⁴⁰⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
ondertduin.nl	Onder 't Duin	Onder 't Duin is a cafeteria located in West-Terschelling that serves a variety of sandwiches, snacks, and dishes.	Quick Bites → Cafeteria ⁹⁰⁶ Beach → Beach Facilities ³⁶	kibbeling ¹¹⁵ chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Terschelling → West-Terschelling ¹¹⁴
brelamersfoort.nl	BREL	The website of BREL presents a wine bar and lounge in Amersfoort, offering a pleasant experience with an extensive selection of wines, whiskeys, and luxury snacks, as well as options for event organization.	Wine → Wine Tasting ⁷³⁰ Bars → Wine Bars ¹⁷⁰	whiskey ⁷⁸ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ event ⁴⁵¹⁹⁹	Utrecht → Amersfoort ⁸⁰¹¹
verrevanverre.nl	Verre van Verre	Verre van Verre is a catering company based in Leiden that offers vegetarian, vegan, and other dishes and snacks.	Quick Bites → Food Trucks ⁶²³ Produce & Vegetables → Vegetables ¹⁰⁷⁰	buffet ¹⁷⁴⁷ salad ²⁴⁴⁴ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	South-Holland → Leiden ⁷⁰⁸⁹
mola.nl	Mola	The website of Mola presents the company as a specialist in bake-off products, with a focus on industrial bakery products, both sweet and savory. The site also offers information about the company, vacancies and contact details.	Jobs → Vacancies ¹⁰⁹⁹ Food & Beverage → Food Industry ⁸³⁵	puff pastry ¹² flavor ¹⁰³² snack ²⁹¹⁶ production ⁴⁵⁸² vacancy ⁶⁵⁹⁸	Land van Cuijk → Beugen ¹⁰²
anderhalfbar.nl	Anderhalf Bar	Anderhalf Bar is a bike bar and rental company located in Ede, Netherlands, that combines cycling adventures with coffee and snacks, and offers guided bike tours in the South Veluwe area.	Cycling → Cycling Routes ¹⁰⁰² Cycling → Bicycle Rental ⁶⁴³	bike ¹⁵⁴¹ snack ²⁹¹⁶ route ³⁴²⁵ coffee ³⁸³⁸ rental ⁷²⁵⁷	Amsterdam → South ¹⁴⁸⁸
proeflokaal-dekruis.nl	Proeflokaal De Kruis	Proeflokaal De Kruis is a restaurant and bar located near the Zaanse Schans offering a variety of drinks, snacks and meals.	Bars → Pubs ⁵⁴⁶ Context ¹⁶¹³⁹⁴	chef ⁶³¹ dinner ¹⁵³³ beer ²⁸⁸⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶	Zaanstad → Zaandijk ²¹⁴
reinerinksvis.nl	Reinerink's Vis	The website of Reinerink's Vis presents the company and its assortment of fish and snacks sold at various markets and locations in the Twente region. The goal is to inform visitors about the locations of the stands and the offerings.	Local Events → Markets ¹⁰⁹⁷ Business & Professional → Trade Shows ⁹⁵¹	stand ²⁹⁴ fish ¹¹²¹ market ²⁷⁷² snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Twenterand → Vriezenveen ⁴⁸⁷
helmondsfriethuys.nl	Cashdesk	Helmonds Friethuys is a fast-food restaurant in Helmond that sells fries, hamburgers, snacks, and other fresh products, both for takeaway and delivery.	Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
cateringgennep.nl	Cateringgennep	The website ‘Cateringgennep’ offers a wide assortment of gifts and snacks, including chocolate, coffee, nuts, candy, and teas.	Chocolate & Sweets → Chocolate ⁵⁸⁷ Nutrition & Diet → Natural ¹⁶	chocolate ⁹¹¹ tea ¹¹⁴⁶ snack ²⁹¹⁶ gift ⁶⁴⁴²
broodjeextra.nl	Broodje Extra	The website of Broodje Extra in Valkenswaard offers filled sandwiches, corporate lunches, catering, and shaved ice, focusing on quality and customization.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	North-Brabant → Valkenswaard ¹¹⁷⁹
cafetariafriendsharderwijk.nl	Cafetaria Friends Harderwijk	Cafetaria Friends Harderwijk is an online ordering platform for meals and snacks in Harderwijk, where customers can order their favorite meals online and enjoy them quickly.	Quick Bites → Cafeteria ⁹⁰⁶	satay ³²⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Harderwijk ²²⁴⁰
tantelieksnacks.nl	Tante Liek Snacks	Tante Liek Snacks is a horeca (restaurant supply) supplier that provides exclusive snacks to hospitality businesses in the Netherlands.	Hospitality → Suppliers ¹⁰⁵⁷ Vegetables → Potatoes ¹⁰⁰	horeca ¹¹⁵ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹
snackenbroodjeshuisjongman.nl	Snack- and Bread House Jongman Assen	Snack- and Bread House Jongman Assen is a cafeteria in Assen that offers a variety of snacks, burgers, sandwiches and drinks, with a focus on homemade products.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	online order ⁷¹ milkshake ¹⁹⁵ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Drenthe → Assen ³⁵¹⁶
dewittebaron.nl	Cafetaria De Witte Baron	The website of Snackbar De Witte Baron presents a snack bar and cafeteria aimed at residents of Tweede Exloërmond and surrounding areas, with a focus on takeaway meals and snacks of high quality.	Quick Bites → Cafeteria ⁹⁰⁶ Activities → Dining Out ¹⁸¹	whatsapp ³⁸² fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Borger-Odoorn → Odoorn ¹⁰⁴
spetterenpaintroom.nl	Spetter & Paint Room	The Spetter & Paint Room in Rotterdam offers creative activities with UV paint in a blacklight environment, catering to both individual and group bookings.	Conceptual & Interactive Art → Art Forms ⁴⁹²	session ¹⁷⁹¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ paint ⁸⁷⁴⁷	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-kerklaan.nl	Cafetaria Kerklaan	The website of Cafetaria Kerklaan in Groningen offers an online ordering system for dishes such as fries, sandwiches and snacks. It informs visitors about the menu, reviews and the possibility to sign up for a newsletter.	Websites → Restaurant Websites ¹⁴ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
cafetariaderietlanden.nl	Cafetaria de Rietlanden	Cafetaria de Rietlanden is a cafe located in Grijpskerk offering a wide range of snacks, fries, and coffee.	Quick Bites → Snack Bar ⁵⁸⁰ Coffee & Tea → Beverages ⁴⁴⁵³	pancakes ⁵⁶⁸ meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸	Berg en Dal → Groesbeek ⁶⁵³
koperenhemel.nl	Restaurant Koperen Hemel	The website of Restaurant Koperen Hemel provides information about both the restaurant and its associated traiteur, including opening hours, job vacancies, and contact details.	Culinary & Tastings → Culinary Events ⁶⁵	traiteur ¹⁸ guest ¹³³⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ restaurant ¹¹²¹⁵	Haarlemmermeer → Vijfhuizen ²²⁶
tokosil.nl	Toko Sil	The Toko Sil website is an Indonesian toko and wok offering takeaway and delivery options, specializing in Indonesian cuisine, snacks, and exotic products, as well as catering services.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
ccasianmarket.nl	C&C Asian Market	The C&C Asian Market website offers a wide selection of Asian products, including sauces, spices, snacks, drinks, and ingredients for cooking.	Catering & Ready Meals → Asian Cuisine ¹³⁷	noodles ¹⁹¹ spices ³⁴⁰ sauce ¹¹⁴¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹
mutiarabv.nl	Mutiara B.V.	The website is an online store selling Indonesian snacks and side dishes, both frozen and refrigerated.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	supplier ¹⁷²⁵ packaging ²²³⁶ snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
cafetaria-sim-groningen.nl	Cafetaria Sim	The Cafetaria Sim website is an online ordering system for meals and snacks from Cafetaria Sim in Groningen. Users can view the menu and order online here.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	croquette ¹³⁶ shawarma ³³⁵ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Groningen ²³⁷³⁴
cafetariagrunogroningen.nl	Gruno	Cafetaria "Gruno" is a cafe located in Groningen offering a comprehensive menu featuring fries, snacks, sandwiches, and other dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	shawarma ³³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
demolensiddeburen.nl	Snackbar de Molen	The website of Snackbar de Molen is an online platform for ordering snacks and fries for delivery or pickup. It also offers a menu, reviews, and information about the snack bar.	Quick Bites → Snack Bar ⁵⁸⁰ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Midden-Groningen → Siddeburen ¹⁰⁸
sitasrotibroodjes-groningen.nl	Sita's Roti & Broodjes	Sita's Roti & Broodjes is an online platform allowing customers in Groningen to order dishes, including roti and sandwiches.	Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ ingredients ²³⁴⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
shamrockharlingen.nl	The Shamrock Harlingen	The Shamrock Harlingen website is for an Irish pub in Harlingen that offers beers, whiskey’s, snacks and events.	Performance → Live Music ¹⁶¹² Bars & Pubs → Bars ¹⁹³⁸	whiskey ⁷⁸ pub ¹⁸⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ reservation ³³⁷³ event ⁴⁵¹⁹⁹	Friesland → Harlingen ⁹⁷⁸
cafemaxim.nl	Café Maxim	Café Maxim is a neighborhood café in Bottendaal that offers hospitality and coziness with a wide menu and various events.	Cafes → Beer Cafes ²⁰⁹ Festivals → Music Festivals ¹⁰²⁰	cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ party ⁵⁹²⁸	Nijmegen → Nijmegen-East ¹⁶⁹
bakkerijstroet.nl	Bakkerij Stroet Neede	Bakkerij Stroet Neede offers an online webshop and a physical store in Neede, providing a wide range of bread, pastries, and snacks. The website facilitates online ordering and allows for communication regarding special requests.	Bakery & Food Production → Online Bakeries ⁵⁶	pastries ⁹⁴⁶ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸	Berkelland → Neede ³⁰⁰
cafetariabroodjeshuisdeschans.nl	PC Ronnie	Cafetaria De Schans offers a price list with various types of fries, snacks, sandwiches and drinks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹
pizzaworkum.nl	De Heeren van Heeres	Pizza Workum is a takeaway service offering pizzas, gourmet burgers, and snacks, part of the restaurant De Heeren van Heeres in Workum.	Catering & Ready Meals → Chinese Restaurants ³⁰³ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	takeaway ⁶⁵³ burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² restaurant ¹¹²¹⁵	Southwest-Friesland → Workum ³⁶³
dailytrend.nl	Dailytrend	The website dailytrend provides daily updates on various topics, including living, fashion, beauty, health, and sports, as well as general news articles.	Fashion → Trends ³⁵⁵ Media → News & Journalism ¹⁰⁸²⁷	underwear ²⁸¹ fashion ²²¹² snack ²⁹¹⁶ article ⁶⁰⁰⁰ news ¹⁵²⁹³
flamingo-hoogvliet.nl	Partycentrum Flamingo Hoogvliet Rotterdam	Partycentrum Flamingo Hoogvliet Rotterdam is a hall rental company located in Rotterdam, specializing in organizing various events, including weddings, corporate parties, meetings, and parties.	Venues → Halls ⁴¹⁹ Venues & Rentals → Hall Rental ¹⁹⁷	hall rental ¹²⁴ hall ¹⁷⁸⁶ snack ²⁹¹⁶ party ⁵⁹²⁸ quote ¹²⁸⁶³ event ⁴⁵¹⁹⁹	Rotterdam → Hoogvliet ⁵¹⁶
wijnopwielen.nl	Wijn op Wielen	Wijn op Wielen is a mobile wine bar specializing in providing wine and complementary snacks for various occasions.	Culinary & Tastings → Tastings ¹²⁷	wine shop ⁶³ bar ¹²¹⁶ snack ²⁹¹⁶ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ event ⁴⁵¹⁹⁹	Haarlemmermeer → Hoofddorp ²⁷³⁹
sannewijn.nl	Sanne Wijn	The website of Sanne Wijn offers wine tasting experiences, taking guests on a journey to Portugal to sample Portuguese wines and snacks in a personal setting.	Wine → Wine Tasting ⁷³⁰	portugal ¹³⁰ wine tasting ²³⁸ taste ⁹³³ snack ²⁹¹⁶ wine ⁴⁴⁷⁶
shefu.nl	FBI Food Group	The website introduces and sells a range of authentic Asian snacks, including Japanese (tatsuta, karaage) and Korean (kiphapjes, yakitori) dishes.	Sauces & Condiments → Asian Food ¹⁵	authentic ³¹ flavor ¹⁰³² snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackcounterbraam-eiland.nl	Snackcounter Braam-Eiland	The website of Snackcounter Braam-Eiland presents the snack bar, a long-standing establishment in Duiven, offering a wide range of snacks, takeaway meals, ice cream and drinks, and currently advertising job vacancies for new staff.	Quick Bites → Snack Bar ⁵⁸⁰ Commerce → Shopping Centers ¹⁰⁰¹	shopping center ⁴⁹¹ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ staff ³⁴⁰⁵ assortment ⁷⁷⁹⁹ menu ¹³⁸⁵⁶	Gelderland → Duiven ⁸⁵¹
devuurbaak.nl	Snackbar de Vuurbaak	Snackbar de Vuurbaak is a snack bar in Katwijk aan Zee that offers high-quality snacks and meals.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	patat ²¹ meal ¹⁶³⁸ snack ²⁹¹⁶	Katwijk → Katwijk aan Zee ⁶¹⁶
snackwijzer.nl	Snackwijzer	Snackwijzer.nl is a website providing news related to snacks in the Netherlands.	Government & Administration → Dutch Government ¹¹⁴ Media → News & Journalism ¹⁰⁸²⁷	government ⁸²⁷ layout ⁸⁹⁹ category ²³¹⁶ snack ²⁹¹⁶ property ⁷⁴⁰⁶ news ¹⁵²⁹³
de-ziepe.nl	Cafetaria de Ziepe	Cafetaria de Ziepe offers an online webshop where customers can order fries, family menus and various snacks, including chicken snacks and gluten-free snacks, and have them delivered.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Beekdaelen → Nuth ²²³
cafetariabreukelen.nl	Cafetaria Breukelen	The website of Cafetaria Breukelen offers the possibility to order snacks online for delivery or pickup. It presents a menu with various dishes, salads, and drinks.	Quick Bites → Cafeteria ⁹⁰⁶ Landscape → Utrechtse Heuvelrug ⁷⁷	pickup ⁷³⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Stichtse Vecht → Breukelen ⁶³²
dannysmarknesse.nl	Danny's Marknesse	The website of Danny's Marknesse is an online platform for ordering snacks, fries, sandwiches and drinks, and promoting their cafetaria and restaurant in Marknesse.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	loyalty card ⁸⁷ table ¹⁷⁷⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Noordoostpolder → Marknesse ¹⁷⁵
cafetaria-marktzicht.nl	Cafetaria Marktzicht	The website of Cafetaria Marktzicht presents the menu, ordering options (online, pickup, delivery), and information about the cafeteria.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	cafeteria ¹⁶⁹ lunch ¹⁵³⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Beesel → Reuver ²⁵¹
snackpointsucces.nl	Snackpoint Succes	Snackpoint Succes is a restaurant located in Stadskanaal that offers online ordering for delivery or pickup.	Fast Food → Fries ⁹⁴⁹	ideal ²⁴⁹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Groningen → Stadskanaal ¹⁰⁵⁴
prettystrong-supplements.nl	Pretty Strong Supplements	The website Pretty Strong Supplements sells 100% natural, handcrafted supplements, snacks, and accessories, emphasizing doping-free products and vegan options.	Sandwiches & Salads → Snacks ⁶⁹³ Healthy Food → Snacks ²²	protein ²⁹⁹ vegan ⁵⁰⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶
kofferbakmarktwijkaanzee.nl	Kofferbakmarkt Wijk aan Zee	The website serves as an information center for the Wijk aan Zee Flea Market, providing details about dates, opening hours, visitor information, and vendor information.	Local Events → Markets ¹⁰⁹⁷ Retail & Commerce → Second-Hand Shops ¹¹⁰	vendor ¹²⁸ visitors ¹⁰⁴⁸ parking ¹⁹²⁸ market ²⁷⁷² snack ²⁹¹⁶ coffee ³⁸³⁸	Velsen → Santpoort-Noord ⁶⁰⁶
theetuin-de-winterlinde.nl	Theetuin De Winterlinde	Theetuin De Winterlinde is a tea garden and café that provides a pleasant and relaxing environment for visitors.	Pastry → Cakes ⁸²⁶	scones ³⁹ tea ¹¹⁴⁶ cake ¹⁷³⁰ snack ²⁹¹⁶ coffee ³⁸³⁸ drink ⁵¹⁹¹	Nijkerk → Achterhoek ¹⁷³⁰
gewoonbookel.nl	Gewoon Bookel eten en drinken	Gewoon Bookel eten en drinken is a café and cafeteria located in Boekelo offering a wide range of dishes and drinks.	Quick Bites → Snack Bar ⁵⁸⁰	satay ³²⁰ café ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Enschede → Boekelo ¹⁷¹
eetwinkelpolly.nl	Eetwinkel Polly	Eetwinkel Polly is a hospitality company primarily specializing in offering fries, snacks, catering, and delivery services.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	delivery service ²³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Lingewaard → Bemmel ⁵⁰⁹
slagerijvugts.nl	Slagerij Vugts	The website of Slagerij Vugts is an online platform for a traditional artisanal butcher shop in Diessen, Netherlands, offering a wide assortment of meat products, BBQ products, and other culinary items, with the possibility of online ordering for pickup.	Barbecues → Barbecue Supplies ¹⁹ Supermarkets & Grocery → Butchers ⁷⁴⁷	meat products ²⁷² bbq ⁹⁰⁸ meal ¹⁶³⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ order ⁶⁹¹²	Hilvarenbeek → Diessen ¹³⁶
braadspitveghel.nl	braadspitveghel.nl	The website of ‘t Braadspit serves as an information portal for online ordering and tracking updates regarding the restaurant's temporary closure. It also provides information about the menu and the company’s history.	Meat → Chicken ¹²⁷	chicken ⁹⁴⁴ snack ²⁹¹⁶ app ⁴⁵⁹⁵ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Meierijstad → Veghel ¹²⁸⁸
familydiscounter.nl	Familydiscounter	The website familydiscounter.nl is a retail company specializing in the sale of A-brand soft drinks and snacks, catering to both individual customers and business clients such as sports clubs and restaurants.	Beverages → Soft Drinks ⁹² Hospitality → Suppliers ¹⁰⁵⁷	business clients ¹⁷ soft drinks ⁸⁷ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹ price ⁸³²⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cafetariadeluifel.nl	Cafetaria de Luifel	Cafetaria De Luifel is a cafeteria located in Best that offers a variety of snacks, menus, burgers, salads, and luxury fries toppings, both on-site and online.	Family Activities → Outings ⁷⁶³ Quick Bites → Cafeteria ⁹⁰⁶	pickup ⁷³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	North-Brabant → Best ⁹⁷⁸
cafetariadeesch.nl	Cafetaria De Esch	Cafetaria De Esch in Borne is a cafe offering snacks, fries, ice cream, and other products from its own kitchen, and also has job postings for staff.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	hour ³⁶⁵ colleague ³⁷⁸ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Borne ⁸¹²
poolcentrum-geldrop.nl	Poolcentrum Geldrop	Poolcentrum Geldrop is a recreation center offering pool, billiards, darts, and jeu de boules.	Bars & Pubs → Bars ¹⁹³⁸ Team → Sports Activities ⁴³³⁹	dart lane ¹⁰ billiard table ⁴³ pool table ⁶⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹	Geldrop-Mierlo → Geldrop ⁷⁹⁴
goudhaantjevlijmen.nl	Cafetaria & Eethuis Het Goudhaantje	The website of Cafetaria & Eethuis Het Goudhaantje in Vlijmen allows visitors to order online and view the menu.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Heusden → Vlijmen ³⁸⁹
shengliwaalwijk.nl	Sheng Li Sushi & Snackbar	The website of Sheng Li Sushi & Snackbar in Waalwijk provides an online ordering system for sushi, snacks, and other dishes, with the option for delivery. It also provides information about the menu and customer reviews.	Japanese → Sushi ⁹⁷¹	sushi ¹⁶⁹⁵ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Brabant → Waalwijk ¹⁷⁴⁴
doner-corner.nl	Döner Corner Veenendaal	The Döner Corner Veenendaal website allows customers to order meals online from their extensive menu, which includes various döner sandwiches, Turkish pizzas, snacks, and drinks.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Utrecht → Veenendaal ²⁶⁴¹
snackcompanydriebergen.nl	Snack Company Driebergen	The Snack Company Driebergen website is an online platform where customers can order fries, snacks, and other dishes, with the option for home delivery and app ordering.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht Hill Ridge → Driebergen-Rijsenburg ²³⁷
profood.nl	ProFood	The website of ProFood presents the services of the company, focused on delivering, managing and maintaining coffee machines and vending machines for schools and businesses, as well as catering services for schools.	Dogs → Supplies ¹⁰⁰⁵ Logistics & Transportation → Vending Machines ⁶⁹	vending machine ¹²⁷ coffee machine ⁴¹⁵ snack ²⁹¹⁶ coffee ³⁸³⁸ catering ⁶⁴⁵⁶ school ⁷⁸⁵⁶
snackervenlo.nl	Tafelronde 94 Venlo	The website promotes the Snacker Venlo culinary festival in Venlo.	Fast Food → Fries ⁹⁴⁹	beer ²⁸⁸⁷ snack ²⁹¹⁶ festival ³⁸⁰⁴ music ¹³¹⁷⁰	Limburg → Venlo ⁴¹⁵⁸
cafedealm.nl	Plaza de Alm	The website of Plaza de Alm presents the offerings of a cafeteria and cafe in Almkerk, with a focus on providing various snacks, meals, and beverages, as well as organized events.	Quick Bites → Cafeteria ⁹⁰⁶	folder ³⁰⁰ cafe ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Altena → Almkerk ¹⁵⁹
onderdekelders.nl	Onder de Kelders	Onder de Kelders is a website that provides information and inspiration about the culinary world, with a focus on snacks and drinks.	Personal Development → Self-Love ³³ Social → Personal Blog ²⁷¹⁸	inspire ⁹⁹ snack ²⁹¹⁶ recipe ⁵¹⁴² drink ⁵¹⁹¹ story ⁸²⁸⁵
bakkerijkaspers.nl	Bakkerij Kaspers	Bakkerij Kaspers is a traditional bakery offering bread and pastries in Doetinchem, Wehl, and surrounding areas, providing delivery and business ordering options.	Bakery & Food Production → Online Bakeries ⁵⁶ Food Delivery → Delivery ²²²⁷	pastries ⁹⁴⁶ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶ workshop ¹⁹³²⁵	Bronckhorst → Hoog-Keppel ⁵⁵
brasseriebrocante.nl	Brasserie Brocante	Brasserie Brocante is a brasserie in Ulestraten offering lunch, dinner, and drinks in a cozy setting, both indoors and on the terrace.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Performances & Entertainment → Nightlife ⁷⁰¹	brasserie ⁷⁵² dinner ¹⁵³³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ event ⁴⁵¹⁹⁹	Meerssen → Ulestraten ⁷²
santeborrelbar.nl	SANTÉ Borrelbar	SANTÉ is a bar offering a welcoming atmosphere for enjoying drinks, food, and socializing.	Bars → Pubs ⁵⁴⁶ Venues → Halls ⁴¹⁹	gathering ³⁹⁴ hall ¹⁷⁸⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ event ⁴⁵¹⁹⁹
pruuven.nl	PRUUVEN	The PRUUVEN website announces the 7th edition of the PRUUVEN 2026 event, a Burgundian Friday afternoon and evening featuring specialty beers, wine, and snacks in the Jan Cunenpark in Oss.	Culinary & Tastings → Beverage Events ¹⁰⁵ Food & Drink → Beer Culture ³⁹	brewer ⁵² beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	North-Brabant → Oss ²⁹⁶²
thinlizzys.nl	Thin Lizzy’s – Irish Pub	Thin Lizzy’s – Irish Pub is an Irish pub located in Oldenzaal, Twente, offering a relaxed and friendly atmosphere with drinks, snacks, and events.	Pubs → Irish Pubs ¹¹	pub ¹⁸⁵ market ²⁷⁷² snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Overijssel → Oldenzaal ¹²¹⁹
deschalksevlaming.nl	Frituur De Schalkse Vlaming	The website presents the menu and offerings of Frituur De Schalkse Vlaming.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Dishes ³³⁵	croquette ¹³⁶ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶
warungtunjungan.nl	Warung Tunjungan Baarn	The website of Warung Tunjungan Baarn provides an online ordering system for Asian dishes, including a digital menu, reviews, and newsletter registration.	Food Delivery → Indonesian ⁵⁰²	rice table ²⁷⁷ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Baarn ¹⁶²⁸
karrewielvogelwaarde.nl	Het Karrewiel	Het Karrewiel is a restaurant and frituur (takeaway fry shop) in Vogelwaarde offering a cozy atmosphere and enjoying a bourgeois experience.	Places → Towns ³⁸⁰ Context ¹⁶¹³⁹⁴	frituur ¹² coziness ²³⁵ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹ history ⁷²⁸⁶ restaurant ¹¹²¹⁵	Hulst → Vogelwaarde ³⁶
wijnbarnext.nl	Wijnbar Next	Wijnbar Next is a wine bar in Hardenberg offering a cozy atmosphere for guests to enjoy wines, cocktails, and snacks.	Bars → Pubs ⁵⁴⁶ Bars → Wine Bars ¹⁷⁰	cozy ²²⁷ cocktail ⁹²⁵ snack ²⁹¹⁶ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ party ⁵⁹²⁸	Overijssel → Hardenberg ²³⁰⁹
vanspeyck.nl	Van Speyck	The website of Van Speyck presents a specialty beer café and wine bar in Oud-Beijerland, aimed at an adult audience who value quality, diversity, and a unique dining experience.	Cafes → Beer Cafes ²⁰⁹ Tourism → Cultural Attractions ⁶⁹⁸	tap ¹³⁵ taste ⁹³³ café ⁹⁴⁴ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
groothandel-telindert.nl	Groothandel Te Lindert	The website of Groothandel Te Lindert is a wholesaler supplying a wide range of products to various customers, including schools, businesses, associations, and specialty shops.	Wholesale → Hospitality Supplies ²⁴ Sandwiches & Salads → Prepared Foods ³⁹	beverage ⁵⁸⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶ hospitality ³⁴⁹¹ coffee ³⁸³⁸
murrayspizzasnacks-mijdrecht.nl	Murray's Pizza & Snacks	The website of Murray's Pizza & Snacks in Mijdrecht allows customers to order pizzas, snacks, and salads online for delivery.	Pastries & Baked Goods → Menus ²²³	tomato sauce ¹⁵ mozzarella ²⁷ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	De Ronde Venen → Mijdrecht ⁷⁰⁰
pinohilversum.nl	Pino Hilversum	The website of Pino Hilversum offers online ordering for dishes and snacks from the restaurant in Hilversum.	International → Middle Eastern ¹¹⁶ Quick Bites → Hair Salon ¹¹²	plate ⁷⁸⁷ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
wallisdiervoeding.nl	Wallis Diervoeding	Wallis Diervoeding is an online store selling natural food, snacks, and accessories for dogs and cats, offering free delivery in Zeeland for a minimum order value.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	gift certificate ⁶⁴⁶ snack ²⁹¹⁶ food ³⁸⁷² care ¹²³³⁸ accessories ¹²⁹⁷⁵	Netherlands → Zeeland ¹⁵⁴⁹³
kingskakilima.nl	Kings Kaki Lima	Kings Kaki Lima is a food cart specializing in authentic Indonesian satay, rice tables, and Indonesian snacks, offering on-location catering services for various events.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Indonesian Restaurant ³⁹²	rice table ²⁷⁷ satay ³²⁰ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
cafetariadejachthaven.nl	Cafetaria De Jachthaven	The website of Cafetaria De Jachthaven presents the menu and opening hours of the cafeteria, emphasizing fresh, daily-fried potatoes and various snacks and sandwiches.	Fast Food → Fries ⁹⁴⁹ Food & Dining → Harbors ¹⁸	harbor ⁶⁹¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Meierijstad → Veghel ¹²⁸⁸
badhuisschoon.nl	Damesbadhuis Schoon	Damesbadhuis Schoon is a women's bathhouse (hammam) in Amersfoort offering beauty treatments, massages, and rituals.	Entertainment → Lounges ⁴⁸ Spa → Hammam ¹⁰	hammam ³⁴ lounge ²⁰¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ massage ⁷⁶⁴⁶ treatment ²¹²⁰³	Utrecht → Amersfoort ⁸⁰¹¹
wazzafishmore-westkapelle.nl	Wazza Fish & More	The Wazza Fish & More website, located in Westkapelle, offers online ordering for a variety of dishes, including fries, snacks, burgers, pizzas, and fish dishes.	Fast Food → Fries ⁹⁴⁹	fish ¹¹²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Veere → Westkapelle ¹⁸³
marktenzuidoost.nl	Markten Zuidoost	The website Markten Zuidoost provides information about the lively markets in Amsterdam Southeast, including locations, opening hours, and product offerings.	Markets → Local Markets ¹⁵³ Context ¹⁶¹³⁹⁴	cuisine ⁶⁶⁶ market ²⁷⁷² snack ²⁹¹⁶	Amsterdam → Southeast ⁸¹⁵
broodje-bram.nl	VOF Broodje Bram	Broodje Bram is a lunchroom and restaurant in Heemstede that serves delicious sandwiches, lunch dishes, coffee, and tea daily.	Food Delivery → Delivery ²²²⁷ Cafes & Lunch → Lunch Spots ²³⁷	lunch ¹⁵³⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Heemstede ¹¹⁷³
alanyamedemblik.nl	Alanya Doner Medemblik	The website Alanya Doner Medemblik allows customers to order meals online in Medemblik.	Fast Food → Döner ²³⁸	doner ¹³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Medemblik ¹⁵³⁵
cafebalu.nl	Balu	Grand Café Balu is a café and terrace in Castricum offering a cozy atmosphere, a wide range of drinks, food, and events.	Fast Food → Burgers ⁶⁸⁷ Beverages → Cocktails ¹⁴⁴	cocktail ⁹²⁵ burger ¹⁴³¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	North-Holland → Castricum ¹³⁸⁷
vanoijenbeugen.nl	Firma van Oijen	The website of van Oijen Beugen presents the offerings of a cafeteria and lunchroom in Beugen.	Brasseries & Bistros → Bistro ⁵⁹⁴ Quick Bites → Cafeteria ⁹⁰⁶	lunchroom ³¹² cake ¹⁷³⁰ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Land van Cuijk → Beugen ¹⁰²
bestariaruinen.nl	Bestaria Ruinen	Bestaria Ruinen is a fast-food restaurant and snack bar located in Ruinen.	Cuisine → Vegetarian ⁶⁹⁷	gluten-free ¹⁵⁶ vegetarian ³³⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	De Wolden → Ruinen ¹⁸⁸
speciaalzaakmhilboezen.nl	Speciaalzaak M Hilboezen	The website of Speciaalzaak M Hilboezen showcases a specialty shop offering a wide assortment of cheese, butcher shop goods, BBQ products, and snacks.	Local Events → Markets ¹⁰⁹⁷ Outdoor → Barbecues ⁷⁴⁴	nuts ⁴¹⁷ bbq ⁹⁰⁸ chicken ⁹⁴⁴ cheese ¹²⁰⁵ snack ²⁹¹⁶	Northeast-Friesland → Kollum ²¹⁴
perfectlunch.nl	Perfect Lunch	Perfect Lunch is a lunchroom and catering service located in Leusden that provides various lunches, catering, and events.	Cafes & Lunch → Lunch Spots ²³⁷ Tourism → Tourist Information ¹²⁴	lunchroom ³¹² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Utrecht → Leusden ¹³⁴⁵
hetbelegvanede.nl	Het Beleg van Ede	The website of ‘Het Beleg van Ede’ offers a range of catering services, including breakfast, lunch, snacks and dinners, both on-site and via an online shop.	Accommodation → Breakfast ³⁶⁴ Cafes & Lunch → Lunch ⁵⁹¹	lunch ¹⁵³⁴ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶
dedriespronggarderen.nl	Restaurant de Driesprong	Restaurant de Driesprong is a restaurant located in Garderen, offering lunch, dinner, coffee, and snacks to visitors.	Weather → Weather Forecasts ¹⁵ Cafes & Lunch → Lunch Spots ²³⁷	lunch ¹⁵³⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Barneveld → Garderen ²⁰²
cafetaria-sunplein.nl	Cafetaria 't Sunplein	Cafetaria 't Sunplein is a cafe and food stall in Landgraaf offering fresh products and catering services.	Brasseries & Bistros → Bistro ⁵⁹⁴ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	village ⁸⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Limburg → Landgraaf ⁷¹⁹
mijnboemboe.nl	Mijn Boemboe	Mijn Boemboe is an Indonesian restaurant and catering service located in Rotterdam Schiebroek.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	snack ²⁹¹⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Rotterdam → North ³³²
snackpoint-susteren.nl	Snackpoint Susteren	Snackpoint Susteren is a restaurant in Susteren that offers fried food delivery and takeaway orders.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	ideal ²⁴⁹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Echt-Susteren → Susteren ²¹⁸
friturezaaladelaars.nl	Friture Zaal Adelaars	The website of Friture Zaal Adelaars provides information about the friture (fast food restaurant), opening hours, the possibility to order online, and contact details.	Fast Food → Burgers ⁶⁸⁷ Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ party ⁵⁹²⁸	North-Brabant → Helmond ³⁰⁵⁸
snackbardepuntzak.nl	Snackbar De Puntzak	The website of Snackbar De Puntzak presents a menu of various fries and snacks, special offers, and information about the establishment.	Quick Bites → Snack Bar ⁵⁸⁰ Family Fun → Family Activities ¹⁴⁹³	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Emmen → Klazienaveen ²⁹⁷
snackbargrootdriene.nl	Snack&Grillroom Hengelo	The website of Snack&Grillroom Hengelo is an online platform where visitors can order snacks and fries for pickup or delivery.	Fast Food → Fries ⁹⁴⁹	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
cafetarialenferink.nl	Cafetaria Lenferink	The website of Cafetaria Lenferink provides information about the opening hours, menu, delivery options, and contact details of the snack bar in Delden. It also includes a news section with recent updates.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶ news ¹⁵²⁹³	Hof van Twente → Delden ⁴⁴²
slagerijdijkstra.nl	Uw Beenhouwer Gerard Dijkstra	The website of Uw Beenhouwer Gerard Dijkstra offers an online shop and potential takeaway options for snacks, barbecues, gourmet dishes, and fondue dishes, salads and complete buffets, as well as home-cured meats.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Outdoor → Barbecues ⁷⁴⁴	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ salad ²⁴⁴⁴ snack ²⁹¹⁶
detussenstop.nl	Snackbar DE TUSSENSTOP	The website of Snackbar DE TUSSENSTOP offers a wide range of snacks, ice cream, milkshakes, and meals, with a focus on fries and various side dishes and vegetarian options. Special offers and family portions are also available.	Family Activities → Outings ⁷⁶³ Quick Bites → Cafeteria ⁹⁰⁶	ice cream ¹⁰⁰⁰ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ family ⁶⁴⁶² menu ¹³⁸⁵⁶	Midden-Drenthe → Hooghalen ¹⁰⁷
gommianz.nl	Gommianz	The Gommianz website is an online shop and service provider offering high-quality meals, snacks, and cooking workshops, with a focus on passion, experience and taste.	Cooking & Recipes → Cooking Classes ²⁹² Dairy & Cheese → Delicatessens ⁶¹⁷	cooking workshop ¹⁶⁸ family business ⁷⁹³ meal ¹⁶³⁸ snack ²⁹¹⁶ kitchen ⁶⁴⁴³
bakkerijweijers.nl	Bakkerij Weijers	The website of Bakkerij Weijers offers a wide assortment of artisanal bread, pastries, and various desserts, emphasizing freshly made products and recipes with a long tradition.	Pastries & Baked Goods → Pastry ¹²¹⁰ Food → Local & Regional Products ⁹³⁰	roll ³⁵⁸ dessert ⁴⁹⁶ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶	Netherlands → Limburg ³¹⁹⁰⁹
deweefkamer.nl	De Weefkamer	The Weefkamer is a cozy dining establishment in Knegsel offering a pleasant and personalized experience for families, couples, and children.	Regional Cuisine → Regional Restaurants ⁵⁷ Family Fun → Family Activities ¹⁴⁹³	coziness ²³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹ family ⁶⁴⁶² menu ¹³⁸⁵⁶	Eersel → Knegsel ¹³⁵⁹
snackbar-deroef.nl	Snackbar de Roef	The website of Snackbar de Roef in Grou offers the possibility to order and pay online, with the option for home delivery and a mobile app for quick ordering.	Websites → Local Businesses ⁸⁵ Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Leeuwarden → Grou ³⁶⁶
snackbardewatertoren.nl	de Watertoren	The website for Snackbar de Watertoren is an online presence of a grillroom-cafeteria in Nijverdal offering a wide range of food and drinks, including fries, snacks, sandwiches, and grilled dishes.	Catering & Ready Meals → Takeaway ⁴⁰⁹	dining area ¹¹ grilled dishes ⁴⁹ cafeteria ¹⁶⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Hellendoorn → Nijverdal ⁷²⁸
bss-partners.nl	BSS Partners	BSS Partners is a wholesaler specializing in sports nutrition and related products for the Dutch and Belgian markets.	Nutrition → Sports Nutrition ²⁴⁶ Nutrition → Supplements ¹⁵⁵⁷	amino acids ³⁰ pre-workout ⁴⁰ sports nutrition ¹³⁹ protein ²⁹⁹ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
cateringmetmieke.nl	Catering MetMieke	Catering MetMieke offers a wide range of meals and snacks, emphasizing locally sourced, homemade, and healthy options, particularly for businesses, training sessions, and events.	Fast Food → Fries ⁹⁴⁹	lunch ¹⁵³⁴ meal ¹⁶³⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶
doner-abi-ijmuiden.nl	DöNER ABI IJMUIDEN	The Döner Abi IJmuiden website is an online ordering platform for dishes from the Döner Abi restaurant in IJmuiden, featuring a comprehensive menu and reviews.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	grilled dishes ⁴⁹ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Velsen → IJmuiden ¹¹⁰⁹
cafetariaridderhof.nl	Cafetaria Ridderhof	The website of Cafetaria Ridderhof showcases its range of traditional snacks, catering services, and the history of the snack bar in Nieuw-Vennep.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	sauce ¹¹⁴¹ meat ²⁰⁵⁵ snack ²⁹¹⁶ employee ⁴⁴²⁹ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
femkesdogstore.nl	Femke's Dog Store	Femke's Dog Store is a shop specializing in products and services for dogs.	Animal Care → Dog Care ¹³⁹⁸ Animals → Pet Stores ⁴⁷⁸	collar ²⁴² breed ¹⁷⁴⁴ toy ²²⁹⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³	Twenterand → Stationslaan ²⁶⁶
pawfectfoods.nl	Living The Pawfect Way	The Living the Pawfect Way website offers natural and grain-free food and snacks for dogs and cats, focusing on healthy and tasty options.	Essential ²⁴¹⁰¹⁶	treat ³⁷³ cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
buah.nl	Buah	The website buah.nl sells freeze-dried and dried fruit, vegetable chips, Blissballs, fruit & nut sets and other products, with an emphasis on natural and healthy snacks.	Healthy Food → Snacks ²²	set ⁷²⁰ fruit ¹¹⁶⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
dudes-stein.nl	DUDES Food & Drinks	The website of DUDES Food & Drinks presents the restaurant, drink selection, events, and atmosphere of the establishment, aiming to inform visitors and invite them to visit.	Bars & Pubs → Bars ¹⁹³⁸	bar ¹²¹⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹
americangroothandel.nl	American Groothandel	American Groothandel is the largest importer and distributor of American snacks and candy in the Netherlands.	Online Retail → Food Retail ³⁴⁰ Chocolate & Sweets → Sweets ²⁵⁷	candy ²⁰⁵ beverage ⁵⁸⁶ category ²³¹⁶ snack ²⁹¹⁶ brand ¹⁷⁷³⁷
deadelshoeve.nl	Hondensnacks & Dagopvang De Adelshoeve	Hondensnacks & Dagopvang De Adelshoeve is a company that offers natural dog snacks, food and daycare, with a focus on personalized advice for dogs of all ages and breeds.	Dogs → Pet Care ³⁸⁷ Pet Food → Dog Food ³²¹	daycare ¹³⁶⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³ webshop ⁸⁶⁴⁸
discusmaassen.nl	DiscusMaassen B.V.	The website DiscusMaassen.nl is an online store offering a wide range of organic food and care products for dogs, cats, small rodents, birds, and chickens. It also features a blog and information about ‘About Us’ and contact details.	Animals → Pet Food ⁵⁸⁴ Animals → Dogs ⁵⁸⁷⁹	cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ care ¹²³³⁸
kelbosnacks.nl	Kelbo Snacks	The website, Kelbo Snacks, sells 100% natural snacks for dogs and cats.	E-Commerce → Pet Supplies ¹⁰¹³	cat ¹⁵⁷⁸ snack ²⁹¹⁶ dog ⁵⁴⁸³
robertsdogfood.nl	Robert's Dogfood	The website Robert's Dogfood sells grain-free and gluten-free dog food, dog snacks, supplements, and toys for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	dog food ²⁰⁴ supplement ¹⁹⁶⁸ toy ²²⁹⁵ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Drenthe → Assen ³⁵¹⁶
verwendhondje.nl	Verwendhondje	The website www.verwendhondje.nl offers a wide range of dog and cat food, treats, and accessories, including self-dried snacks, KVV (Nutri-Gel) from Tammenga and Dogmeat, and provides advice on dog care.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ accessories ¹²⁹⁷⁵
versvleeshonden.nl	Versvleeshonden.nl	The website versvleeshonden.nl offers a wide range of fresh meat and dog biscuits, including mixes, shelf-stable sausages, snacks, and oils and supplements for both dogs and cats, and ensures fast and safe delivery.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	dog biscuits ¹⁶ shopping cart ¹⁵²¹ supplement ¹⁹⁶⁸ snack ²⁹¹⁶
wijnfestivalhoorn.nl	Wijnfestival Hoorn	The Wijnfestival Hoorn is an annual event held on the Baatland in Hoorn, offering a wide selection of wines and beers combined with food trucks, entertainment, and music.	Family Activities → Outings ⁷⁶³ Festivals → Wine Festivals ⁴²	wine bar ¹²⁸ foodtrucks ¹⁸² snack ²⁹¹⁶ wine ⁴⁴⁷⁶ restaurant ¹¹²¹⁵ music ¹³¹⁷⁰	North-Holland → Hoorn ³⁰⁹⁰
koolhydraatarmerecepten.nl	Not mentioned	The website provides a guide with low-carb recipes for breakfast, lunch, dinner, and snacks.	Nutrition → Healthy Eating ⁶³⁴	low-carb ¹⁸ dinner ¹⁵³³ breakfast ¹⁸²² snack ²⁹¹⁶ recipe ⁵¹⁴²
chefsburger-haarlem.nl	Chef's Burger	Chef's Burger is an online ordering platform allowing customers to order meals and snacks in Haarlem.	Fast Food → Burger Restaurants ³⁴⁶ Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
hetlutke.nl	Het Lutke	Cafetaria Het Lutke is a cafeteria, café, and event center located in De Lutte, specializing in the provision of fries, snacks, and other dishes with a focus on quality and a cozy atmosphere.	Quick Bites → Cafeteria ⁹⁰⁶ Venues → Halls ⁴¹⁹	cafeteria ¹⁶⁹ hall ¹⁷⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ atmosphere ⁵⁵⁹¹	Losser → de Lutte ²²²
degrootedelgebak.nl	De Groot Edelgebak	De Groot Edelgebak is a horeca supplier offering artisanal baked goods.	Pastries & Baked Goods → Pastry Shops ²⁰¹ Hospitality → Suppliers ¹⁰⁵⁷	bonbons ³²⁹ dessert ⁴⁹⁶ chocolate ⁹¹¹ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶	Gelderland → Ede ⁵¹⁰⁴
boattoursspaarndam.nl	Boat Tour Spaarndam	The website offers boat tour bookings from Haarlem, including sightseeing cruises and themed culinary cruises in collaboration with local restaurants.	Water Travel → Boat Tours ⁶⁴⁰ Water Recreation → Sightseeing Cruises ¹⁸	sightseeing tour ¹⁷ boat tour ⁹⁴ cruise ⁴⁰⁵ snack ²⁹¹⁶ restaurant ¹¹²¹⁵	Haarlemmermeer → Spaarndam ²⁰⁷
rebel-moon.nl	Rebel & Moon	Rebel & Moon is an online shop catering to dog lovers, offering accessories, snacks, enrichment items, and home accessories for dogs, alongside coaching and guidance for dogs and their owners.	Animals → Dogs ⁵⁸⁷⁹	line ²³⁶ collar ²⁴² snack ²⁹¹⁶ dog ⁵⁴⁸³ accessories ¹²⁹⁷⁵ coach ²⁵⁸¹⁰
cafetariaprins.nl	Cafetaria Prins	The website of Cafetaria Prins Beekbergen offers online ordering for delivery and takeaway of various dishes, including pizzas, sandwiches, salads, and snacks.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	takeaway ⁶⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Apeldoorn → Beekbergen ³²⁶
schaftzonderspijt.nl	Schaft zonder spijt	The website of Rick, known as ‘Schaft zonder spijt’ (Without Regret), presents calorie-rich content, primarily focused on Dutch snack and deep-fried food culture, with a special focus on ‘Fat Friday’ content.	Online Marketing → Social Media Marketing ¹⁰⁰² Fast Food → Burgers ⁶⁸⁷	friday ²³ fry ⁵⁹ steak ³³⁵ series ⁶⁴⁴ snack ²⁹¹⁶
dierverzorgingtexel.nl	Dierverzorging Texel	Dierverzorging Texel is a pet care business on Texel offering boarding, grooming, and dog and cat rehoming services.	Animal Welfare → Animal Boarding ⁵⁸ E-Commerce → Pet Supplies ¹⁰¹³	grooming ⁸⁹⁶ cat ¹⁵⁷⁸ snack ²⁹¹⁶ board ³⁴³⁸ dog ⁵⁴⁸³ training ²⁸¹³³	North-Holland → Texel ²²⁰⁸
beetea.nl	Bee Tea	Bee Tea is a student-owned small business located in Groningen, Netherlands, offering bubble tea, coffee, matcha, and other treats.	Beverages → Tea ⁸²⁹ Tea & Coffee → Tea Houses ⁴²	matcha ⁶⁰ bubble tea ¹⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ student ⁷⁶²³	Netherlands → Groningen ²³⁷³⁴
eetcounterdelauden.nl	Webshop Eetcounter De Lauden	The Eetcounter De Lauden website offers the possibility to order various snacks, fries, and other meals online for delivery. The website contains an extensive menu with different types of fries, snacks, sandwiches, and drinks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Emmen → Klazienaveen ²⁹⁷
allyoucanfriet.nl	All You Can Friet	All You Can Friet is a snack truck rental company based in the north that specializes in providing fresh fries and snacks for private and corporate events.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	snack truck ³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
seysterfriteshuys.nl	LeMau®	‘t Seyster Friteshuys is a restaurant specializing in fresh fries with various toppings and traditional snacks, now located in Zeist.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	croquettes ¹⁰⁸ toppings ¹⁵³ potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Zeist ²⁶⁴⁴
bijbrigitteegmondaanzee.nl	Bij Brigitte	The website of Bij Brigitte in Egmond aan Zee allows customers to order meals online, with a focus on fries, schnitzel dishes, and other snacks.	Fast Food → Fries ⁹⁴⁹	schnitzel ⁶¹ fries ²⁷⁵³ snack ²⁹¹⁶	Bergen → Egmond aan Zee ³⁶²
meiweitime.nl	Cashdesk	The website of Meiwei Time Hilversum allows customers to order and pick up Asian food.	Japanese → Sushi ⁹⁷¹ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	noodles ¹⁹¹ wok ²³¹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ order ⁶⁹¹²	North-Holland → Hilversum ⁴³⁹⁷
surifood-rotterdam.nl	SURIFOOD ZUIDPLEIN HOOG	The website Surifood Zuidplein Hoog offers the opportunity to order meals online from Rotterdam, focusing on Surinamese, Chinese-Indian, and other diverse dishes.	Food Delivery → Surinamese ²⁶⁵	nasi goreng ⁶⁵ beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
toko-helouise.nl	Toko Helouise	Toko Helouise Amstelveen is a Surinamese and Indonesian grocery store offering a wide selection of dishes, sandwiches, snacks, and beverages.	Supermarkets & Grocery → Specialty Stores ⁷⁰ TravelContent → Maps ¹⁴¹	surinamese ⁴¹ indonesian ⁴⁴ beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Holland → Amstelveen ³¹⁸⁰
bobsboatbash.nl	Bob’s Boat Bash	Bob’s Boat Bash is an event where musician Douwe Bob combines his passions for music, food, drinks, and Amsterdam into a night of surprises and live performances on a boat.	Water Travel → Boat Tours ⁶⁴⁰ Parties → Private Parties ¹⁴	snack ²⁹¹⁶ boat ²⁹⁸⁰ concert ⁴⁴⁰⁹ drink ⁵¹⁹¹ artist ⁵⁷⁴⁵ music ¹³¹⁷⁰	North-Holland → Amsterdam ⁴¹²⁵³
silvioswarmehap.nl	Silvio’s Warme Hap	Silvio’s Warme Hap provides a mobile fry and snack wagon for hire to cater events and locations.	Sandwiches & Salads → Snacks ⁶⁹³ Cooking & Recipes → Frying ¹³	fry wagon ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
soetendalurk.nl	Soetendal	The website of Soetendal is a confectionery shop based in Urk that sells sweets, gifts, and various delicacies, and features a blog with information and stories.	Chocolate & Sweets → Confectionery ¹¹⁹ Chocolate & Sweets → Chocolate ⁵⁸⁷	sweets ²²⁹ nuts ⁴¹⁷ chocolate ⁹¹¹ snack ²⁹¹⁶ gift ⁶⁴⁴² blog ¹³³⁹²	Flevoland → Urk ⁷⁶²
bbq-specialistdevisser.nl	BBQ-specialist de Visser	The website of BBQ Specialist de Visser offers barbecue and catering services for both private events and businesses, focusing on quality and service.	Social & Events → Party Services ¹⁸⁷ Performances & Entertainment → Celebrations ⁵⁶⁰	party tent ²⁵⁶ barbecue ¹¹⁷⁵ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
frozu.nl	FROZU	FROZU’s website offers healthy, natural frozen fruit treats for children and families.	Healthy Food → Snacks ²² Home → Dutch Businesses ¹¹	frozen ³¹ healthy ¹⁰⁶ fruit ¹¹⁶⁶ snack ²⁹¹⁶ child ¹¹⁵⁶⁶ brand ¹⁷⁷³⁷
cafetariapassantje.nl	Cafetaria Passantje	The Cafetaria Passantje website in Wageningen provides an online ordering system for snacks, sandwiches, salads, and drinks, with the option to earn points and view promotions.	Cafeteria → Dutch Cafeteria ¹²²	points ⁶¹² promotion ²⁰⁶² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Wageningen ¹⁹⁴⁹
alleswatiklekkervind.nl	alleswatiklekkervind.nl	The website ‘Everything I Love to Eat’ presents recipes for simple, often healthy and delicious meals, with an emphasis on homemade food and avoiding packaged products.	Cooking & Recipes → Breakfast ⁴⁵	smoothie ³⁸⁴ soup ¹⁰⁴³ bread ¹⁶²² snack ²⁹¹⁶ recipe ⁵¹⁴²
ruitersbakkerij.nl	De Ruiters Speculaas	The website of De Ruiters Speculaas describes their tradition and the authentic taste of their speculaas.	Pastry → Cakes ⁸²⁶ Knowledge → Culture ⁸²⁶⁵⁹	speculaas ²¹ spices ³⁴⁰ cookie ⁶⁰² bakery ⁷¹⁸ snack ²⁹¹⁶ coffee ³⁸³⁸	Goeree-Overflakkee → Ooltgensplaat ⁸³
stoelmassageprofs.nl	StoelMassageProfs	The website, StoelMassageProfs, blogs about chair massages, RSI, and health policy, and provides tips for overcoming dips at work.	Specialty Medicine → Occupational Medicine ¹²⁹¹ Personal Care & Services → Vitality ⁵⁶⁵	dip ⁴⁹ secretary ¹⁴¹ office ²⁸⁹⁸ snack ²⁹¹⁶
moqum.nl	Bar Moqum	Bar Moqum is a café in Amsterdam that focuses on a cozy atmosphere, quality, and a modern vibe, emphasizing the informal nickname 'Mokum' for Amsterdam.	Brasseries & Bistros → French ¹⁴¹ Outdoor → Terraces ¹⁸⁸	allergen ⁶⁷ cocktail ⁹²⁵ cafe ¹⁶²² snack ²⁹¹⁶ coffee ³⁸³⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
paulshondenvoer.nl	Pauls Dog Food	The website Pauls Dog Food offers healthy and natural food and snacks for dogs and cats, with a wide range of options from various brands.	Pet Food → Dog Food ³²¹	harness ⁸⁴ dog food ²⁰⁴ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ brand ¹⁷⁷³⁷	Westerkwartier → Zuidhorn ²⁸⁶
snackbar-veronica.nl	Veronica Snackbar	The Veronica Snackbar website offers a mobile snack bar operating in the Purmerend region, providing snack and meal delivery and pickup, with a focus on hamburgers and various other snacks and meals.	Food Delivery → Delivery ²²²⁷ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	hamburger ³⁶⁴ pickup ⁷³⁶ meal ¹⁶³⁸ snack ²⁹¹⁶	North-Holland → Purmerend ²⁶²⁰
debordelaise.nl	Café de Bordelaise	De Bordelaise is a classic beer cafe in The Hague offering an extensive beer selection and a classic interior.	Bars → Pubs ⁵⁴⁶ Cafes → Beer Cafes ²⁰⁹	name ⁶⁸³ cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹ interior ⁸⁰⁹³	South-Holland → The Hague ¹⁹⁸⁹⁸
snackpoint-emmen.nl	Snackpoint Emmen	The website of Snackpoint Emmen presents the product range, opening hours, and services of the snack bar, which has been located in the center of Emmen since 1997.	Quick Bites → Snack Bar ⁵⁸⁰	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	Drenthe → Emmen ³³⁴⁸
trefpuntassen.nl	trefpuntassen.nl	Cafe cafetaria 't Trefpunt in Assen is a cafe/snackbar offering fries, snacks, and drinks, with a focus on 'Raspatat' and a cozy atmosphere.	Quick Bites → Snack Bar ⁵⁸⁰ Bus Services → Public Transportation ⁷⁸²	patat ²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹	Drenthe → Assen ³⁵¹⁶
trimmi.nl	Trimmi	Trimmi is a webshop specializing in unique and stylish dog products, focused on quality and durability.	Pet Supplies → Dog Supplies ¹¹² Animals → Pet Stores ⁴⁷⁸	dog supplies ¹⁵ dog bed ³² leashes ⁴⁰ sleeping bag ⁵⁰ snack ²⁹¹⁶
smultaria-schagen.nl	Smultaria	The Smultaria website, located in Schagen, provides an online ordering system for meals and snacks. Visitors can view the menu and order directly online for delivery.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	plate ⁷⁸⁷ sauce ¹¹⁴¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Schagen ²¹⁸²
wijnbar-kurk.nl	Wijnbar Kurk	Wijnbar Kurk offers a place in the Utrecht city center to enjoy wine, small bites, and a cozy atmosphere.	Wine → Wine Tasting ⁷³⁰ Bars → Wine Bars ¹⁷⁰	oyster ¹¹⁸ chat ⁵⁴⁴ snack ²⁹¹⁶ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ atmosphere ⁵⁵⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
dunya-denhelder.nl	Bakkerij Dunya Den Helder	Bakkerij Dunya Den Helder is an online ordering platform for a diverse selection of dishes, including sandwiches, pizzas, Turkish cuisine, and plates, which customers in Den Helder can order and have delivered.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner ⁶⁷³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Den Helder ¹⁸⁸⁶
smulhoekjemiddelburg.nl	Smulhoekje	't Smulhoekje is a fast-food restaurant in Middelburg offering a variety of snacks and fries.	Fast Food → Fries ⁹⁴⁹	kibbeling ¹¹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Zeeland → Middelburg ²³⁴²
snackbar-thomas.nl	Snackbar Thomas	Snackbar Thomas is a snack bar located in Sassenheim offering various snacks and salads.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Outdoor Dining ⁵⁶	ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Teylingen → Sassenheim ⁵⁹⁹
eetwinkeldewindt.nl	Eetwinkel de Windt	Eetwinkel de Windt is a shop in Kampen that sells various meals and snacks.	Quick Bites → Cafeteria ⁹⁰⁶ Cafes & Lunch → Deli ²³	meal ¹⁶³⁸ buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ package ⁶¹¹²	Overijssel → Kampen ²¹⁶¹
nocandy.nl	Nocandy	The Nocandy website introduces and sells dried fruit, referred to as 'Just Fruit!', as a healthy and natural snack with no unhealthy ingredients.	Healthy Food → Snacks ²²	responsible ¹⁰ dried fruit ¹¹ fruit ¹¹⁶⁶ bag ²³⁹⁹ snack ²⁹¹⁶ energy ⁹⁰⁷⁵
thejuniors.nl	The Junior's - Food Market	The Junior's - Food Market is an online and physical store located in Amsterdam that sells American, Japanese, and British snacks, drinks, breakfast cereals, and various other food products.	Chocolate & Sweets → Sweets ²⁵⁷	candy ²⁰⁵ snack ²⁹¹⁶ food ³⁸⁷² drink ⁵¹⁹¹ webshop ⁸⁶⁴⁸	North-Holland → Amsterdam ⁴¹²⁵³
bowlingwestland.nl	Bowling Westland	Bowling Westland is a bowling alley and escape rooms located in De Lier, also offering a bar and restaurant with dinner.	Games → Escape Rooms ⁴¹⁰ Business → Industry ³⁶⁹⁷⁷	escape room ⁴³⁰ bowl ⁴⁸² bar ¹²¹⁶ snack ²⁹¹⁶ reservation ³³⁷³	Westland → De Lier ⁴⁰⁴
afvallenzondersporten.nl	afvallenzondersporten.nl	This website provides information and tips on how to lose weight without exercising, by focusing on dietary changes.	Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷	calories ⁷⁴ sugar ¹⁰⁰ fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ nutrition ⁴⁹³⁵
cafetariadeklein.nl	Cafetaria de Klein	Cafetaria de Klein is a cafeteria located in Wanssum offering a variety of meals and snacks, emphasizing fresh products and easy ordering.	Quick Bites → Cafeteria ⁹⁰⁶ Foodservice & Catering → Canteens ¹¹	schnitzel ⁶¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Venray → Wanssum ⁸⁴
bartssnelbuffet.nl	Bart's Snelbuffet	The website of Bart's Snelbuffet provides an overview of the menu, opening hours, and contact information, emphasizing customer-friendliness and product quality assurance.	Turkish Cuisine → Fast Food ³²²² Staffing & Recruitment → Personnel ⁴⁷	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ staff ³⁴⁰⁵
kwekkeboom-foodservice.nl	Kwekkeboom Oven & Airfryer	The website of Kwekkeboom Oven & Airfryer offers a range of premium snacks without frying, primarily aimed at the hospitality sector.	Wholesale → Food Products ³⁰³ Sandwiches & Salads → Snacks ⁶⁹³	bitterballs ⁴¹ croquettes ¹⁰⁸ wholesaler ²²⁵ snack ²⁹¹⁶ hospitality ³⁴⁹¹ assortment ⁷⁷⁹⁹
fitafvallen.nl	Digital Vastgood	The website Fitafvallen provides information and articles about weight loss, health, and related topics.	Diets → Low-Carb ²⁶ Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷	weight loss ⁶⁷⁸ diet ⁷⁴⁷ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ health ⁶³⁶⁶
topzz.nl	Topzz	The Topzz website is an online platform for a cafeteria in Almelo, offering fresh and friendly meals, snacks, and ice cream, with a focus on traditional Dutch hamburgers.	Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ tradition ⁷³⁶ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Almelo ²⁶⁹⁶
2tasty.nl	2Tasty	The website of 2Tasty is a catering company that offers catering services both at home and on location, including BBQ's, a private chef service, and delivery of various snacks.	Cooking & Recipes → Culinary ³³⁸ Retail & Commerce → Commerce ⁸²⁴⁴	chef ⁶³¹ bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶
futurefoodlab.nl	FutureFoodLab	FutureFoodLab is an organization that offers workshops to Dutch youth focused on healthy eating and drinking, with the goal of raising awareness about the impact of unhealthy choices and inspiring students to adopt healthier habits.	Nutrition → Healthy Eating ⁶³⁴ Knowledge → Education ⁶⁹⁶⁶⁶	exercise ⁷⁰⁶ choice ⁸²⁷ snack ²⁹¹⁶ food ³⁸⁷² workshop ¹⁹³²⁵
bigsnack-hoogeveen.nl	De Cascade	The website of Snackbar "De Cascade" in Hoogeveen presents a comprehensive menu of fries, snacks, sandwiches, and drinks, with the option to order online.	Fast Food → Fries ⁹⁴⁹ Pastries & Baked Goods → Menus ²²³	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ package ⁶¹¹² menu ¹³⁸⁵⁶	Drenthe → Hoogeveen ²²⁹⁴
cafetariabaseethuis.nl	Cafetaria 't Eethuis	The website of Cafetaria 't Eethuis in Roosendaal presents the cafeteria and offers information about their selection of fries and snacks, opening hours, and contact details.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Roosendaal ²⁶⁷⁷
bocktober.nl	Bocktober Enkhuizen	The website for Bocktober Enkhuizen presents the annual bockbier tour, an event with various stops, snacks, and beers.	Cycling → Cycling Routes ¹⁰⁰² Local & Regional → Regional Events ⁸²¹	establishment ³² ticket ²⁷⁸⁵ snack ²⁹¹⁶ route ³⁴²⁵	North-Holland → Enkhuizen ¹⁰⁶⁴
autobedrijfdehucht.nl	Autobedrijf De Hucht	This website describes the benefits of renting a vending machine for an auto dealership.	Online Marketing → Promotion ⁶¹⁴	vending machine ¹²⁷ snack ²⁹¹⁶ employee ⁴⁴²⁹
cafetariahoogland.nl	Cafetaria Hoogland	Cafetaria Hoogland is a cafe and fast-food restaurant in Hoogland offering a variety of meals, snacks, and ice cream with a focus on quality and responsibility.	Quick Bites → Cafeteria ⁹⁰⁶ Traffic Management → Parking ⁵⁰⁸	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹	Amersfoort → Hoogland ²⁸⁴
aasf.nl	Animalfood And Snacks Factory B.V.	The website of Animalfood And Snacks Factory (AASF) presents the company as a producer of snacks and treats for dogs, cats, and small rodents, with over 15 years of experience.	Animals → Pet Food ⁵⁸⁴	cat ¹⁵⁷⁸ snack ²⁹¹⁶ certification ³³⁸⁰ dog ⁵⁴⁸³	De Fryske Marren → Lemmer ¹¹⁸⁸
amigoleeuwarden.nl	Amigo Pizza	The website Amigo Pizza offers an online ordering system for pizzas, pasta, snacks and drinks in Leeuwarden, with the ability to customize meals and view an extensive menu.	Food Delivery → Delivery ²²²⁷	pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
bakhuusaalburg.nl	Bakhuus Wijk and Aalburg	The website of Bakhuus Wijk and Aalburg offers online ordering of fries, snacks, sushi, and other meals with the option of online payment and delivery. The platform also promotes a loyalty program and newsletters with special offers.	Japanese → Sushi ⁹⁷¹ Fast Food → Fries ⁹⁴⁹	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
bamdesign.nl	Bam Design Catering	Bam Design Catering offers budget-catering services, aiming to provide delicious snacks at attractive prices.	Creative → Video ⁷⁷⁷	snack ²⁹¹⁶ catering ⁶⁴⁵⁶ price ⁸³²⁸ photography ⁹⁵⁰³	Overijssel → Enschede ⁵⁵⁵⁴
baomazing-rotterdam.nl	Baomazing	The website Baomazing is an online platform allowing customers in Rotterdam to order Chinese dishes, including dim sum, bao buns, and rice bowls, for delivery.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	bao bun ¹⁶ rice bowl ¹⁷ dim sum ⁸⁷ rice ⁶³⁵ snack ²⁹¹⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-t-schouwtje-haarlem.nl	Cafetaria 't Schouwtje	Cafetaria 't Schouwtje is an online ordering platform for food in Haarlem, allowing customers to easily order dishes online.	Quick Bites → Cafeteria ⁹⁰⁶	croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
cafetariarestaurantubachsberg-voerendaal.nl	Cafetaria Restaurant Ubachsberg	The website of Cafetaria Restaurant Ubachsberg allows visitors to browse the menu and order online from the restaurant, located in Voerendaal. The restaurant offers a wide variety of dishes, including fries, snacks, vegetarian options, and beverages.	Fast Food → Burgers ⁶⁸⁷ Cuisine → Vegetarian ⁶⁹⁷	vegetarian ³³⁷ beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Voerendaal → Ubachsberg ³⁰
dejongvisspecialist-nieuwegein.nl	De Jong Visspecialist Nieuwegein	The website of De Jong Visspecialist Nieuwegein offers online ordering of various fish-based dishes and snacks.	Fish → Fishmongers ⁸³	kibble ⁴⁶ herring ¹⁵⁶ fish ¹¹²¹ meal ¹⁶³⁸ snack ²⁹¹⁶	Utrecht → Nieuwegein ²²⁶⁴
derotonde-brunssum.nl	De Rotonde	De Rotonde is an online webshop and cafeteria offering fresh fries, snacks, sandwiches and burgers, for takeaway and delivery.	Quick Bites → Cafeteria ⁹⁰⁶	deal ⁷⁷³ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Limburg → Brunssum ⁶²⁶
happy-petlife.nl	HappyPetLife	HappyPetLife is an online shop that primarily focuses on selling food and supplies for dogs.	Animals → Pet Stores ⁴⁷⁸	snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ shop ⁶⁴⁸³ accessories ¹²⁹⁷⁵	Lochem → Almen ¹⁴⁹
keeskroketdenbosch.nl	Kees Kroket Den Bosch	The website Kees Kroket Den Bosch provides an online platform to order meals from the restaurant Kees Kroket in Den Bosch.	Catering & Ready Meals → Takeaway ⁴⁰⁹	croquette ¹³⁶ takeaway ⁶⁵³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
frituretven.nl	Friture ’t Ven	The website of Friture ’t Ven in Venlo showcases a snack bar that offers delivery and takeaway of various dishes, including fries, pizza, shawarma, and salads.	Quick Bites → Snack Bar ⁵⁸⁰	patat ²¹ shawarma ³³⁵ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Limburg → Venlo ⁴¹⁵⁸
deharbarg.nl	Restaurant de Harbarg	Restaurant De Harbarg is a restaurant located at the foot of the Holterberg, offering fries, snacks, lunch dishes, appetizers, main courses, desserts and a children's menu, with special opening hours during weekends and school holidays.	Family & Themed Dining → Family Restaurants ¹⁶⁹ Family Fun → Camping ³³¹²	corona ⁸⁵ weekend ³⁸³ fries ²⁷⁵³ snack ²⁹¹⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Rijssen-Holten → Holten ⁵⁴⁰
awansushi.nl	Awan Sushi & Snack	Awan Sushi & Snack is an online restaurant that delivers sushi, snacks, and other dishes, and where customers can also pick up orders.	Asian → Japanese ¹⁴⁸⁸ Quick Bites → Online Restaurant ¹⁰⁹	points ⁶¹² sushi ¹⁶⁹⁵ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶
tijhofpartyservice.nl	Tijhof Partyservice & Verhuur	Tijhof Partyservice and Rental is a catering company offering a variety of party and catering services.	Sandwiches & Salads → Snacks ⁶⁹³ Recreation → Rental Items ³⁶	high tea ⁵⁸⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Overijssel → Wierden ⁷⁸¹
rabaabcatering.nl	Rabaab Catering	The website Rabaab Catering offers catering services for various occasions, including parties, weddings, corporate events and banquets, with a focus on Indian and Indonesian buffets and individual dishes.	Cafes → Grand Cafés ²²⁸ Performances & Entertainment → Celebrations ⁵⁶⁰	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ quote ¹²⁸⁶³ event ⁴⁵¹⁹⁹
frituurdehaven.nl	Frituur de Haven Zutphen	The website of Frituur de Haven Zutphen offers the possibility to place online orders for a variety of fries, snacks, and drinks.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Zutphen ²⁶⁹⁰
hondinfocus.nl	Hond in Focus	Hond in Focus is an online pet store offering 100% natural dog snacks focused on canine well-being.	Animals → Dogs ⁵⁸⁷⁹ Animals → Pet Stores ⁴⁷⁸	dog snacks ³⁵ natural ²³⁵ snack ²⁹¹⁶ ship ⁵¹⁰³ health ⁶³⁶⁶
tjauwmin.nl	IDFNV	TjauwMin.nl is a website offering Surinamese-Chinese bami, noodle and bami dishes, alongside catering services for various events.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Asian ²⁷²³	bami ¹⁴⁴ noodles ¹⁹¹ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
snackpoint-bunde.nl	Snackpoint Bunde	The Snackpoint Bunde website is an online platform where customers can order and have snacks delivered or picked up in Bunde.	Fast Food → Fries ⁹⁴⁹	ideal ²⁴⁹ evening ²⁸⁷ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Meerssen → Bunde ¹¹³
bellofriet.nl	Bello Friet	Bello Friet is a snack bar located in Bergen and Warmenhuizen offering fresh-cut fries and other snacks.	Fast Food → Fries ⁹⁴⁹ Family Activities → Day Trips ⁴¹⁹	locomotive ⁸⁶ potato ⁵⁴² meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶ hospitality ³⁴⁹¹	Schagen → Warmenhuizen ²⁴⁴
die-eetje.nl	DIEETOOK	The website die-eetje is an online shop that sells protein-reduced, low-salt, gluten-free and lactose-free food products.	Dairy & Cheese → Specialty Food Stores ⁶⁴ Meal Solutions → Food Online Shops ⁸⁰	bread ¹⁶²² snack ²⁹¹⁶ order ⁶⁹¹² assortment ⁷⁷⁹⁹ brand ¹⁷⁷³⁷
eethuislazizpapendrecht.nl	Eethuis Laziz	Eethuis Laziz is an online ordering platform for dishes from Eethuis Laziz in Papendrecht.	Fast Food → Fries ⁹⁴⁹	döner ⁶⁷³ pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Papendrecht ⁸⁷⁶
onlinedierenwereld.nl	Onlinedierenwereld	The website is an online pet store specializing in the sale of quality products for various companion animals.	Dogs → Pet Care ³⁸⁷ Animals → Pet Food ⁵⁸⁴	supplement ¹⁹⁶⁸ animal ²⁹⁰⁸ snack ²⁹¹⁶ food ³⁸⁷² brand ¹⁷⁷³⁷	Gooise Meren → Naarden ¹¹⁵⁴
bakkerijkalkdijk.nl	Bakkerij Kalkdijk	Bakkerij Kalkdijk is an online bakery offering a variety of bread and baked goods, as well as catering services for special occasions.	Pastries & Baked Goods → Pastry Shops ²⁰¹	baker ⁹⁰ waffle ²¹⁸ pastries ⁹⁴⁶ bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶	Drenthe → Coevorden ¹⁴⁹²
durpsherberg.nl	Café de Durpsherberg	Café de Durpsherberg is a special beer café located in Liempde offering a selection of specialty beers, snacks and drinks, as well as options for event hall rental and beer tastings.	Vegan & Vegetarian → Brunch ²⁴ Beverages → Beer ¹⁰⁹⁵	cocktail ⁹²⁵ hall ¹⁷⁸⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶ arrangement ³¹⁰⁴	Boxtel → Liempde ²³²
asperia.nl	Asperia Heeswijk Dinther	The website of Asperia Heeswijk Dinther is an online platform where visitors can directly order and have food delivered.	Quick Bites → Cafeteria ⁹⁰⁶	review ¹⁸⁸⁸ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶
deversebakker.nl	The Verse Bakker	The Verse Bakker is a catering company that provides freshly baked savory and sweet snacks to businesses.	Food Delivery → Delivery ²²²⁷ Healthy Food → Snacks ²²	bakery ⁷¹⁸ snack ²⁹¹⁶ order ⁶⁹¹²	Oost Gelre → Groenlo ⁴²¹
phoenixdiervoeding.nl	Phoenix Diervoeding	Phoenix Diervoeding is a pet specialty store specializing in natural animal feed and supplies.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	supply ⁹⁶¹ snack ²⁹¹⁶ food ³⁸⁷² care ¹²³³⁸	Ede → Otterlo ³⁷¹
dehaveltermade.nl	Cafetaria de Haveltermade	Cafetaria de Haveltermade is a cafeteria in Meppel that sells lunch, snacks, fries, hot drinks and ice cream, with options for vegetarians, people with a gluten-free diet or halal-requirements and delivery services.	Quick Bites → Cafeteria ⁹⁰⁶	satay ³²⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹	Drenthe → Meppel ¹⁹⁰³
versbakkerijleusden.nl	Versbakkerij Leusden	Versbakkerij Leusden is a bakery dedicated to producing honest and healthy bread and baked goods.	Vegan & Vegetarian → Vegan ³⁹⁰	gluten free ¹² vegan ⁵⁰⁸ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶
hypodogs.nl	Hypodogs	Hypodogs is a website offering healthy, hypoallergenic snacks for dogs with allergies or dietary needs.	Pet Food → Dog Food ³²¹ Essential → Food ⁴⁷⁹⁹⁹	allergy ²⁵⁴ snack ²⁹¹⁶
bunkertjelangedijk.nl	Snackbar Het Bunkertje	Snackbar Het Bunkertje is a cafetaria and lunchroom located in Noord-Scharwoude, offering a variety of snacks, sandwiches, and fast food.	Cafes & Lunch → Lunchroom ⁴⁴⁶	ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Dijk en Waard → Noord-Scharwoude ¹⁶⁵
hetpoeliertje.nl	Het Poeliertje	Het Poeliertje is a website focused on selling chicken specialties, offering both fresh and grilled options, and including an online webshop and market stall.	Meat → Chicken ¹²⁷	chicken fillet ³⁵ satay ³²⁰ chicken ⁹⁴⁴ meal ¹⁶³⁸ snack ²⁹¹⁶
cateringpreuf.nl	Catering Preuf	The website Catering Preuf offers catering services for various events, including parties, receptions and BBQs, with a focus on unique flavors and a complete service from A to Z.	Dairy & Cheese → Delicatessens ⁶¹⁷	snack board ¹²² bbq ⁹⁰⁸ flavor ¹⁰³² buffet ¹⁷⁴⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
firstclassbakery.nl	First Class Bakery	The website of First Class Bakery showcases its range of bread and pastry snacks, emphasizing freshness, quality, and sustainability, and provides insight into the company's operations and history.	Local Businesses → Artisan Products ⁵⁶ Bakery & Food Production → Online Bakeries ⁵⁶	baking ¹¹⁹ pastry ²⁰⁶ bread ¹⁶²² snack ²⁹¹⁶ sustainability ¹⁸⁴⁵¹	North-Brabant → Bergeijk ⁷⁷⁵
belcandohondenvoer.nl	Belcando Hondenvoer B.V.	The website is a specialist in dog and cat food from the brand Belcando, Bewi Dog and Leonardo, offering a wide assortment of kibble, snacks and accessories.	Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ cat food ⁹⁸ dog food ²⁰⁴ snack ²⁹¹⁶ package ⁶¹¹² accessories ¹²⁹⁷⁵
cafetariamarktplein.nl	Cafetaria Marktplein	The website of Cafetaria Marktplein presents the menu, opening hours, and contact information for the cafeteria, located in the center of Wijchen. The goal is to provide information about the offerings of snacks, fries and ice cream.	Quick Bites → Cafeteria ⁹⁰⁶ Food & Dining → Outdoor Seating ²²⁸	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶	Gelderland → Wijchen ¹⁵⁷⁹
cornieljecatering.nl	Cornielje Catering	The website of Cornielje Catering offers culinary solutions for events such as corporate events, parties, openings, anniversaries, farewells and funerals, with a focus on homemade snacks and dishes.	Sandwiches & Salads → Snacks ⁶⁹³ Conferences & Meetings → Corporate Events ²⁴⁷²	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
wen-zhou.nl	Wen Zhou	The website Wen Zhou from Rotterdam offers online ordering of Chinese dishes, including rice tables, meat, chicken, fish and vegetable dishes, as well as various snacks and drinks.	Asian → Chinese ⁴¹⁵ Food Delivery → Indonesian ⁵⁰²	rice table ²⁷⁷ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
filmcafeoverasselt.nl	Stichting Verenigingsgebouw Overasselt	Filmcafe Overasselt is a place where visitors can watch films in a relaxed atmosphere.	Personal → Biography ¹⁰⁰³ Village Focus → Village Activities ²⁹	biography ⁶⁹⁷ snack ²⁹¹⁶ film ³⁰⁰⁷ room ³⁴¹¹ agenda ⁴³⁷⁴ volunteer ⁸³⁶⁷	Heumen → Overasselt ¹⁵¹
buddypetfoods.nl	Buddy Pet Foods	Buddy Pet Foods is a website offering natural and honest dog food, directly from Sweden.	Pet Food → Dog Food ³²¹ Nutrition → Supplements ¹⁵⁵⁷	sample pack ³⁷ supplement ¹⁹⁶⁸ ingredients ²³⁴⁶ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
devogelenzang.nl	Cafetaria de Vogelenzang	Cafetaria de Vogelenzang Echteld is an online platform where customers can order burgers and snacks for delivery or pickup. The website also offers an online menu and the option to subscribe to a newsletter for discounts.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Food Businesses ⁵⁷	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Neder-Betuwe → Echteld ⁶⁶³
plein6dussen.nl	Eet- en borrelcafé Plein 6	Eet- en borrelcafé Plein 6 Dussen is a cozy cafe that offers meals, snacks, and meals for home delivery.	Bars & Pubs → Bars ¹⁹³⁸	poke bowls ²⁰ facebook ⁸⁵⁰ meal ¹⁶³⁸ snack ²⁹¹⁶ reservation ³³⁷³ food ³⁸⁷²	Altena → Dussen ⁹⁷
snackbarpleintje.nl	Snackbar 't Pleintje	The website of Snackbar 't Pleintje in Leidschendam offers an online ordering system for snacks and meals, including delivery and pickup options, and regularly organizes prize-winning games and lotteries.	Websites → Local Businesses ⁸⁵ Quick Bites → Snack Bar ⁵⁸⁰	prize wheel ⁴⁰² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
pizzeriaenhotwingsijburg-amsterdam.nl	Pizzeria and Hotwings IJburg Amsterdam	The website of Pizzeria and Hotwings IJburg Amsterdam offers the possibility to order meals online, with an extensive menu featuring pizzas, sandwiches, wraps, hamburgers, snacks and drinks.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	hotwings ¹⁹ hamburger ³⁶⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Amsterdam ⁴¹²⁵³
cafetariadebaksteen.nl	Cafetaria De Baksteen Winschoten	Cafetaria De Baksteen Winschoten is an online platform where customers can order snacks and meals for delivery or takeout in Winschoten.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	ideal ²⁴⁹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Oldambt → Winschoten ⁸³⁰
nelson-cafetaria.nl	Nelson Cafetaria & Sushi	The website of Nelson Cafetaria & Sushi presents a cafeteria and sushi restaurant in Den Bosch offering various dishes including fries, snacks, poke bowls, and sushi.	Japanese → Sushi ⁹⁷¹ Quick Bites → Cafeteria ⁹⁰⁶	poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
hook20.nl	Hoôk 20	The website of Hoôk 20 is an online platform for a cafeteria and lunchroom in Weert.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	lunch menu ²⁰ loaded fries ⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Limburg → Weert ²⁰³⁰
casperdierenwinkel.nl	Casper Dierenspeciaalzaak	The website Casper Dierenspeciaalzaak offers a wide range of products and services for pets, with an even broader selection in the store located in Noord-Scharwoude.	Pets → Cats ⁶³⁹ Animals → Dogs ⁵⁸⁷⁹	harnesses ⁷⁶ collar ²⁴² basket ²⁷⁵ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²	Dijk en Waard → Noord-Scharwoude ¹⁶⁵
zoezoo.nl	ZoeZoo	ZoeZoo is a webshop selling natural and honest pet products, such as food, snacks and care products, for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	harnesses ⁷⁶ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
eerlijkdierenvoer.nl	Eerlijk Dierenvoer	Eerlijk Dierenvoer is a pet store in Ede that sells high-quality dog and cat food.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	biscuit ³⁹ pet ¹⁶¹⁷ snack ²⁹¹⁶ food ³⁸⁷² ship ⁵¹⁰³	Gelderland → Ede ⁵¹⁰⁴
feestje-verhuur.nl	Feestje-verhuur	The website Feestje-verhuur – Alles voor uw feest offers a wide range of products and services for organizing parties, including rental furniture, drinks, party supplies and bouncy houses.	Sandwiches & Salads → Appetizers ⁴⁰ Rental Services & Equipment → Rental Products ⁶⁶	tap installation ¹² bouncy house ⁴² party tent ²⁵⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹	Rucphen → St. Willebrord ¹⁴¹
cafetariatastyjoedewijert-groningen.nl	Cafetaria Tasty Joe De Wijert	Cafetaria Tasty Joe De Wijert is an online platform in Groningen where customers can order food.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	bubble tea ¹⁵³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
thefoodies.nl	thefoodies.nl	The website ‘The Foodies’ is a Dutch foodie blog that publishes articles on various topics related to food, nutrition, recipes, and hospitality.	Supplements → Vitamins ²⁶⁹ Nutrition → Diets ⁹⁵¹	veganism ⁸⁵ scale ¹⁹⁴ snack ²⁹¹⁶ hospitality ³⁴⁹¹ food ³⁸⁷² recipe ⁵¹⁴²
frietfabrique.nl	Friet Fabrique	The Friet Fabrique website is an online service that delivers fresh, crispy fries and various snacks, day and night, to customers in the area.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶
chinnybroodjes.nl	CHINNY	The CHINNY website is a bread shop and catering service based in Rotterdam and The Hague, offering Surinamese sandwiches, meals and snacks, and delivering them.	Lunch → Sandwiches ⁴⁶⁶ Quick Bites → Cafeteria ⁹⁰⁶	soft drinks ⁸⁷ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Rotterdam → Center ³⁸²
theunleashedcompany.nl	The Unleashed Company	The Unleashed Company website is an online shop selling personalized clothing and items, with a focus on dog apparel and corporate wear, as well as various lifestyle products.	Clothing → Workwear ¹⁰⁰¹	snack ²⁹¹⁶ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵ design ²⁷²⁰²
karelskitchen.nl	Karels Kitchen	The website Karels Kitchen in Oldenzaal offers a variety of food services, including takeout lunches, buffets, snacks, catering and food trailers.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Outdoor → Barbecues ⁷⁴⁴	foodtrailer ¹⁸ bbq package ²⁴ lunch ¹⁵³⁴ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Overijssel → Oldenzaal ¹²¹⁹
blomslokaal.nl	Blomslokaal	Blomslokaal offers wine tasting and knowledge sessions for groups, aimed at increasing wine knowledge and enjoying wine.	Wine → Wine Tasting ⁷³⁰ Gifts & Souvenirs → Wine Shops ⁷⁹⁶	taste ⁹³³ session ¹⁷⁹¹ snack ²⁹¹⁶ theme ⁴⁰¹⁵ wine ⁴⁴⁷⁶
baristahans.nl	Outdoor Adventure – Catering	The website of Outdoor Adventure – Catering offers coffee, snacks and catering services at various events and campsites in the region, especially around walking, cycling and bird watching.	Outdoor & Recreation → Outdoor Events ¹¹⁰ Recreation → Recreational Activities ⁶⁵	camp ²⁴⁶⁶ snack ²⁹¹⁶ coffee ³⁸³⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
subify.nl	Subify	Subify is a website offering subscriptions for various products, including vegetables, fruit, razors, and household items, delivered monthly or weekly to your door.	Sandwiches & Salads → Snacks ⁶⁹³ Personal & Household → Household Services ¹⁰⁵⁰	cheese ¹²⁰⁵ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ subscription ³²⁸⁷ wine ⁴⁴⁷⁶
puikborrelplank.nl	Puik Borrelplank	The Puik Borrelplank website offers a wide selection of various snack boards, ranging from themes like Italian and Spanish to vegetarian and sweet options. The site also facilitates the creation of a custom snack board and online ordering of these products.	Cooking & Recipes → Dishes ³³⁵	snack board ¹²² plank ¹⁶² snack ²⁹¹⁶ theme ⁴⁰¹⁵ order ⁶⁹¹² price ⁸³²⁸
sandrasdierenwinkel.nl	Sandra’s Dierenwinkel	Sandra’s Dierenwinkel is a pet store offering a wide variety of products for different animal species and fishing supplies.	Pets → Cats ⁶³⁹ Animals → Dogs ⁵⁸⁷⁹	fishing ⁴²⁴ feed ⁶⁷² toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²	Waadhoeke → Menaam ⁷²
dehoender.nl	De Hoender	De Hoender is a restaurant that offers snacks and lunch dishes, with options for takeaway or dine-in.	Catering & Ready Meals → Outdoor Dining ⁵⁶	snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ order ⁶⁹¹²
ceobar.nl	Bubble Tea Amsterdam	The website of Bubble Tea Amsterdam offers various types of bubble tea drinks, Italian coffee, and snacks in the city of Amsterdam.	Sandwiches & Salads → Snacks ⁶⁹³ Beverages → Tea ⁸²⁹	bubble tea ¹⁵³ bar ¹²¹⁶ snack ²⁹¹⁶ coffee ³⁸³⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
friethuys-nova.nl	Friethuys Nova	The website of Friethuys Nova presents a snack restaurant located in Winkelcentrum Nova in Utrecht, offering fresh fries and a wide variety of snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	shopping center ⁴⁹¹ potato ⁵⁴² sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Southwest ²⁴⁷
maukcatering.nl	MAUK Catering	MAUK Catering is a catering company that offers a variety of meals and snacks, including BBQs, buffets, finger foods, and party snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Cooking & Recipes → BBQ ²³⁶	bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	Barneveld → Voorthuizen ⁵⁴¹
tijdvoorvega.nl	Tijd voor Vega	Tijd voor Vega is a website providing information about vegetarian dishes and a vegetarian lifestyle.	Asian → Chinese ⁴¹⁵ Vegan & Vegetarian → Vegan ³⁹⁰	dim sum ⁸⁷ vegan ⁵⁰⁸ snack ²⁹¹⁶ recipe ⁵¹⁴² blog ¹³³⁹²
lucsloempias.nl	Luc's Loempia's	Luc's Loempia's is a wholesaler specializing in authentic Vietnamese snacks.	Cooking & Recipes → Dishes ³³⁵	spring rolls ¹⁴¹ snack ²⁹¹⁶
cafetariathegrant.nl	Cafetaria The Grant	Cafetaria The Grant is a cozy cafe and catering service located in Langeraar, offering classic American diner-style snacks, ice cream, and event catering.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	appetizer ⁵⁵⁶ bbq ⁹⁰⁸ ice cream ¹⁰⁰⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Nieuwkoop → Langeraar ⁶³
broodjeszaaktenbeste-utrecht.nl	Cafetaria Ten Beste	Cafetaria Ten Beste is an online ordering platform for dishes and snacks in Utrecht.	Fast Food → Döner ²³⁸ Fast Food → Fries ⁹⁴⁹	kapsalon ⁵⁰⁹ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
desluiscatering.nl	De Sluis Catering	The website of De Sluis Catering showcases and promotes its catering services, focusing on renting out food trucks for fries, woks, and offering luxury snacks for events and corporate gatherings.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	fryer ³⁸ foodtruck ⁶¹³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
bortan.nl	Bart Bollen	The website is a personal blog by Bart Bollen that publishes articles on a variety of topics.	Personal Finance → Budgeting ⁶⁷⁶	eating ⁸³ investing ⁹¹¹ politics ¹²⁵⁹ snack ²⁹¹⁶ culture ³⁹²²
cateringdehaan.nl	Catering and Partyservice Raymond de Haan	The website of Catering de Haan presents a catering company that offers a variety of buffets, snacks, and meal services, with special attention to organizing parties and events, both for individuals and businesses.	Cafes → Grand Cafés ²²⁸	meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Dalfsen → Lemelerveld ¹⁸⁴
expatacademy.nl	ExpatAcademy	The ExpatAcademy website provides information and a rental service for vending machines, targeting offices, expat communities, and student residences, and also serves as a platform for finding rental agents in Utrecht.	Rental Properties → Renting ³⁸⁶ Office & Workspace → Office Supplies ¹⁰⁸⁶	vending machine ¹²⁷ expat ³⁴⁴ snack ²⁹¹⁶ rental ⁷²⁵⁷
alysbiologischecatering.nl	Aly's Biologische Catering	Aly's Biologische Catering is a catering company specializing in providing organic meals, buffets, lunch boxes, and snacks for various events in the Utrecht and Amsterdam regions.	Catering → Buffets ²⁷⁷ Celebratory Occasions → Reception ¹⁰⁷	lunchboxes ⁴¹ bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
lokalebierproeverij.nl	Local Beer & Wine Tasting	The website offers beer and wine tasting experiences in the region.	Hobbies → Beer Enthusiasts ¹⁹ Beverages → Beer ¹⁰⁹⁵	brewery ⁴⁹⁸ taste ⁹³³ occasion ²⁰³⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶
dekrooneetcounter-groningen.nl	The Kroon Eetcounter	The Kroon Eetcounter is an online ordering platform for food in Groningen.	Fast Food → Fries ⁹⁴⁹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
cafetariaramon.nl	Cafetaria Ramon	Cafetaria Ramon is a snack bar located in Arnhem, Netherlands, known for its snacks, sandwiches, and fries.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
cafetariapassage.nl	Cafetaria De Passage Malden	Cafetaria De Passage Malden's official website offers online ordering, delivery, and takeaway options for a wide range of dishes.	Quick Bites → Hair Salon ¹¹² Quick Bites → Cafeteria ⁹⁰⁶	beverage ⁵⁸⁶ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Heumen → Malden ³⁹¹
unclejohnleyweg.nl	Uncle John	Uncle John is a restaurant in The Hague that serves fresh fries, hamburgers, and snacks, and offers delivery services.	Food Delivery → Delivery ²²²⁷	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
snacklinegijsbrecht.nl	Snackline Gijsbrecht	Snackline Gijsbrecht is a snack business in Hilversum offering a wide range of food and drinks.	Wholesale → Food Products ³⁰³ Quick Bites → Snack Bar ⁵⁸⁰	croquette ¹³⁶ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
cafetariabol.nl	Cafetaria Broek Op Langedijk	The website of Cafetaria Broek Op Langedijk provides an online ordering system for food and drinks, with the option for home delivery and takeaway.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	chicken dishes ²⁶ menus ²²¹ points ⁶¹² snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹²	Dijk en Waard → Broek op Langedijk ²⁴³
friturevogels.nl	Friture Vogels	The website of Friture Vogels offers a service providing a mobile fries truck (frietwagen) to various locations for events and occasions.	Fast Food → Fries ⁹⁴⁹ Telecommunications → Mobile Services ¹⁵⁰	fry truck ³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹² event ⁴⁵¹⁹⁹
wokkieensnackie.nl	Wokkie & Snackie	The website of Wokkie & Snackie is an online platform for ordering Asian dishes, including wok dishes, Vietnamese specialties, and various snacks, for delivery and takeaway in Helmond.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Asian Restaurant ¹⁶³	vietnamese ²¹ wok ²³¹ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
duinzichtbezorgd.nl	Cafetaria Duinzicht	The website of Cafetaria Duinzicht presents the menu, opening hours and contact details of a frituur (fast food restaurant) located in Julianadorp.	Websites → Ordering Sites ⁷⁵	pickup ⁷³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Den Helder → Julianadorp ³⁰⁴
bedo.nl	Bero Imex B.V.	BeDo Imex is a broker specializing in dry foods and offers a wide range of products.	Sweets → Candy ⁷⁷	popcorn ⁴² candy ²⁰⁵ chocolate ⁹¹¹ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Gelderland → Scherpenzeel ⁴¹⁴
hondencentrumsamen.nl	Hondencentrum Samen	Hondencentrum Samen is an organization that offers dog training and nutritional advice.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	anxiety ¹⁵⁹⁶ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ training ²⁸¹³³	Westerwolde → Bellingwolde ⁹⁷
warungsosolobi-rotterdam.nl	Warung So So Lobi	The website of Warung So So Lobi offers the possibility to order dishes online from the Warung in Rotterdam.	Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackpoint-parapluke.nl	Snackpoint 't Parapluke	The Snackpoint 't Parapluke website is an online ordering platform for meals, snacks, and drinks, offering options for home delivery, takeaway, and the chance to win prizes.	Fast Food → Fries ⁹⁴⁹	prize wheel ⁴⁰² fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Valkenburg aan de Geul → Valkenburg ⁹²²
hendomarnixstraat.nl	Snackbar Hendo Marnixstraat Leiden	Snackbar Hendo Marnixstraat Leiden offers a variety of snacks, sandwiches, and drinks, and also provides catering services.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	South-Holland → Leiden ⁷⁰⁸⁹
deliesta.nl	Deliesta Food & Drinks	Deliesta Food & Drinks is a foodtruck specializing in providing snacks and drinks for various events.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	foodtruck ⁶¹³ snack ²⁹¹⁶ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹ event ⁴⁵¹⁹⁹	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
lunchroom-drentskwartiertje.nl	Lunchroom – Cafetaria Drents Kwartiertje	The website of Cafetaria Lunchroom Drents Kwartiertje is an online platform presenting the menu and opening hours of a lunchroom and cafe in Nieuw-Roden, offering online ordering and delivery services for businesses.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	delivery service ²³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶	Noordenveld → Nieuw-Roden ⁵⁰
hondensnackshop.nl	Hondensnackshop b.v.	The website of Hondensnackshop is a wholesaler specializing in dried snacks and food for dogs.	Wholesale → Food Products ³⁰³ Pet Food → Dog Food ³²¹	bone ³⁵ trainer ¹⁹⁶⁶ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷² assortment ⁷⁷⁹⁹	Overijssel → Haaksbergen ⁸⁸⁷
snackplazaschalkhaar.nl	Snack Plaza	The website of Snack Plaza in Schalkhaar provides the opportunity to order various snacks and dishes for pickup or delivery in the Deventer area and surrounding locations. It also offers information on opening hours, locations, and the possibility of eating on-site.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	snack ²⁹¹⁶ opening hours ²⁹⁵³ account ⁵⁷⁸¹ order ⁶⁹¹²	Lochem → Gorssel ²⁸³
kolenkit.nl	Snackcounter De Kolenkit	The website of Snackcounter De Kolenkit presents the catering and snack services of the company, focusing on delivery and catering for events and meetings in the Wateringen area.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	party tent ²⁵⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	The Hague → Escamp ²⁵⁸
friturepan.nl	Friture Pan	The website of Friture Pan presents a snack restaurant located in Swalmen, offering both on-site and takeaway fries and other snacks.	Meal Solutions → Food Businesses ⁵⁷	telephone ²⁰⁹ parking ¹⁹²⁸ fries ²⁷⁵³ snack ²⁹¹⁶ restaurant ¹¹²¹⁵	Roermond → Swalmen ²⁵⁴
snackbarleeuwerik.nl	Snackbar Leeuwerik Supersnack	The website of Snackbar Leeuwerik Supersnack presents the opening hours, menu and address of the snack bar, located in Purmerend.	Sandwiches & Salads → Snacks ⁶⁹³	milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	North-Holland → Purmerend ²⁶²⁰
biopetfood.nl	BioPetFood	BioPetFood.nl is an online store dedicated to providing pet food, grooming products, and accessories for dogs, cats, small rodents, and birds.	Pet Food → Dog Food ³²¹ Animals → Pet Stores ⁴⁷⁸	grooming products ⁵² aquarium ³²⁰ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵
bellisimo-milano.nl	Bellisimo Milano Oud-Beijerland Molenaar	The website Bellisimo Milano Oud-Beijerland Molenaar offers the possibility to order food online from the restaurant's menu located in Oud-Beijerland.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Diner ³⁵	kapsalon ⁵⁰⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
vendingzone.nl	VendingZone	The VendingZone website provides a full-service vending machine solution, primarily targeting larger organizations that want to provide their employees, visitors, or customers with access to snacks and drinks without having to manage the machines themselves.	Logistics & Transportation → Vending Machines ⁶⁹	payment ¹³⁸⁹ snack ²⁹¹⁶ machine ³⁷²⁷ drink ⁵¹⁹¹	Netherlands → North-Brabant ⁷³³⁴¹
pisaoldebroek.nl	Pisa Oldebroek	Pisa Oldebroek is a restaurant located in Oldebroek that offers a diverse menu including pizzas, meat dishes, salads, and snacks. The restaurant also provides delivery services in the surrounding area.	Supermarkets & Grocery → Local Supermarkets ⁵⁶ Food → Meat ¹¹²³	meat dishes ⁶⁶ delivery service ²³⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Elburg → Spoorstraat ¹⁴²
cafetaria-hout.nl	Cafetaria ’t Hout	Cafetaria ’t Hout is a cafeteria located in Mierlo-Hout, Helmond, offering a unique dining experience with freshly cut fries and homemade snacks.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Helmond → Mierlo-Hout ⁶²
cafepinkeltje.nl	Cafe-Cafetaria Pinkeltje Rijswijk	The website of Cafe-Cafetaria Pinkeltje in Rijswijk offers an online ordering system for food and drinks, including delivery and a menu with various dishes and snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rijswijk ²⁰⁵⁴
restaurantstein.nl	Restaurant Bar Stein	Restaurant Bar Stein is a restaurant and hotel offering an à la carte restaurant, bar, and various drinks and snacks, located in the Van der Valk Hotel Gorinchem, inspired by the historical Slot Loevestein.	Mediterranean & Middle Eastern → Spanish Restaurants ²¹⁴ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	cocktail ⁹²⁵ snack ²⁹¹⁶ reservation ³³⁷³ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵	South-Holland → Gorinchem ¹⁹⁴⁷
snacksalonlaplaza.nl	Snacksalon La Plaza	The website of Snacksalon La Plaza in Bunschoten-Spakenburg showcases the snack bar, its products, catering services, and delivery options.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	pickup ⁷³⁶ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Bunschoten → Bunschoten-Spakenburg ³⁸²
the-snackbar-corner-rotterdam.nl	The Snackbar Corner Rotterdam	The Snackbar Corner Rotterdam website offers an online ordering system for food and drinks in Rotterdam, featuring an extensive menu including fries, snacks, burgers, and various beverages.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	croquette ¹³⁶ milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
transfemhaarlem.nl	Transfem Haarlem	The website is for a Haarlem-based organization that supports transfem people, offering a community space, resources, and events.	Anthropology & Sociology → Gender Studies ⁵⁷ Community & Social → LGBTQ ⁶⁷	meetup ⁶⁷ resources ³¹⁰ snack ²⁹¹⁶ community ⁷⁹³¹ event ⁴⁵¹⁹⁹	North-Holland → Haarlem ⁸⁶⁷⁴
mifoodandmore.nl	MI Food&More	MI Food&More offers a meal service for various occasions and parties.	Brasserie → Dutch Brasseries ¹⁰	meal service ⁶⁵ high tea ⁵⁸⁵ buffet ¹⁷⁴⁷ salad ²⁴⁴⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
veldman-vlees.nl	Slagerij Veldman	Slagerij Veldman is a butcher shop located in Joure, Friesland, specializing in the sale of artisanal and honest meat, including sausages, beef, pork, and chicken, with a particular focus on the Kesburger hamburger.	Supermarkets & Grocery → Butchers ⁷⁴⁷	sausage ²⁵⁶ spices ³⁴⁰ buffet ¹⁷⁴⁷ meat ²⁰⁵⁵ snack ²⁹¹⁶	De Fryske Marren → Joure ⁶⁸⁹
cravtbrouwlokaal.nl	Cravt Brouwlokaal	Cravt Brouwlokaal is a location in Uden that focuses on experiencing and tasting beverages, with an emphasis on sharing the stories behind the beers, wines, gins, and whiskeys they offer.	Bars & Pubs → Bars ¹⁹³⁸ Festivals → Carnival ¹¹⁵⁰	beverage ⁵⁸⁶ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ atmosphere ⁵⁵⁹¹ story ⁸²⁸⁵	Maashorst → Uden ¹⁵⁴⁰
cafetariavannesstraat.nl	Cafetaria de van Nesstraat	Cafetaria de van Nesstraat is a restaurant in Alphen aan de Rijn offering online ordering for delivery and takeout, and visitors have the chance to win prizes and lottery prizes.	Fast Food → Shoarma ⁹⁰ Cooking & Recipes → Cuisine ¹¹⁴⁷	prize wheel ⁴⁰² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
snacksvanlex.nl	Snacks van Lex	The Snacks van Lex website is an online platform where customers can order fries and snacks online, pick them up, or have them delivered in Willemstad.	Quick Bites → Snack Bar ⁵⁸⁰	pickup ⁷³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
cafetariatorenveld.nl	Cafetaria Torenveld	Cafetaria Torenveld is a cafeteria in Zevenbergen that has been operating since 1972 and offers fries, snacks, and ice cream.	Quick Bites → Cafeteria ⁹⁰⁶	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ hospitality ³⁴⁹¹	Moerdijk → Zevenbergen ⁵⁰²
smulkamer.nl	De Smulkamer	De Smulkamer is a bakery and coffee shop that focuses on people with functional impairments, where they learn and work.	Beverages → Tea ⁸²⁹ Entrepreneurship → Social Enterprises ²⁹⁹	trainee ¹⁰⁵ bakery ⁷¹⁸ cake ¹⁷³⁰ snack ²⁹¹⁶ coffee ³⁸³⁸ atmosphere ⁵⁵⁹¹
vanderlanscatering.nl	Van der Lans Catering	Van der Lans Catering is a caterer based in the Bollenstreek (bulb region) offering catering services and party catering, including barbecues, buffets, and snacks, with 24/7 ordering available through an online shop.	Sandwiches & Salads → Snacks ⁶⁹³	barbecue ¹¹⁷⁵ online shop ¹³¹⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
debaakhoeve.nl	De Baakhoeve	The De Baakhoeve website is an online shop offering balanced food, snacks, and supplements for dogs and cats, and the owner also provides dog grooming services.	Dog Care → Grooming Salons ⁶⁵¹ Animals → Pet Food ⁵⁸⁴	coat ⁴⁶⁰ cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³	Echt-Susteren → Susteren ²¹⁸
nutricanis.nl	Nutricanis	Nutricanis.nl is an online retailer that offers premium dog food and snacks, focusing on grain-free nutrition and high-quality ingredients.	Pet Food → Dog Food ³²¹	dog food ²⁰⁴ ingredients ²³⁴⁶ snack ²⁹¹⁶
vishandeldiemerplein.nl	Vishandel Diemerplein	Vishandel Diemerplein is a fish specialty shop in Diemen that offers a wide range of seafood dishes and snacks.	Fish → Fishmongers ⁸³ Local & Regional Products → Local Shops ²⁴⁵	combination ¹⁸⁹ fish ¹¹²¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹ sustainability ¹⁸⁴⁵¹
eetwinkelhendrikselst.nl	Eetwinkel Hendriks	Eetwinkel Hendriks is a shop in Elst offering a wide assortment of food and drinks, including snacks, sandwiches, catering, and pre-packaged meals. The website provides online ordering and information about special promotions.	Quick Bites → Cafeteria ⁹⁰⁶ Supermarkets & Grocery → Fresh Products ³⁷	kidsbox ³⁸ menus ²²¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Overbetuwe → Elst ⁸⁸⁶
debanksantpoort.nl	Restaurant & Wijnbar de Bank	De Bank Santpoort is a restaurant and wine bar offering a pleasant place for dining, snacks and drinks, as well as events.	Bars → Wine Bars ¹⁷⁰ Bars & Pubs → Wine Restaurants ⁵¹	wine bar ¹²⁸ taste ⁹³³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ party ⁵⁹²⁸ restaurant ¹¹²¹⁵	Velsen → Santpoort-Noord ⁶⁰⁶
rolingsnacks-sushi.nl	Roling Automatiek	The website Roling Automatiek is the official website of a company that delivers snacks, sushi, and fries in Hilversum, offering online ordering, pickup, and delivery options.	Food Delivery → Delivery ²²²⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	ideal ²⁴⁹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
deenkhuizernotenkraam.nl	Notenkraam	Notenkraam webshop offers freshly baked nuts and snacks, with home delivery.	Vegetables → Nuts ¹⁰⁴	nuts ⁴¹⁷ seed ⁵⁹⁹ chocolate ⁹¹¹ market ²⁷⁷² snack ²⁹¹⁶	Flevoland → Almere ⁷⁷⁶⁵
koningvis.nl	Vishandel Koning Bennebroek	The website of Vishandel Koning Bennebroek presents a wide assortment of fish specialties, with a focus on fresh fish, baked and smoked fish, and various dishes and snacks.	Fish & Seafood → Fish ³⁸⁸ Food → Supermarkets & Grocery ³⁵⁶⁸	herring ¹⁵⁶ fish ¹¹²¹ snack ²⁹¹⁶ dish ⁵⁹³⁶	Edam-Volendam → Volendam ⁹⁴⁸
ramenheaven.nl	RamenHeaven	The website RamenHeaven.de is an online shop specializing in Asian foods, including ramen, snacks, sauces, and ingredients.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Sauces & Condiments → Asian Food ¹⁵	ramen ¹⁰⁶ noodles ¹⁹¹ sauce ¹¹⁴¹ ingredients ²³⁴⁶ snack ²⁹¹⁶
deversepieperopwielen.nl	De Verse Pieper op Wielen	The website of De Verse Pieper op Wielen offers the rental of fresh fries and snacks on location.	Fast Food → Fries ⁹⁴⁹ Cuisine → Dutch Cuisine ¹⁷⁹	foodtruck ⁶¹³ fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹² event ⁴⁵¹⁹⁹	North-Brabant → Nuenen ca ⁹⁰⁶
snackeethuishugo.nl	Snackbar & Eethuis Hugo	The website of Snackbar & Eethuis Hugo in Heerhugowaard presents the menu, opening hours, catering options, and the ability to order online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	soft ice cream ¹⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ order ⁶⁹¹²	Dijk en Waard → Heerhugowaard ²⁰¹¹
cafetariabaarn.nl	Cafetaria Hartje Baarn	The website of Cafetaria Hartje Baarn is an online presence of a snack bar in Baarn, offering a variety of fries, snacks, and meals.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ hamburger ³⁶⁴ kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Baarn ¹⁶²⁸
gunstigehapjes.nl	Gunstige Hapjes	Gunstige Hapjes is a company that provides luxury snacks and appetizer boards for various occasions.	Cafes → Dutch Restaurants ¹⁰³¹ Events & Hospitality → Parties ³³	appetizer board ¹⁴ pastries ⁹⁴⁶ lunch ¹⁵³⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Meierijstad → Veghel ¹²⁸⁸
willemscorner.nl	Willems Corner	Willems Corner, located in Doetinchem, is a business offering a variety of snacks and milkshakes, including gluten-free and vegetarian options, and organizes children's parties and group reservations.	Quick Bites → Snack Bar ⁵⁸⁰ Parties → Birthday Parties ¹⁰⁰⁸	gluten-free ¹⁵⁶ milkshake ¹⁹⁵ vegetarian ³³⁷ wifi ¹³⁷² snack ²⁹¹⁶	Gelderland → Doetinchem ²⁷⁰⁶
automatiekspeciaalwinschoten.nl	Automatiek Speciaal	The website of Automatiek Speciaal in Winschoten presents a snack bar that sells fresh fries, snacks, and ice cream, with a focus on innovation and contactless payment.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ ice cream ¹⁰⁰⁰ payment ¹³⁸⁹ fries ²⁷⁵³ snack ²⁹¹⁶	Oldambt → Winschoten ⁸³⁰
loket13-zutphen.nl	Loket 13 Zutphen	The Loket 13 Zutphen website is an online platform where customers can order fries, snacks, and other treats for delivery. It also offers opportunities to collect loyalty points and subscribe to newsletters.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Zutphen ²⁶⁹⁰
bestelflorence.nl	Pizzeria Florence	The website of Pizzeria Florence in Kesteren offers an online menu with a wide selection of pizzas, pasta dishes, sandwiches, and snacks, available for takeout or delivery.	Food Delivery → Delivery ²²²⁷	pasta ¹³⁸⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Neder-Betuwe → Casterhoven ²⁴⁸
petsbytanja.nl	Pets by Tanja	Pets by Tanja is a webshop that offers premium quality dog food, snacks, and accessories.	E-Commerce → Product Categories ¹⁸ Online Retail → Food Retail ³⁴⁰	dog food ²⁰⁴ discount code ²⁷² snack ²⁹¹⁶ accessories ¹²⁹⁷⁵
bloemendaldiervoeders.nl	Bloemendal Diervoeders	Bloemendal Diervoeders is a producer and wholesaler of pet food and snacks, primarily for dogs and cats.	Wholesale → Food Products ³⁰³ E-Commerce → Pet Supplies ¹⁰¹³	pet food ¹¹⁰ private label ¹⁸⁴ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Overijssel → Almelo ²⁶⁹⁶
snackbarvanforeest.nl	Snackbar Van Foreest Julianadorp	The website of Snackbar Van Foreest Julianadorp presents the snack bar located in Julianadorp aan zee and provides an overview of the menu, opening hours and contact details.	Fast Food → Fries ⁹⁴⁹ Beach Life → Beach ⁵³²	potato ⁵⁴² plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Den Helder → Julianadorp ³⁰⁴
tgeveltje-alphenaandenrijn.nl	t Geveltje	The website 't Geveltje offers online ordering for food and drinks in Alphen aan den Rijn, featuring a comprehensive menu with fries, snacks, sandwiches, and other meals.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
istanbul-echt.nl	Cafetaria Istanbul Echt	The website of Cafetaria Istanbul Echt offers the possibility to order online and have various dishes and drinks delivered.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Takeaway ⁴⁰⁹	lahmacun ⁹³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Echt-Susteren → Echt ⁴⁵⁴
dehondenkraam.nl	The Hondenkraam	The Hondenkraam is an online shop that sells products and accessories for dogs and cats.	E-Commerce → Pet Supplies ¹⁰¹³	leashes ⁴⁰ grooming ⁸⁹⁶ bed ¹³⁸⁴ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
kccatering.nl	KC Catering	The website of KC Catering offers catering services for businesses and private individuals, with a particular focus on hot and cold buffets and various arrangements for parties and events.	Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ arrangement ³¹⁰⁴ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Westerkwartier → Leek ⁶⁴²
shelma.nl	Partner in Pet Food CZ, s.r.o.	The website of Shelma offers premium, grain-free food for cats in the form of kibble, pouches, and snacks.	Nutrition → Animal Nutrition ³⁸	kibble ⁴⁶ pouch ⁶⁸ superfood ¹⁰³ protein ²⁹⁹ snack ²⁹¹⁶
cafetariasucces.nl	Cafetaria Succes Norg	The website of Cafetaria Succes in Norg provides information about their menu, ice cream offerings, and opening hours, functioning as a popular snack restaurant in the town.	Quick Bites → Snack Bar ⁵⁸⁰ Events → Places ¹²¹⁹	snack bar ¹⁶² ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Noordenveld → Norg ³²²
snackbar-de-instuif-hilversum.nl	Snackbar de Instuif	The website of Snackbar de Instuif in Hilversum offers the possibility to order food online. Users can view a menu and place orders for a quick meal.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Hilversum ⁴³⁹⁷
bigbreadvoorthuizen.nl	Big Bread Kitchen 'De Uitdaging'	The website of Big Bread Kitchen 'De Uitdaging' in Voorthuizen offers online ordering and takeaway options for a wide range of products, including bread, snacks, salads, sandwiches and ice cream.	Restaurants & Dining → Takeaway Restaurants ²⁴⁰ Cooking & Recipes → Cuisine ¹¹⁴⁷	takeaway ⁶⁵³ bread ¹⁶²² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Barneveld → Voorthuizen ⁵⁴¹
molco-foodservice.nl	Molco Bakery	The Molco Bakery website showcases a comprehensive range of bakery products, catering to bakeries, foodservice companies, and retailers. It also provides recipes and inspiration for the hospitality industry.	Promotional Products → Marketing Materials ²²¹ Pastries & Baked Goods → Organic Bread ⁸⁶	pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶ inspiration ⁴⁰⁸¹ recipe ⁵¹⁴² brand ¹⁷⁷³⁷
pet-specials.nl	Pet Specials	Pet Specials is an online shop offering high-quality animal food and supplies.	Food → Pet Supplies ⁹⁴	animal food ¹⁵ pet supplies ¹¹⁰ pet ¹⁶¹⁷ snack ²⁹¹⁶ knowledge ³⁵²⁸ assortment ⁷⁷⁹⁹	Zeeland → Middelburg ²³⁴²
cafetariaflintrop.nl	Cafetaria Flintrop	The website of Cafetaria Flintrop in Gendt offers an online ordering system for delicious snacks and provides information about the cafeteria, including opening hours and the benefits of online ordering.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	Lingewaard → Gendt ¹⁹⁰
rebelfoodandbar.nl	Rebel Food & Bar	The Rebel Food & Bar website in Oss showcases the amenities and activities of a bar and restaurant, with a special focus on cocktails, themed parties, and live music.	Bars → Cocktail Bars ²³⁶ Performance → Live Music ¹⁶¹²	rum ⁸⁴ theme party ¹⁴³ cocktail ⁹²⁵ snack ²⁹¹⁶ music ¹³¹⁷⁰	North-Brabant → Oss ²⁹⁶²
amis-maastricht.nl	Amis Grill & Snacks Maastricht	The website Amis Grill & Snacks Maastricht is an online platform where visitors can order snacks, wraps, pizzas and other meals for delivery or takeout. The restaurant offers an extensive menu and facilitates easy online payments.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Limburg → Maastricht ⁶⁰⁰⁸
boulevard1.nl	Cafetaria Boulevard1	The website of Cafetaria Boulevard1 in Breskens showcases the range of drinks, snacks, and fries offered by the cafe, as well as opening hours and takeaway options.	Places → Towns ³⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹	Sluis → Breskens ²⁹⁴
snackswaard.nl	Snackswaard Valkenswaard	The Snackswaard Valkenswaard website is an online platform where customers can order fries, snacks, and other dishes for delivery or pickup. It offers an extensive menu and facilities for online payment and app ordering.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Valkenswaard ¹¹⁷⁹
cafetariadehoek.nl	Cafetaria De Hoek	Cafetaria De Hoek is a cafe and snack bar located in Nieuwveen, offering fries, snacks, sandwiches, and catering services to local residents.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶	Nieuwkoop → Nieuwveen ¹⁷⁷
cafetariakamrad.nl	Cafetaria Kamrad	Cafetaria Kamrad is a cafe located in Hilversum that offers traditional snacks, sandwiches and meals.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Hilversum ⁴³⁹⁷
grandbras.nl	BroodjesExpress	The website of BroodjesExpress presents a lunchroom and terrace in the Walburg Shopping Center in Zwijndrecht, offering a wide range of sandwiches, coffee, snacks, and ice cream.	Ice Cream → Ice Cream Parlors ⁵²¹ Food & Dining → Outdoor Seating ²²⁸	milkshake ¹⁹⁵ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	South-Holland → Zwijndrecht ¹⁴⁵⁵
hunters-home.nl	Hunters Home	Hunters Home provides pet food products for dogs and cats based on natural ingredients, with a particular focus on raw meat and ready-to-use food.	Pet Food → Dog Food ³²¹	slaughterhouse ⁴² dog food ²⁰⁴ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷²
burgerexpressroosendaal.nl	Burger Express	The website Burger Express offers the possibility to order various sandwiches, snacks, and drinks online for delivery. It also offers Msemen and Kapsalons.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	soft drink ³⁹ kapsalon ⁵⁰⁹ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Brabant → Roosendaal ²⁶⁷⁷
partyhaptilburg.nl	PartyHap Tilburg	PartyHap Tilburg is a caterer based in the Reeshof, Tilburg, offering party catering for various occasions and events.	Asian → Chinese-Indian ⁵⁴ Fast Food → Fries ⁹⁴⁹	payment ¹³⁸⁹ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ order ⁶⁹¹² event ⁴⁵¹⁹⁹	Tilburg → Reeshof ¹⁶⁸
eetsalonderotonde.nl	Eetsalon De Rotonde	Eetsalon De Rotonde is a cafe in Tilburg that has been offering quality food for over 25 years, specializing in fries, snacks, ice cream, and hamburgers.	Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ cafe ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
aboutlemons.nl	About Lemons	About Lemons is a catering company that provides festive snacks and meals for various occasions, both at home or for businesses.	Brasseries & Bistros → Bistro ⁵⁹⁴	brunch ¹⁸⁵ dinner ¹⁵³³ meal ¹⁶³⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	North-Holland → Amstelveen ³¹⁸⁰
konings-snacks.nl	Cafetaria R Koning	Cafetaria R Koning is a snack bar in Groningen specializing in high-quality, traditionally made products, with a particular focus on egg balls and fries.	Cafes → Dutch Restaurants ¹⁰³¹ Events → Places ¹²¹⁹	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Netherlands → Groningen ²³⁷³⁴
studioartbeat.nl	Entourage	The website offers glow-in-the-dark sip and paint events in Alkmaar.	Culinary & Tastings → Gatherings ⁹² Knowledge ²¹⁶⁰¹⁹	snack ²⁹¹⁶ drink ⁵¹⁹¹ paint ⁸⁷⁴⁷ music ¹³¹⁷⁰	North-Holland → Alkmaar ⁶⁵⁰⁷
snackservicemarie.nl	Snackservice Marie	Snackservice Marie provides on-location snack services and rents out snack trucks for events, with fixed locations in the regions of Nieuwkoop, Alphen a/d Rijn and Kaag en Braassem.	Fast Food → Fries ⁹⁴⁹ Event Styling & Decoration → Event Equipment ⁷⁷⁵	snack truck ³⁵ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → AWZI Alphen a/d Rijn ³⁵⁸
toko-ibu-tjilik-leiden.nl	Toko Ibu Tjilik	Toko Ibu Tjilik is an online restaurant located in Leiden where customers can order dishes from the menu online.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	nasi goreng ⁶⁵ meat dishes ⁶⁶ satay ³²⁰ rice ⁶³⁵ snack ²⁹¹⁶	South-Holland → Leiden ⁷⁰⁸⁹
1001hapjes.nl	1001 hapjes	The website of ‘1001 Hapjes’ offers catering services for various occasions, from breakfast to dinner, both on-site and during canal tours and bike rides in The Hague.	Water Recreation → Canal Tours ¹⁰⁶	canal tour ⁹⁹ snack ²⁹¹⁶ arrangement ³¹⁰⁴ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → The Hague ¹⁹⁸⁹⁸
dewandelgangzeeland.nl	De Wandelgang Zeeland	De Wandelgang Zeeland is a cozy village café for both young and old, offering drinks and small snacks in a welcoming atmosphere.	Bars → Pubs ⁵⁴⁶ Cafes → Brown Cafés ⁵⁹⁹	cafe ¹⁶²² snack ²⁹¹⁶ coffee ³⁸³⁸ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹ event ⁴⁵¹⁹⁹	Maashorst → Zeeland ¹⁷
carelscafetaria-amstelveen.nl	Carel’s Cafetaria	The Carel’s Cafetaria website in Amstelveen provides an online ordering system for a wide selection of snacks, sandwiches, plates, salads, and beverages.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	plate ⁷⁸⁷ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amstelveen ³¹⁸⁰
even-pause.nl	Even Pause	Even Pause is a cafeteria in Brouwershaven that offers lunch, dinner, and snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	seafood ¹⁴⁸ cafeteria ¹⁶⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Schouwen-Duiveland → Brouwershaven ¹²⁴
tokozoetermeer.nl	Toko Mahkota	Toko Mahkota is an Indonesian takeaway and restaurant in Zoetermeer, offering authentic Indonesian dishes, including rice tables and individual meals, with a long tradition since 1997.	Food Delivery → Indonesian ⁵⁰²	rice table ²⁷⁷ rice ⁶³⁵ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
cafetariadietwee.nl	Cafetaria Die Twee	Cafetaria Die Twee is a cafe in Luyksgestel that offers fries, snacks and lunch dishes.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	soft ice cream ¹⁶ milkshake ¹⁹⁵ lunch ¹⁵³⁴ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³	Bergeijk → Luyksgestel ¹⁰⁶
cafetariawilly.nl	Cafetaria Willy	Cafetaria Willy is a cafeteria in Gouda offering various dishes such as fries, snacks, sandwiches and Greek specialties, emphasizing quality and good service.	International → Greek ⁴⁶⁵ Quick Bites → Cafeteria ⁹⁰⁶	gyro ⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Gouda ³⁵²¹
bestariasteenwijk.nl	Bestaria Steenwijk	Bestaria Steenwijk is a cafetaria in Steenwijk that offers fresh products and snacks, aiming to be a welcoming meeting place for local residents.	Fast Food → Fries Restaurants ⁸⁷ Food Delivery → Italian Restaurant ¹⁰⁴⁰	hamburger ³⁶⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ restaurant ¹¹²¹⁵	Steenwijkerland → Steenwijk ⁸⁷⁶
snackbarlobo.nl	Snackhouse Lobo	Snackhouse Lobo’s official website offers online ordering, delivery, and pick-up services in Oudorp.	Fast Food → Shoarma ⁹⁰	prize wheel ⁴⁰² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Alkmaar → Oudorp ³⁴⁵
frietjefred.nl	Frietje fred	The website Frietje fred offers the possibility to order various fried potato meals, snacks and drinks online, including different types of fries, sauces, burgers, sandwiches, and plates, and to have them delivered.	Fast Food → Fries ⁹⁴⁹	plate ⁷⁸⁷ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Heerlen → Hoensbroek ³⁷¹
cateringmoosetten-leur.nl	Catering Moos	Catering Moos is a catering company in Etten-leur offering a variety of snacks, buffets, and meals.	Lunch → Sandwiches ⁴⁶⁶	platters ⁵⁴ meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶	North-Brabant → Etten-Leur ¹³⁶⁶
restariadebuurman.nl	De Buurman	The website of De Buurman presents a restaurant in Etten-Leur that offers fries and snacks, with the option to pick them up, eat in the restaurant, or have them delivered via prior telephone ordering.	Quick Bites → Snack Bar ⁵⁸⁰ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ music ¹³¹⁷⁰	North-Brabant → Etten-Leur ¹³⁶⁶
chowshoekie.nl	Chow's Hoekie	Chow's Hoekie is a cafeteria in Gasselternijveen that offers fries, snacks, and Asian dishes.	Bars → Pubs ⁵⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	pub ¹⁸⁵ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Aa en Hunze → Gasselternijveen ⁶⁸
cafetaria-sabina.nl	Cafetaria Sabina	Cafetaria Sabina is a cafeteria located in Nieuwegein, offering a wide range of food and beverages including fries, snacks, sandwiches, and ice cream. The website provides online ordering, location information, and opening hours.	Quick Bites → Cafeteria ⁹⁰⁶	children's party ¹¹⁵ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Nieuwegein ²²⁶⁴
cafetariatpontje.nl	Cafetaria 't Pontje Akersloot	The website of Cafetaria 't Pontje Akersloot offers an online ordering system for fries, snacks, sandwiches and other products, as well as information about the cafeteria and customer reviews.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Castricum → Akersloot ²⁴²
snackbarlucullus.nl	Snackbar Lucullus	The website of Snackbar Lucullus in Doorn provides information about the snack bar, its history, menu and contact details.	Specialized History → Roman History ⁵¹ Quick Bites → Snack Bar ⁵⁸⁰	snack bar ¹⁶² fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht Hill Ridge → Doorn ⁶¹⁵
bakkerijroos.nl	Snackbar & Bakkerij Roos	Snackbar & Bakkerij Roos is a bakery and snack bar located in Hilversum that offers traditional and modern foods and bakery products, emphasizing artisanal quality and hospitality.	Trade → Local Trade ⁶¹ Quick Bites → Snack Bar ⁵⁸⁰	bakery products ¹³ bread ¹⁶²² snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	North-Holland → Hilversum ⁴³⁹⁷
cafetariadeprinsenhof.nl	Cafetaria de Prinsenhof Hardenberg	The website of Cafetaria de Prinsenhof Hardenberg provides an online ordering system for burgers, snacks, fries, and other menu items, including delivery options and a mobile app for quick ordering.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶
alotfordoodles.nl	A Lot for Doodles	The website A Lot for Doodles is an online shop that sells dog toys, grooming products, and accessories, with a focus on providing fun and care for dogs.	E-Commerce → Pet Supplies ¹⁰¹³ Environment → Animals ¹³⁷⁶⁴	grooming ⁸⁹⁶ shopping cart ¹⁵²¹ toy ²²⁹⁵ snack ²⁹¹⁶ accessories ¹²⁹⁷⁵	Twenterand → Vriezenveen ⁴⁸⁷
petfoodsupply.nl	Petfood Supply	Petfood Supply is a wholesaler and distributor of high-quality dog food, also offering dealer accounts.	Pet Supplies → Dog Supplies ¹¹² Pet Food → Dog Food ³²¹	wet food ¹² dry food ¹³ dog food ²⁰⁴ snack ²⁹¹⁶
tokovleuterweide.nl	Toko Vleuterweide	Toko Vleuterweide is a shop in Utrecht that offers authentic Indonesian dishes, snacks, sandwiches, and meals for takeaway or immediate consumption.	Food Delivery → Indonesian ⁵⁰² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	meal ¹⁶³⁸ ingredients ²³⁴⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
arkoswereld.nl	Arko's Wereld	Arko's Wereld is an online shop offering natural snacks and toys, specifically designed for superdogs like Arko.	Dog Care → Grooming Salons ⁶⁵¹ Animals → Pet Stores ⁴⁷⁸	stomach ²⁴ teeth ⁶⁸⁰ toy ²²⁹⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³
leywegvissnack.nl	Leyweg Vis & Snacks	Leyweg Vis & Snacks is a kiosk in The Hague that sells fresh fish, snacks, and prepared sandwiches, serving meals.	Supermarkets & Grocery → Fish Shops ¹⁹¹	kiosk ⁹¹ fish ¹¹²¹ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
fransebulldogloversshop.nl	Franse Bulldog Lovers Shop	The Franse Bulldog Lovers Shop is an online store specializing in products for French bulldogs.	Breed → French Bulldog ¹⁵	harnesses ⁷⁶ grooming ⁸⁹⁶ bed ¹³⁸⁴ toy ²²⁹⁵ snack ²⁹¹⁶
shokran.nl	Shokran.nl	Shokran.nl is an online shop offering a variety of gifts, snacks, books about Islam, and other essentials, with a focus on Islamic themes and occasions.	Religion → Islam ⁵⁴² Gifts → Gift Cards ⁹⁸¹	islam ¹⁷² gift box ²⁴³ snack ²⁹¹⁶ gift ⁶⁴⁴² book ¹¹³⁹⁶
carniwell.nl	SW Pet Products	Carniwell offers locally sourced, high-quality fish and meat delicacies specifically for dogs.	Nutrition → Natural Nutrition ⁶⁵ Pet Food → Dog Food ³²¹	protein ²⁹⁹ fish ¹¹²¹ meat ²⁰⁵⁵ bag ²³⁹⁹ snack ²⁹¹⁶ health ⁶³⁶⁶
hypoallergeenvoorhonden.nl	Hypoallergeenvoorhonden.nl	Hypoallergeenvoorhonden.nl is a webshop specializing in nutritional advice and hypoallergenic food for dogs with food allergies.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	allergy ²⁵⁴ supplement ¹⁹⁶⁸ problem ²²¹⁴ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
dehapjespan.nl	Slagerij Lunenburg	De Hapjespan is an online store offering ready-to-eat snacks, salads, and snacks in the Westland region.	Dairy & Cheese → Delicatessens ⁶¹⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Westland → Monster ³⁶⁰
snackplazaelmaar.nl	Snackplaza Elmaar Alkmaar	The website of Snackplaza Elmaar Alkmaar is an online platform where visitors can order snacks and dishes, including Italian pizzas, for delivery or pickup.	Fast Food → Shoarma ⁹⁰ Quick Bites → Online Restaurant ¹⁰⁹	prize wheel ⁴⁰² snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
cafetariadejongens.nl	Cafetaria De Jongens	Cafetaria de Jongens is a cafeteria that offers a variety of products and services, including business lunches, snacks, and salads, and is focused on serving both businesses and local residents.	Quick Bites → Cafeteria ⁹⁰⁶	lunch ¹⁵³⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ food ³⁸⁷² cleaning ⁴⁵⁶⁷	South-Holland → Delft ⁵³⁰⁹
peace4dogs.nl	Peace4Dogs	Peace4Dogs is an online shop selling raw frozen meat and dog food, including snacks and supplements, and offering assistance with missing dogs.	Essential → Food ⁴⁷⁹⁹⁹	meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ shop ⁶⁴⁸³	North-Holland → Bergen ²⁰⁰⁹
bierbitterballenenbevallingen.nl	Block&Barrels	The website 'Bier, Bitterballen & Bevallingen' provides information for expectant fathers about childbirth, including practical tips and a beer tasting.	Beer → Craft Beer ¹⁹⁹ Pregnancy & Childbirth → Midwife Care ¹⁴	postpartum ⁴⁶⁴ childbirth ⁸⁹⁴ tips ²⁷⁸⁹ beer ²⁸⁸⁷ snack ²⁹¹⁶ partner ⁴²⁷²
cafetariathuus.nl	Cafetaria 't Huus 2.0	Cafetaria 't Huus 2.0 is a restaurant in Veenendaal that offers delivery or takeaway of fries, snacks, milkshakes, and ice cream.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Utrecht → Veenendaal ²⁶⁴¹
cafetarialarewi.nl	Cafetaria Larewi Oud Stein	Cafetaria Larewi is a cafeteria in Oud Stein offering fresh snacks, hamburgers, steaks, and catering services, and has been operating since 1997.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	schnitzel ⁶¹ buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Limburg → Stein ⁶²⁸
poelierterbrake.nl	Grillwinkel ter Brake	The website Grillwinkel ter Brake presents itself as a catering company based in Denekamp, offering various catering services including buffets, snacks, and party trays, utilizing fresh ingredients.	Cafes → Grand Cafés ²²⁸ Sandwiches & Salads → Snacks ⁶⁹³	buffet ¹⁷⁴⁷ ingredients ²³⁴⁶ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Dinkelland → Denekamp ³⁷⁵
heijshepke.nl	Heijs Hepke	The website of eeterij Heijs Hepke presents the menu, opening hours, and contact information for the restaurant, which has been serving delicacies for more than 30 years.	Catering & Ready Meals → Takeaway ⁴⁰⁹	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ restaurant ¹¹²¹⁵
olhoofstersnackcorner.nl	Cafetaria de Olhoofster Snackcorner	The website of Olhoofster Snackcorner presents the cafeteria, its offerings, opening hours, and contact information.	Quick Bites → Cafeteria ⁹⁰⁶	meatball ²⁷ croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹	North-Holland → Landsmeer ⁴¹³
alvolo.nl	Al-Volo	The website of Al-Volo in Heteren offers online ordering, delivery, and takeaway options for a variety of dishes, including pizza, pasta, salads, and snacks.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Meal Solutions → Delivery Service ⁸⁰	calzone ⁹⁰ bread ¹⁶²² salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Overbetuwe → Heteren ²³⁶
smulhuishoensbroek.nl	Cafetaria Smulhuis Hoensbroek	The website of Cafetaria Smulhuis Hoensbroek allows visitors to order french fries, snacks and other dishes online for delivery or pickup. The site also provides information, reviews, and a newsletter.	Fast Food → Burgers ⁶⁸⁷	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	Heerlen → Hoensbroek ³⁷¹
popupsillys.nl	Silly's	Snackbar Silly's is a snack bar in Berghem offering a variety of snacks and meals, both in the shop and through delivery and on location.	Fast Food → Fries ⁹⁴⁹ Food → Foodservice & Catering ⁵⁷⁷	snack bar ¹⁶² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Oss → Berghem ²⁵³
cafetariagovers.nl	Cafetaria Govers	The website of Cafetaria Govers in Geffen presents the cafe and restaurant, with information about the menu, customer experiences, and the possibility to order by phone and takeaway.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	fry ⁵⁹ wok dish ⁶⁶ allergy ²⁵⁴ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Oss → Geffen ²⁰⁰
snackbarhenrys.nl	Snackbar Henry's Hengelo	The website of Snackbar Henry's in Hengelo provides an online ordering system and a digital menu, allowing visitors to easily have meals and drinks delivered to their door or picked up.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
cafetarialing.nl	Cafetaria Ling	Cafetaria Ling is a cafeteria located in Alphen aan den Rijn that offers online ordering for delivery, takeaway, and home delivery.	Sandwiches & Salads → Snacks ⁶⁹³ Quick Bites → Cafeteria ⁹⁰⁶	soda ⁴⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
partypan.nl	Partypan	The Partypan website is a local business from Friesland that sells meat, meal specialties, and snacks, including pork, chicken, and beef products.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Meat → Meat Products ²¹¹	shopping cart ¹⁵²¹ meat ²⁰⁵⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Friesland ²⁷⁹¹¹
cafetaria-arthur-den-haag.nl	Cafetaria Arthur	The website of Cafetaria Arthur in The Hague offers the possibility to order meals online, including a menu with various dishes such as sandwiches, snacks, fries, and Turkish pizza's.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbartuintje-denhaag.nl	Snackbar Tuintje	The website, Snackbar Tuintje, located in The Hague, allows customers to order food online. It also features a menu and provides the ability to view reviews.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
delekkerbekbaarlo.nl	De Lekkerbek Baarlo	De Lekkerbek is a snack bar located in Baarlo that sells fries, snacks, and sandwiches.	Fast Food → Fries ⁹⁴⁹ Events → Places ¹²¹⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ collaboration ¹⁶⁰³⁶	Peel and Maas → Baarlo ⁴⁴²
cafetariadeweide.nl	Cafetaria De Weide	Cafetaria De Weide is a snack bar in Hoogeveen that offers fries and a variety of snacks, allowing customers to order both on-site and online.	Fast Food → Fries ⁹⁴⁹	shopping center ⁴⁹¹ fries ²⁷⁵³ snack ²⁹¹⁶	Drenthe → Hoogeveen ²²⁹⁴
rickyspurmerend.nl	Rana Collection (Ricky's)	The Rana Collection (Ricky's) Purmerend website is an online restaurant offering Surinamese, Indian, Thai, and vegetarian dishes and accepting orders. It also provides sandwiches, snacks, and drinks.	Quick Bites → Online Restaurant ¹⁰⁹ Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Purmerend ²⁶²⁰
surinamsnacksfood.nl	Surinam Snacks Food	The Surinam Snacks Food website is an online platform for customers to easily and quickly order their meals for home delivery, pickup, or delivery to Tholen.	Fast Food → Shoarma ⁹⁰ Food Delivery → Delivery ²²²⁷	toyota aygo ¹²² prize wheel ⁴⁰² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zeeland → Tholen ⁸⁶³
friterieemmen.nl	Friterie – IJssalon Emmen	The website of Friterie – IJssalon Emmen presents the opening hours, menu and location of a fast food establishment and ice cream parlor in Emmen, which offers fresh fries, snacks, ice cream and milkshakes.	Quick Bites → Cafeteria ⁹⁰⁶ Chocolate & Sweets → Ice Cream ⁷⁷⁴	milkshake ¹⁹⁵ plate ⁷⁸⁷ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶	Drenthe → Emmen ³³⁴⁸
themafeestcaribisch.nl	Theme Party Caribbean	The website offers various services and products centered around Caribbean themes, including themed parties, costumes, music, and entertainment.	Activewear → Dancewear ³⁰ Parties → Themed Parties ⁵⁸³	theme party ¹⁴³ dancer ²²⁰ costume ⁵⁰⁰ snack ²⁹¹⁶ band ²⁹⁷⁷ music ¹³¹⁷⁰
gembirastreetfood.nl	Toko Gembira	Toko Gembira is an Indonesian street food establishment that has been serving authentic dishes and snacks based on family recipes since 1984 and currently operates three locations.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶ shop ⁶⁴⁸³	Zaanstad → Zaandam ²⁷⁴⁰
cafetariavanputten.nl	Cafetaria van Putten	The website of Cafetaria van Putten offers online ordering for delivery, pickup, and home delivery of their products, including fries, ice cream, and snacks, in Rotterdam and surrounding areas.	Fast Food → Fries ⁹⁴⁹ Ice Cream → Ice Cream Parlors ⁵²¹	online order ⁷¹ prize wheel ⁴⁰² ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ gift ⁶⁴⁴²	Rotterdam → Charlois ³²⁸
shellnoordermors.nl	Shell Noordermors	The website of Shell Noordermors showcases a range of fresh sandwiches, drinks, snacks, and other products available at the store.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Cafes & Lunch → Lunch Spots ²³⁷	panini ¹⁵⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹
johnenmichaels.nl	John and Michaels	Catering & Snackbar Deventer is an online platform where customers can order catering and snacks.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Meal Solutions → Food Online Shops ⁸⁰	cafeteria ¹⁶⁹ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	Overijssel → Deventer ⁴⁷⁵¹
plasticpower.nl	Plastic Power	Plastic Power is a lifestyle blog that publishes articles covering a variety of topics.	News & Journalism → News Websites ³⁴⁰ Cooking & Recipes → Dishes ³³⁵	shooting sport ²³ quiche ³⁴ snack ²⁹¹⁶ clothing ⁹⁴⁴³ car ¹⁰⁸⁶⁵
cleopatraheistraat.nl	Cleopatra	The website Cleopatra Online bestellen offers online ordering of various products, including pizzas, salads, snacks, and other dishes, with delivery service to Helmond.	Fast Food → Döner ²³⁸ Food Delivery → Delivery ²²²⁷	shawarma ³³⁵ döner ⁶⁷³ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Brabant → Helmond ³⁰⁵⁸
donerbeyzaandam.nl	Döner Bey	The Döner Bey website from Zaandam offers online ordering for Turkish dishes, including sandwiches, pizzas, döners, and wraps.	Fast Food → Döner ²³⁸	döner ⁶⁷³ wrap ⁸²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Zaanstad → Zaandam ²⁷⁴⁰
lekkerrrnieuwegein.nl	Lekkerrr	The website of Lekkerrr is the online presence of a family-run cafe located in the Hoogzandveld shopping center in Nieuwegein, specializing in snacks, hamburgers, fries and ice cream.	Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ cafe ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
viersprongwinterswijk.nl	Cafetaria De Viersprong	Cafetaria De Viersprong is a cafeteria in Winterswijk offering a variety of snacks, meals, and drinks.	Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ hamburger ³⁶⁴ chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Gelderland → Winterswijk ¹²²¹
snackdriveurk.nl	Snack Drive Urk	Snack Drive Urk is an online shop that delivers food, snacks, and drinks from Urk.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Flevoland → Urk ⁷⁶²
bigbreadenschede.nl	Big Bread Kitchen Enschede	The Big Bread Kitchen Enschede website is an online platform where visitors can order burgers, sandwiches, fries, and snacks for pickup. The site also provides a menu and information about pickup locations and opening hours.	Fast Food → Burger Restaurants ³⁴⁶ Internet → Food Retailers ¹⁰	pickup ⁷³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
snackbarharte.nl	Snackbar Harte	The website is an online listing for Snackbar Harte in Uden, where customers can order fries and snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	frikandel ¹⁸ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Maashorst → Uden ¹⁵⁴⁰
snackbarputten.nl	Benny's Place Putten	Benny's Place Putten is an online snack bar offering a wide selection of snacks, sandwiches, menus, and drinks, with the option to order online and have it delivered.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Putten ¹⁰⁶⁹
snackbarsixties.nl	Snackbar The Sixties	The website of Snackbar The Sixties presents the menu, opening hours and reviews of a snack bar in Westenschouwen, focusing on the diverse dishes offered and the 1960s-style atmosphere.	Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ fish ¹¹²¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Schouwen-Duiveland → Burgh-Haamstede ⁴⁰¹
hetbusstation.nl	Cafetaria-Eethuis het Busstation	Cafetaria-Eethuis het Busstation is a restaurant and cafeteria located in Zuidwolde, Netherlands, offering a variety of food and snack options with an online ordering service.	Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²	Het Hogeland → Zuidwolde ³⁵⁹
hamenkaas.nl	Ham & Kaas Horeca Group	The website of Ham & Kaas Horeca Group presents their diverse range of hospitality and catering services, including a cafeteria, barbecue services, and complete catering solutions for various occasions.	Catering → Buffets ²⁷⁷ Water Activity → Swimming ¹⁴⁰²	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶	Oirschot → East-West-and Middle Beers ²¹⁴
absolute-delicious.nl	Absolute Delicious	Absolute Delicious is a catering service and restaurant located in Duivendrecht offering various meals and events, including breakfast, lunch, dinner, buffets, walking dinners, high tea, and barbecue.	Social & Events → Party Services ¹⁸⁷ Brasseries & Bistros → Brasserie ¹⁰⁰⁵	high tea ⁵⁸⁵ dinner ¹⁵³³ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Ouder-Amstel → Stationsplein ¹⁷⁰
dekloesgeleen.nl	De Kloes Geleen	De Kloes Geleen is a lunchroom and cafeteria offering a wide range of dishes, snacks, and fries in a cozy atmosphere.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Sandwiches & Salads → Snacks ⁶⁹³	cafeteria ¹⁶⁹ brasserie ⁷⁵² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ atmosphere ⁵⁵⁹¹ dish ⁵⁹³⁶	Sittard-Geleen → Geleen ⁹⁷⁸
lenashapjes.nl	Lena's Hapjes	Lena's Hapjes was a business that provided delivered snacks in the municipalities of Leek, Tolbert, Roden, Nieuw-Roden, and Zevenhuizen.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Indonesian Restaurant ³⁹²	schedule ²⁶²⁴ snack ²⁹¹⁶ order ⁶⁹¹²	Westerkwartier → Leek ⁶⁴²
dedreupelkot.nl	Dreupelkot	’t Dreupelkot is a brown café located in the center of Maassluis offering Belgian beers, jenevers, and snacks.	Cafes → Brown Cafés ⁵⁹⁹	cafe ¹⁶²² beer ²⁸⁸⁷ snack ²⁹¹⁶ building ³²⁰⁴	South-Holland → Maassluis ⁹⁸⁸
parkstadcocktail.nl	Parkstad cocktail bezorgservices	The website Parkstad cocktail bezorgservices offers an online platform for ordering and delivery of cocktails, snacks, and beverages. It features various promotions, including a 6+1 free offer.	Food Delivery → Delivery ²²²⁷ Beverages → Cocktails ¹⁴⁴	beverage ⁵⁸⁶ cocktail ⁹²⁵ promotion ²⁰⁶² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Limburg ³¹⁹⁰⁹
debeloningduiven.nl	The Beloning	The Beloning is a village café with a modern appeal, offering a cozy meeting place for a wide audience.	Cafes → Village Cafes ⁷⁷ Family Gatherings → Birthday Parties ¹³	cafe ¹⁶²² snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹	Gelderland → Duiven ⁸⁵¹
cafetariadezonnebloem.nl	Cafetaria de Zonnebloem	The website of Cafetaria de Zonnebloem in Borne presents their menu, opening hours, and options for online ordering.	Cafeteria → Dutch Cafeteria ¹²²	bear ⁸⁵ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Borne ⁸¹²
cafetariadeballon.nl	Cafetaria De Ballon	The website of Cafetaria De Ballon in Gouda offers the possibility to order online and pick-up, with an extensive menu featuring fries, sandwiches, snacks, and hamburgers.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	menus ²²¹ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Gouda ³⁵²¹
snackbarberkel.nl	Snackbar Berkel	The website Snackbar Berkel offers online ordering for a variety of snacks, fries, sandwiches, hamburgers, vegetarian options, ice cream, drinks, and various value offers, with the possibility of delivery.	Quick Bites → Snack Bar ⁵⁸⁰ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	milkshake ¹⁹⁵ menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Lansingerland → Berkel and Rodenrijs ⁹²⁹
fromtheroadforce.nl	Road Force	The website, Road Force, is a pet store specializing in organic animal feed, dog food, cat snacks, accessories and supplies for both dogs and cats, as well as a selection of fishing and outdoor products.	Pet Food → Dog Food ³²¹ Animal Care → Dog Care ¹³⁹⁸	kibble ⁴⁶ fishing ⁴²⁴ snack ²⁹¹⁶ food ³⁸⁷² care ¹²³³⁸ accessories ¹²⁹⁷⁵
petsonlyboskoop.nl	PetsOnly	The website PetsOnly is a pet shop that offers healthy and sustainable animal food, snacks, and toys, as well as expert advice for dogs and cats.	Pet Supplies → Pet Nutrition ¹⁸ Environment → Animals ¹³⁷⁶⁴	animal food ¹⁵ cat ¹⁵⁷⁸ toy ²²⁹⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³	Alphen aan den Rijn → Boskoop ⁶⁵²
djairosnature.nl	Djairo's Nature	Djairo's Nature is an online store specializing in dog and cat food and treats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ snack ²⁹¹⁶ food ³⁸⁷² health ⁶³⁶⁶
verloopnatuurlijkgoed.nl	KVV Webwinkel	The website offers a wide range of meat products, snacks, and supplements for dogs and cats, with the option to order and pick up.	Animals → Pet Food ⁵⁸⁴	meat products ²⁷² cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ dog ⁵⁴⁸³ order ⁶⁹¹²
hondensnackservice.nl	Honden Snackservice	The Honden Snackservice website offers a wide selection of natural dog snacks and toys, catering to the needs of dogs of all ages and breeds.	Pet Food → Dog Food ³²¹ Dogs → Supplies ¹⁰⁰⁵	dog snacks ³⁵ trainer ¹⁹⁶⁶ toy ²²⁹⁵ snack ²⁹¹⁶
vleesvoordier.nl	Vlees voor Dier	Vlees voor Dier is a webshop specializing in healthy food and snacks for dogs and cats.	Dogs → Pet Care ³⁸⁷ Animals → Pet Food ⁵⁸⁴	biscuit ³⁹ cat ¹⁵⁷⁸ meat ²⁰⁵⁵ toy ²²⁹⁵ snack ²⁹¹⁶
voedingvoorhondenkat.nl	Hiltjo	The website sells dog and cat food and related products from various brands.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	cat food ⁹⁸ dog food ²⁰⁴ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² brand ¹⁷⁷³⁷
beestenspullen.nl	Beestenspullen	Beestenspullen is an online shop that offers natural and stimulating enrichment products for small pets.	E-Commerce → Pet Supplies ¹⁰¹³ Gifts → Gift Cards ⁹⁸¹	enrichment ¹³ pet ¹⁶¹⁷ toy ²²⁹⁵ snack ²⁹¹⁶ housing ⁴³⁷⁸
humvees.nl	Humvees.nl	The website Humvees.nl offers healthy snacks for dogs and cats, produced without additives, odor, color, flavorings, or preservatives.	Pets → Cats ⁶³⁹ Animals → Dogs ⁵⁸⁷⁹	meat ²⁰⁵⁵ animal ²⁹⁰⁸ snack ²⁹¹⁶ health ⁶³⁶⁶
dieroke.nl	DierOKÉ	DierOKÉ is a mobile pet store serving Friesland, offering quality products and advice to pet owners.	Animals → Pets ¹³⁸² Animals → Pet Stores ⁴⁷⁸	pet ¹⁶¹⁷ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³	Opsterland → Gorredijk ³⁹⁸
hokkenvoordeel.nl	Hokkenvoordeel	Hokkenvoordeel is an online store that offers chicken, rabbit and dog enclosures, aviaries and birdcages.	Animals → Pets ¹³⁸²	enclosure ¹¹⁵ care products ¹⁴² dog food ²⁰⁴ snack ²⁹¹⁶
hondslekker.nl	Hondslekker	Hondslekker is an online shop specializing in the sale of pet care products, food, and accessories for dogs and cats.	Essential ²⁴¹⁰¹⁶	shampoo ²⁵⁸ bed ¹³⁸⁴ snack ²⁹¹⁶ food ³⁸⁷²	Borger-Odoorn → Drouwen ⁴⁰
kitons.nl	Kiton's	Kiton's is an online store that sells fresh meat for dogs and cats, including various types of meat, sausages, snacks and supplements.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	gluten-free ¹⁵⁶ sausage ²⁵⁶ supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶
versvoerhondenkat.nl	Versvoerhondenkat	The website is an online shop selling various types of food and snacks for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ brand ¹⁷⁷³⁷
snackbardeoverkant.nl	Snackbar De Overkant	The website of Snackbar De Overkant is an online ordering platform for a neighborhood snack bar in Gouda that offers classic and modern snacks, including hamburgers and catering services.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	South-Holland → Gouda ³⁵²¹
hetvonnis.nl	Cafetaria Het Vonnis	Cafetaria Het Vonnis is a cafe in Kesteren that offers a variety of snacks, menus, and milkshakes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Neder-Betuwe → Casterhoven ²⁴⁸
a-oneleiden-leiden.nl	A-One Leiden	The website A-One Leiden allows customers to order meals online from Leiden.	Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Leiden ⁷⁰⁸⁹
kiosk-sportpark.nl	Kiosk Sportpark	The KSP Kiosk Sportpark Hilversum website offers online ordering for fries, snacks, döner and shoarma, with the option of delivery or pickup in Hilversum.	International → Middle Eastern ¹¹⁶ International → Turkish ⁴¹⁶	shoarma ²⁵⁴ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	North-Holland → Hilversum ⁴³⁹⁷
smikkelhuus.nl	Snackbar 't Smikkelhuus	The website of Snackbar 't Smikkelhuus offers online ordering for various snacks, fries, hamburgers, drinks and other products, with the possibility of delivery. Horeca sauces and special menus are also offered.	Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Drenthe → Hoogeveen ²²⁹⁴
frietjebrabant.nl	Frietje Brabant	The website offers a service for renting a mobile fry truck for various occasions.	Fast Food → Fries ⁹⁴⁹ Catering → Mobile Catering ⁸⁷	fry truck ³⁸ bookings ⁵²³ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ party ⁵⁹²⁸
saray05.nl	Saray05 Apeldoorn	The website Saray05 Apeldoorn is a pizzeria, cafeteria, and restaurant offering food delivery, takeaway orders, and online ordering.	International → Turkish ⁴¹⁶ Grilling & Steaks → Grillroom ⁸⁷	shawarma ³³⁵ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ restaurant ¹¹²¹⁵	Voorst → Main Road ¹⁶³
smaakommen.nl	SMAAK!	The website of SMAAK! is a lunchroom and cafeteria located in Ommen, offering a variety of dishes and snacks, including coffee, sandwiches, paninis, fries, and takeaway meals.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	panini ¹⁵⁶ lunchroom ³¹² fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Overijssel → Ommen ¹⁰⁹⁵
snackbarjopie.nl	Snackbar Jopie Veghel	The website of Snackbar Jopie Veghel presents the snack bar, its menu and opening hours, and offers online ordering options.	Quick Bites → Cafeteria ⁹⁰⁶	patio ¹⁵³ snack bar ¹⁶² lunch ¹⁵³⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Meierijstad → Veghel ¹²⁸⁸
cafetaria-het-eethuis.nl	Het Eethuis	Het Eethuis is an online ordering platform for food in Nijmegen, offering a diverse menu.	International → Turkish ⁴¹⁶ Pastries & Baked Goods → Menus ²²³	kapsalon ⁵⁰⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gelderland → Nijmegen ⁹³⁸⁴
cafetariaboswijk.nl	Cafetaria Boswijk	The Cafetaria Boswijk website offers online ordering and delivery of a variety of products, including snacks, sandwiches, pizzas, ice cream, and drinks, with a focus on value menus and new offerings.	Quick Bites → Cafeteria ⁹⁰⁶ Coffee & Tea → Beverages ⁴⁴⁵³	ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Flevoland → Lelystad ³¹⁸⁰
cafetariadeheerlijkheid-uden.nl	Cafetaria de Heerlijkheid Uden	The website Cafetaria de Heerlijkheid Uden offers online ordering for a variety of dishes, including wok dishes, sushi, and sandwiches, with a focus on easy ordering and fast delivery.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	sushi box ⁵⁷ wok dish ⁶⁶ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Maashorst → Uden ¹⁵⁴⁰
cafetariasportpark.nl	Cafetaria Sportpark Doesburg	The website of Cafetaria Sportpark Doesburg offers online ordering for delivery or pickup of a variety of food and drinks.	Quick Bites → Snack Bar ⁵⁸⁰	ice cream ¹⁰⁰⁰ sauce ¹¹⁴¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Doesburg ⁶⁰⁰
frituur-restaurant-malberg.nl	Frituur - Restaurant Malberg	Frituur - Restaurant Malberg is a restaurant in Maastricht that accepts online orders.	Fast Food → Fries ⁹⁴⁹ Pastries & Baked Goods → Menus ²²³	family menu ¹² dönerbox ³³ croquette ¹³⁶ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Limburg → Maastricht ⁶⁰⁰⁸
grillsnackshonkytonk.nl	Grillsnacks Honky Tonk	The Grillsnacks Honky Tonk website presents the menu and information about the snack bar, located in Grijpskerk, which has been established since 1999 and is a familiar place in the surrounding area.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Westerkwartier → Grijpskerk ¹⁰⁴
lekker99.nl	Lekker De Overweg	The website of Lekker De Overweg in Leeuwarden offers the ability to order burgers, snacks, and drinks online for delivery or pickup. It also offers a loyalty program and a newsletter.	Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
shoarma-en-pizzeria-010-rotterdam.nl	Shoarma and Pizzeria 010	The website of Shoarma and Pizzeria 010 from Rotterdam offers the possibility to order dishes online, including shawarma, pizzas and various snacks and drinks.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Turkish Cuisine → Fast Food ³²²²	shawarma ³³⁵ kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbaraandekade-sneek.nl	Snackbar Aan de Kade	This website for Snackbar Aan de Kade in Sneek offers the possibility to order online and view the menu.	Fast Food → Fries ⁹⁴⁹	combination ¹⁸⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Southwest-Friesland → Sneek ¹⁹²¹
snackbardesplinter.nl	Snackbar de Splinter	The website of Snackbar de Splinter presents the cafeteria, its opening hours and information about its history, offerings, and service.	Quick Bites → Snack Bar ⁵⁸⁰	guestbook ³³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
snackbarkoster.nl	Snackbar Koster	The website of Snackbar Koster offers online ordering for a variety of snacks, fries, sandwiches, and drinks, with the option for delivery. It's an online store where customers can easily order their favorite items and have them delivered to their home.	Fast Food → Fries ⁹⁴⁹	kidsbox ³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Hardenberg ²³⁰⁹
sushiwereld-denhaag.nl	Sushi Wereld Den Haag	Sushi Wereld Den Haag is an online platform where customers can order sushi and other dishes in The Hague.	Japanese → Sushi ⁹⁷¹	roll ³⁵⁸ mix ³⁷⁷ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
thor-naarden.nl	Snackbar Eethuis THOR	The website of Snackbar Eethuis THOR presents the cafeteria, eethuis (dining room) and snack bar located in Naarden, offering information about their offerings and opening hours.	Quick Bites → Cafeteria ⁹⁰⁶ Outdoor → Terraces ¹⁸⁸	ice cream ¹⁰⁰⁰ wifi ¹³⁷² fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Gooise Meren → Naarden ¹¹⁵⁴
thuukske-helmond.nl	Restaurant 't Huukske	The website 't Huukske is an online platform where customers in Helmond can order food from the restaurant 't Huukske and have it delivered to their homes.	Online Ordering → Delivery Restaurants ⁷²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
torosushi.nl	Torosushi	Torosushi is a sushi restaurant and takeaway restaurant in Almere that offers fresh sushi, Japanese snacks, and party catering.	Japanese → Sushi ⁹⁷¹	takeaway ⁶⁵³ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
traktatieland.nl	Traktatieland B.V.	Traktatieland.nl is an online shop specializing in treats, party favors, and complete solutions for children's birthday parties and events.	Parties → Birthday Parties ¹⁰⁰⁸ Chocolate & Sweets → Sweets ²⁵⁷	party favors ¹² children's parties ¹²⁶ treat ³⁷³ snack ²⁹¹⁶ accessories ¹²⁹⁷⁵
cafetaria-heyendaalseweg.nl	Cafetaria Heyendaalseweg Nijmegen	The website of Cafetaria Heyendaalseweg Nijmegen offers online ordering, delivery, and takeaway options for a wide variety of food and drinks.	Fast Food → Fries Restaurants ⁸⁷	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Nijmegen ⁹³⁸⁴
top2000quizvanhetnoorden.nl	Dinercafe De Nachtwacht	The website promotes an offline quiz with snacks, organized by Dinercafe De Nachtwacht in Meppel.	Games → Quizzes ³⁴⁴ Neighborhoods → Districts ¹⁰⁹	nightwatch ¹³ quiz ⁷¹⁰ snack ²⁹¹⁶ church ³⁴³⁹ music ¹³¹⁷⁰	Drenthe → Meppel ¹⁹⁰³
thijsco.nl	Friture Thijsco	The website of Friture Thijsco presents the opening hours, menu, contact information, and online ordering options of a fast-food restaurant located in Eindhoven, which has been operating since 1958.	Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
depizzerie.nl	De Pizzerie	The Pizzeria's website offers online ordering for pizzas, snacks, and drinks, with the option of delivery.	Food Stores → Organic Stores ¹³ Food Delivery → Italian Restaurant ¹⁰⁴⁰	address ⁹⁰¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Westerkwartier → Zevenhuizen ⁴⁶⁰
cafetariadestatie.nl	Cafetaria eetcafé de Statie	Cafetaria de Statie is a cafe and eatery in Alphen offering fries, snacks, burgers, and specialties.	Municipalities → Peel ⁷² Quick Bites → Cafeteria ⁹⁰⁶	fry ⁵⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Alphen-Chaam → Alphen ²⁴⁹
happyfoodnunspeet.nl	Cafetaria HappyFood	The website of Cafetaria HappyFood in Nunspeet showcases a variety of offerings including sandwiches, meals, snacks, ice cream, and fries, with options for online ordering and delivery.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	online order ⁷¹ ideal ²⁴⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Nunspeet ¹³⁶⁶
smulcentrumveendam.nl	Smulcentrum Veendam	Smulcentrum Veendam is a snack bar located in Veendam, offering fries, snacks, and lunches with an outdoor terrace and delivery options.	Quick Bites → Snack Bar ⁵⁸⁰	lunch ¹⁵³⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Groningen → Veendam ⁸⁹⁶
tropischbar.nl	tropischbar.nl	The website offers tropical bars, cocktails, live music, dancers and entertainment, including decoration, DJ services and tropical snacks.	Bars & Pubs → Bars ¹⁹³⁸ Parties → Themed Parties ⁵⁸³	cocktail ⁹²⁵ dj ¹⁷²² snack ²⁹¹⁶ decoration ⁴⁰⁸⁵ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹
uwonlinedierenvoeding.nl	Uw Online Dierenvoeding	The website 'Uw Online Dierenvoeding' is an online shop that specializes in the sale of pet food, snacks, and supplements for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	pet food ¹¹⁰ shopping cart ¹⁵²¹ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ dog ⁵⁴⁸³
poeliervanledden.nl	Poelier van Ledden	Poelier van Ledden is a business that sells and delivers meat, primarily chicken, game, and poultry.	Meat → Meat Products ²¹¹ Food → Supermarkets & Grocery ³⁵⁶⁸	poultry ¹⁸⁰ chicken ⁹⁴⁴ game ²⁸⁰⁷ snack ²⁹¹⁶ shop ⁶⁴⁸³ assortment ⁷⁷⁹⁹	Neder-Betuwe → Echteld ⁶⁶³
snackbargabo.nl	Snackbar Automatiek Gabo	The website of Snackbar Automatiek Gabo in Lelystad offers the possibility to place online orders for a wide assortment of sandwiches, fries, snacks, and hamburgers.	Quick Bites → Snack Bar ⁵⁸⁰	milkshake ¹⁹⁵ menus ²²¹ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Flevoland → Lelystad ³¹⁸⁰
suryana.nl	Suryana Snacks	The website of Suryana Snacks in Veenendaal offers online ordering for delicious food, including wraps, sandwiches, fries, and catering.	Cafeteria → Dutch Cafeteria ¹²²	snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Veenendaal ²⁶⁴¹
geboeetijssalon.nl	Gebo Eet & IJssalon	Gebo Eet & IJssalon is an ice cream and snack bar with a long history in Oud-Beijerland, offering traditional and modern snacks and ice cream.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Takeaway ⁴⁰⁹	ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
eetcafedewittebrugbreezand.nl	Eetcafé De Witte Brug	The purpose of Eetcafé De Witte Brug is to allow customers to order food and drinks online, featuring a comprehensive menu with fries, snacks, sandwiches, appetizers, and beverages.	Quick Bites → Cafeteria ⁹⁰⁶ Pastries & Baked Goods → Menus ²²³	menus ²²¹ appetizer ⁵⁵⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Hollands Kroon → Breezand ¹²⁷
snackbarvanschaick.nl	Snackbar van Schaick	The website of Snackbar van Schaick provides information about the snack bar, its opening hours, menu, and ordering options, inviting visitors to enjoy a snack.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	De Ronde Venen → Abcoude ⁴⁷²
whiskybeleven.nl	Keyservice BV	Whiskybeleven.nl is a website that offers whisky tasting and experiences on-site or at home, with a focus on creating a fun and educational experience for clients.	Hobbies → Whisky ²³⁵ Corporate Events → Team Building ¹⁰⁰⁵	bagpipe ¹⁹ diner ⁵⁶ taste ⁹³³ snack ²⁹¹⁶ party ⁵⁹²⁸
snackbardebikker.nl	Snackbar de Bikker	The website of Snackbar de Bikker in Boornbergum offers the opportunity to order online for takeout or delivery, with the option to order faster via an app.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶	Smallingerland → Boornbergum ³⁵
tubzvendingfranchise.nl	Tubz Europe	The website of Tubz Europe offers a webshop for small portions of snacks and franchise opportunities for entrepreneurs, aiming to provide consumers with a healthier snacking option and to educate children about saving money.	Food & Beverage → Franchising ²⁵⁴ Logistics & Transportation → Vending Machines ⁶⁹	vending machine ¹²⁷ franchise ²⁸⁴ snack ²⁹¹⁶ webshop ⁸⁶⁴⁸
tasttoehapjes.nl	Hapjescatering Tasttoe	The Hapjescatering Tasttoe website offers a catering service providing various snacks, breakfasts, pastry glasses, lunches, high tea and buffets delivered to homes, with the option to pick them up.	Vegan & Vegetarian → Vegan Restaurants ²⁸ Outdoor → Barbecues ⁷⁴⁴	high tea ⁵⁸⁵ pickup ⁷³⁶ buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ order ⁶⁹¹²	Tubbergen → Langeveen ⁵⁸
star-box.nl	Star-box	Star-box is a webshop offering natural and special dog snacks and gift packages.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	border collie ⁵² gift package ⁵³⁰ fish ¹¹²¹ snack ²⁹¹⁶ dog ⁵⁴⁸³ webshop ⁸⁶⁴⁸
laurashondenboetiek.nl	Laura's Hondenboetiek	Laura's Hondenboetiek is a webshop selling unique dog items, focused on dog care.	Pet Food → Dog Food ³²¹ Essential → Food ⁴⁷⁹⁹⁹	grooming products ⁵² snack ²⁹¹⁶ accessories ¹²⁹⁷⁵	Kampen → IJsselmuiden ³⁸⁰
lipsmackingfood.nl	Lip-Smacking Food	The website of Lip-Smacking Food showcases the menu and services of the catering company, with a focus on quality, hospitality, and offering tasty treats for various times of the day.	Fast Food → Fries ⁹⁴⁹	salad ²⁴⁴⁴ snack ²⁹¹⁶ hospitality ³⁴⁹¹ sandwich ⁴⁰⁹⁸ care ¹²³³⁸ menu ¹³⁸⁵⁶
lecatering.nl	Le Catering	Le Catering is a catering company offering a wide selection of food and arrangements for various occasions, including lunches, dinners, and parties.	Fast Food → Fries ⁹⁴⁹	snack ²⁹¹⁶ arrangement ³¹⁰⁴ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹
frietwagenservicenederland.nl	Frietwagen Service Nederland	Frietwagen Service Nederland provides a wide range of fries and snacks for various occasions, with a focus on quality and service throughout the Netherlands and Belgium.	Fast Food → Fries ⁹⁴⁹ Business → Industry ³⁶⁹⁷⁷	fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹² event ⁴⁵¹⁹⁹	Hilvarenbeek → Esbeek ⁸⁷
frietzo.nl	Frietzo	The Frietzo website offers the possibility to rent a fries cart for various occasions in Brabant and the surrounding area.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	fry cart ¹⁹ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
trefpunt-leerdam.nl	Cafetaria Trefpunt Leerdam	The website of Cafetaria Trefpunt in Leerdam offers the ability to order online and view the menu, with an emphasis on a quick and easy ordering experience.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Vijfheerenlanden → Leerdam ⁶⁷²
wrangeshop.nl	de Wrange Shop	The Wrange Shop is a shop and brasserie that offers camping supplies, fresh bread, and catering services.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Dogs → Supplies ¹⁰⁰⁵	camping supplies ³² brasserie ⁷⁵² bread ¹⁶²² snack ²⁹¹⁶	Gelderland → Doetinchem ²⁷⁰⁶
hondenschooldidam.nl	Hondenschool Didam	Hondenschool Didam offers dog training courses and accessories, aiming to foster a harmonious life between dogs and families.	Pet Supplies → Dog Supplies ¹¹² Dogs → Dog Training ⁸⁸¹	dog behavior ¹⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸ training ²⁸¹³³
donataschoice.nl	Donata's Choice	Donata's Choice is an online store offering a wide selection of food, snacks, grooming products, and toys for dogs and cats, with a focus on healthy options.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ grooming ⁸⁹⁶ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
rederijhaerlem.nl	Rederij Haerlem B.V.	Rederij Haerlem B.V. offers a variety of cruise experiences on a luxury salon boat in Holland.	Water Travel → Cruises ²³⁷ Planning → Tours ⁸⁷⁰	cruise ⁴⁰⁵ snack ²⁹¹⁶ boat ²⁹⁸⁰ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
cafetarianoordereind.nl	Cafetaria Noordereind	Cafetaria Noordereind is a takeaway restaurant in 's-Graveland that accepts online orders.	Restaurants & Dining → Takeaway Restaurants ²⁴⁰	toyota aygo ¹²² prize wheel ⁴⁰² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Wijdemeren → 's-Graveland ¹⁹⁶
cafetariaderompert.nl	Cafetaria de Rompert	Cafetaria de Rompert is a cafeteria located in ‘s-Hertogenbosch that offers a variety of food and drinks, including artisanal burgers, fries, and snacks. They also provide ordering options for individuals and businesses.	Fast Food → Burgers ⁶⁸⁷ Economy → Employment & Labor ⁶⁰⁵⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ application ³³⁷⁷ order ⁶⁹¹²	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
mojosdierenvoeding.nl	Mojo's Dierenvoeding	Mojo's Dierenvoeding is an online store that sells primarily dog and cat food, as well as supplementary animal food and snacks.	Pet Food → Dog Food ³²¹ Animals → Animal Welfare ¹³⁷²	biscuit ³⁹ animal ²⁹⁰⁸ snack ²⁹¹⁶ food ³⁸⁷²	Gilze and Rijen → Rijen ⁴⁹³
patrix-arnhem.nl	Snackbar Shoarmazaak Patrix	The website of Snackbar Shoarmazaak Patrix in Arnhem is an online platform for ordering snacks, meals, and drinks directly, with a focus on a diverse menu and friendly service.	Fast Food → Fries ⁹⁴⁹ Online Services → Ordering ¹²¹	shawarma ³³⁵ review ¹⁸⁸⁸ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
cafetarialeeuwerik.nl	Cafetaria de Leeuwerik	Cafetaria de Leeuwerik is a snack bar in Coevorden offering a wide range of food and drinks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹	Drenthe → Coevorden ¹⁴⁹²
janpatatlochem.nl	Eetwinkel Jan Patat	The website of Eetwinkel Jan Patat showcases the offerings of a cafeteria in Lochem, where customers can find various snacks, sandwiches, and hot meals, with an emphasis on fresh ingredients.	Quick Bites → Snack Bar ⁵⁸⁰	box ¹⁹⁸² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Lochem ¹⁵⁸⁷
koken-is-liefde.nl	Koken is Liefde	Koken is Liefde is a catering company that provides vegan and vegetarian meals and snacks for various occasions.	Entertainment → Leisure Activities ³³⁸ Cooking & Recipes → Cooking Classes ²⁹²	picnic basket ³³ cooking ⁸⁰¹ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹
cafetariatoontje.nl	Cafetaria Toontje	Cafetaria Toontje is a cafeteria located on industrial estate ‘De Ooijk’ in Zaltbommel that offers a variety of food and drinks, including delivery service and options for renting for events.	Quick Bites → Cafeteria ⁹⁰⁶	beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ event ⁴⁵¹⁹⁹	Gelderland → Bommelerwaard ²⁵⁰
pashadoner-hoevelaken.nl	Pasha Döner Hoevelaken	The Pasha Döner Hoevelaken website offers online ordering for Turkish dishes such as pizzas, plates, and sandwiches, along with accompanying snacks and drinks.	Fast Food → Döner ²³⁸ Fast Food → Fries ⁹⁴⁹	kapsalon ⁵⁰⁹ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Nijkerk → Hoevelaken ⁴⁴⁹
mixorbezorgd.nl	Mixor Ede	The Mixor Ede website offers online ordering for a wide range of food items, including pizzas, sandwiches, snacks, fries, and drinks, with options for pickup and delivery.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Ede ⁵¹⁰⁴
inmijnkeukentje.nl	In Mijn Keukentje	The website ‘My Kitchen’ offers information on kitchen products, recipes, and kitchen tips.	Kitchen → Kitchen Supplies ¹⁰⁵ Kitchen → Kitchen Appliances ⁷²⁴	kitchen machine ²³ tips ²⁷⁸⁹ snack ²⁹¹⁶ recipe ⁵¹⁴²
cancomatic.nl	Cancomatic	The website of Cancomatic is a total supplier providing companies with coffee machines, vending machines, and related products and services, with a focus on advice and service.	Logistics & Transportation → Vending Machines ⁶⁹ Coffee & Tea → Coffee ¹⁰⁶⁴	fruit ¹¹⁶⁶ snack ²⁹¹⁶ machine ³⁷²⁷ coffee ³⁸³⁸
broekplein.nl	Broekplein	Sportcafé Broekplein is a sports facility and cafe in Leiden that offers food and drinks to be picked up.	Quick Bites → Snack Bar ⁵⁸⁰ Sport Facility → Sports Centers ⁴³⁹	sports hall ²⁷⁰ cafe ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Leiden ⁷⁰⁸⁹
geveltoerist.nl	De Geveltoerist	The website of De Geveltoerist presents the menu and contact information of a cafe in Enschede.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
warungwaddinxveen-waddinxveen.nl	Warung Waddinxveen	Warung Waddinxveen is an online ordering service in Waddinxveen offering a diverse menu of Indonesian dishes.	Food Delivery → Indonesian ⁵⁰² Food Delivery → Surinamese ²⁶⁵	tjauwmin ¹⁰ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Waddinxveen ¹⁰⁴⁶
bierbelevers.nl	BierBelevers	The website of BierBelevers aims to excite and inform beer enthusiasts about beer tastings and events.	Beer → Craft Beer ¹⁹⁹ Culinary & Tastings → Beer Tasting ⁹¹	beer tasting ⁴⁷ presentation ¹⁷⁸⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Overijssel → Oldenzaal ¹²¹⁹
cafetariademeeuw.nl	Cafetaria de Meeuw	Cafetaria de Meeuw is a cafe in Groningen offering a variety of snacks, salads, and sandwiches.	Fast Food → Fries ⁹⁴⁹ Hospitality → Suppliers ¹⁰⁵⁷	neighborhood ²⁴²⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Groningen → South ²²³
decateringman.nl	De Cateringman	De Cateringman is a company that provides catering services and packages for parties, events, and celebrations.	Events & Hospitality → Parties ³³ Culinary & Tastings → Gatherings ⁹²	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ party ⁵⁹²⁸ package ⁶¹¹² catering ⁶⁴⁵⁶	Voorst → Teuge ¹¹²
grandcafetariaici.nl	Grand cafetaria ICI Sleeuwijk	The website of Grand cafetaria ICI Sleeuwijk offers an online ordering system for snacks, meals, and drinks, with home delivery options and a points-saving program.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Altena → Sleeuwijk ¹⁶²
cafetaria-moeierboom.nl	De Moeierboom	De Moeierboom is an online restaurant and catering business in Etten-Leur that offers various dishes, including shawarma, sandwiches and Turkish specialties, for delivery or takeaway.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	shawarma ³³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	North-Brabant → Etten-Leur ¹³⁶⁶
eethuisgroesbeek.nl	Eethuis Groesbeek	The website of Eethuis Groesbeek offers online ordering, delivery, and takeaway options for a variety of dishes and drinks.	Food Delivery → Delivery ²²²⁷ Mediterranean & Middle Eastern → Takeout ²⁸⁶	snack ²⁹¹⁶ reviews ³¹⁷² pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Berg en Dal → Groesbeek ⁶⁵³
snackmobiel-vlijmen.nl	Snackmobiel Vlijmen	Snackmobiel Vlijmen is a mobile snack truck that delivers fresh-cut fries, snacks, and ice cream to locations, with a focus on quality and sustainability.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	ice cream ¹⁰⁰⁰ truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	Heusden → Vlijmen ³⁸⁹
houtenhond.nl	Hout & Hond	The website Hout & Hond sells handmade wooden dog food bowls and other articles for dogs.	Pet Supplies → Dog Supplies ¹¹² Animals → Pet Stores ⁴⁷⁸	basket ²⁷⁵ toy ²²⁹⁵ snack ²⁹¹⁶ wood ⁴¹⁵³
snackpointputh-online.nl	Snackpoint Puth	The website of Snackpoint Puth offers an online ordering system for snacks and meals, with delivery or pick-up options in the Puth region and surrounding areas. The goal is to provide customers with an easy way to order and receive food.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Meal Boxes ⁶³	time ⁹³² promotion ²⁰⁶² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Beekdaelen → Sweikhuizen ²⁴
snackparadise.nl	Snack Paradise Hoofddorp	The website of Snack Paradise is an online ordering platform and information source for the snack bar Snack Paradise located in the shopping center ‘t Paradijs in Hoofddorp, where visitors can order and collect snacks and fries online.	Quick Bites → Snack Bar ⁵⁸⁰ Commerce → Shopping Centers ¹⁰⁰¹	shopping center ⁴⁹¹ fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ order ⁶⁹¹² menu ¹³⁸⁵⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
broodjeseijst.nl	Broodje Seijst	Broodje Seijst is a catering business located in Zeist that offers freshly made sandwiches, soups, and snacks.	Food Delivery → Indonesian ⁵⁰² Catering & Ready Meals → Takeaway ⁴⁰⁹	soup ¹⁰⁴³ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Utrecht → Zeist ²⁶⁴⁴
allwayswokleyweg.nl	All Ways Wok	The All Ways Wok website offers an online webstore where visitors can order wok dishes, Chinese meals, soups, sandwiches, and snacks for delivery or pickup. Additionally, extra items, sauces, soft drinks, and alcoholic beverages are offered.	Asian → Chinese ⁴¹⁵	wok dish ⁶⁶ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
kioskwest.nl	Kiosk West Restaurant	The Kiosk West Restaurant website presents a Turkish tea garden in Amsterdam that is open every Saturday evening, offering an authentic atmosphere with live music, tea, coffee, and various snacks and drinks.	Performance → Live Music ¹⁶¹² Community & Social → Social Events ⁴¹⁶	tea garden ⁹⁸ evening ²⁸⁷ tea ¹¹⁴⁶ snack ²⁹¹⁶ music ¹³¹⁷⁰	North-Holland → Amsterdam ⁴¹²⁵³
fritureboom.nl	WebZuid.nl	Friture Boom in Maasbracht is a fast-food restaurant that offers fries and snacks.	Fast Food → Burger Restaurants ³⁴⁶ Sandwiches & Salads → Snacks ⁶⁹³	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Maasgouw → Maasbracht ²⁴⁸
mustigroothandel.nl	Musti Groothandel	Musti Groothandel is a wholesaler based in Maastricht, offering a wide variety of products including beverages, snacks, office supplies, and cleaning products, catering to both hospitality and private customers.	Household Goods → Cleaning Supplies ⁶³³ Office & Workspace → Office Supplies ¹⁰⁸⁶	cleaning products ³⁰⁰ office supplies ⁴³³ beverage ⁵⁸⁶ packaging ²²³⁶ snack ²⁹¹⁶	Limburg → Maastricht ⁶⁰⁰⁸
cafetariakerkstraat.nl	Cafetaria Kerkstraat	Cafetaria Kerkstraat is a cafeteria located in Heesch, offering fries, burgers, and other snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ staff ³⁴⁰⁵ restaurant ¹¹²¹⁵	Bernheze → Heesch ³⁹²
manfriet.nl	Manfriet	Manfriet is a mobile french fry truck that provides catering for events.	Fast Food → Fries ⁹⁴⁹ Freight & Logistics → Trucks ⁸⁹⁹	sauce ¹¹⁴¹ truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
restariabrouwhorst.nl	Restaria Brouwhorst	Restaria Brouwhorst is a cafeteria and restaurant located in Helmond and surrounding areas, offering various types of food and snacks.	Quick Bites → Cafeteria ⁹⁰⁶ Bars & Pubs → Casual Dining ²¹⁷	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ restaurant ¹¹²¹⁵	Helmond → Stiphout ⁹⁶
defrietjongen.nl	De Frietjongen	De Frietjongen is a mobile cafetaria that delivers fries and snacks for groups of 30 or more people in the Bergen op Zoom and Halsteren area.	Fast Food → Fries Chain ⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ price ⁸³²⁸	Bergen op Zoom → Halsteren ²⁹⁸
cafetariapitstop-tynaarlo.nl	Cafetaria Pitstop	Cafetaria Pitstop is an online ordering platform for food and snacks in Tynaarlo. It offers an extensive menu with various sandwiches, potato variations, snacks, and drinks.	Bakery & Food Production → Bread ⁷⁶⁵ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Drenthe → Tynaarlo ¹³⁸⁴
cafetariadehalte.nl	Cafetaria de Halte	Cafetaria de Halte is a snack bar and fries shop located in Ermelo, offering a variety of dishes and snacks.	Fast Food → Fries Restaurants ⁸⁷ Trains → Stations ⁴⁸	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Ermelo ¹²⁰⁷
cafetariawittezwaan.nl	Cafetaria de Witte Zwaan	The website of Cafetaria de Witte Zwaan in Eck en Wiel offers the possibility to order online for takeaway or delivery of various snacks, fries and other dishes.	Quick Bites → Cafeteria ⁹⁰⁶	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Buren → Eck en Wiel ⁶⁷
eurosnack-emmen.nl	EURO SNACK	The Euro Snack website in Emmen offers the possibility to order meals online, including plates, sandwiches, fries, and snacks.	Fast Food → Burger Restaurants ³⁴⁶ Food Delivery → Delivery ²²²⁷	hamburger ³⁶⁴ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Drenthe → Emmen ³³⁴⁸
snackcounterdepomp.nl	Hisight.nl	De Pomp is a snack counter located in Heino that offers freshly prepared snacks and sandwiches.	Quick Bites → Snack Bar ⁵⁸⁰ Food → Foodservice & Catering ⁵⁷⁷	patat ²¹ combo ⁵⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Raalte → Heino ²⁸⁶
iceandfriesbydanny.nl	Ice & Fries by Danny	Ice & Fries by Danny is a snack restaurant in Elspeet that offers fries, burgers, artisanal ice cream and snacks.	Ice Cream → Ice Cream Parlors ⁵²¹ Turkish Cuisine → Fast Food ³²²²	milk ⁴²¹ ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Nunspeet → Elspeet ²⁴¹
hudakookt.nl	Huda kookt	The website ‘Huda kookt’ offers authentic Syrian dishes, focusing on both sweet and savory snacks, prepared and sold by the owner, Huda.	Blogs → Food Blogs ²⁴⁶	spices ³⁴⁰ bread ¹⁶²² buffet ¹⁷⁴⁷ snack ²⁹¹⁶ order ⁶⁹¹²
carnibestsnacks.nl	Carnibest BV	The Carnibest Snacks website is an online shop where customers can order cat and dog snacks.	Pet Supplies → Animal Food ¹⁸	poultry ¹⁸⁰ pet ¹⁶¹⁷ meat ²⁰⁵⁵ snack ²⁹¹⁶ order ⁶⁹¹²	Gelderland → Ermelo ¹²⁰⁷
pizzeriamarum.nl	Pizzeria Marum	The website of Pizzeria Marum presents the menu, opening hours, and offers the possibility to order online or takeaway.	Fast Food → Döner ²³⁸ Catering & Ready Meals → Takeaway ⁴⁰⁹	döner kebab ⁸¹ takeaway ⁶⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Westerkwartier → Marum ²⁷¹
cafetaria-dezaak.nl	Cafetaria de Zaak Hapert	Cafetaria de Zaak Hapert is a cafe located in Hapert, Netherlands, that offers a variety of dishes, including fries, snacks, main courses and sandwiches.	Cafes → Brown Cafés ⁵⁹⁹	main course ¹⁰² meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹²	Bladel → Hapert ²⁴⁰
cafetariatuncha.nl	Cafetaria Tuncha	Cafetaria Tuncha is a cafetaria and catering business located in Margraten, Netherlands, offering a variety of products and services including fries, snacks, hamburgers, sandwiches, Thai food, and beverages.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	thai food ²⁵ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Eijsden-Margraten → Margraten ²²³
bakerystars.nl	Bakery Stars	Bakery Stars is a company that supplies a wide range of bakery products to various sectors, including hospitality, retail, and convenience.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Food → Foodservice & Catering ⁵⁷⁷	pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶ pizza ⁴¹⁵⁸ sustainability ¹⁸⁴⁵¹
diwalibox.nl	Diwalibox	The Diwalibox website offers an online shop for Diwaliboxes, consisting of savory and sweet snacks and gifts, with the goal of making Diwali celebrations easier and richer.	Pastry → Cakes ⁸²⁶ Physical Fitness & Exercise → Dietary Needs ¹³	customer reviews ⁷⁹ box ¹⁹⁸² snack ²⁹¹⁶
cafetaria-anklaar.nl	Cafetaria Nieuw Anklaar	Cafetaria Nieuw Anklaar's official website offers online ordering and information about the cafeteria.	Fast Food → Fries ⁹⁴⁹	toyota ¹⁰⁹ prize wheel ⁴⁰² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
maestro-online.nl	Maestro Webshop	The website offers online ordering of a variety of dishes and products, including sandwiches, wraps, pizzas, plates, snacks, and drinks, with delivery to your home.	International → Turkish ⁴¹⁶ Turkish Cuisine → Takeout Restaurant ⁸¹	plate ⁷⁸⁷ wrap ⁸²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Maasdriel → Kerkdriel ²³⁴
marcantfood.nl	MarCant Tubbergen	The MarCant Tubbergen website allows customers to order burgers and snacks online, featuring an online ordering system and a mobile app.	Applications → Apps ⁴³⁵ Mobile & Wireless Communication → Mobile Apps ⁵³⁴	discounts ⁷⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Overijssel → Tubbergen ⁸⁸⁵
cafetariacicek.nl	Cafetaria Cicek	The website of Cafetaria Cicek in Nijmegen offers online ordering options for a variety of dishes and drinks, including delivery and takeaway.	Quick Bites → Snack Bar ⁵⁸⁰ Turkish Cuisine → Fast Food ³²²²	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Nijmegen ⁹³⁸⁴
uitlaatservicekrimpenerwaard.nl	Hondenuitlaatservice Krimpenerwaard	Hondenuitlaatservice Krimpenerwaard offers a dog walking and dog snack service in the Gouda, Krimpenerwaard, and Krimpen a/d IJssel region.	Dog Care → Dog Walking Service ³⁵⁶ Family → Pet Services ⁵⁴	field ⁵²⁷ game ²⁸⁰⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Bergambacht ³⁰³
onyx-dog-enrichment.nl	ODE- Onyx Dog Enrichment	ODE- Onyx Dog Enrichment is a webshop offering natural dog food, food toys, snacks, and toppings.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ sustainability ¹⁸⁴⁵¹
snackpilot.nl	SnackPilot	SnackPilot is a website offering monthly snack boxes with themes from various countries and states of the USA, aiming to explore and share international snack cultures.	Stories → Travel Stories ⁴⁶² Food → Culinary Travel ⁴³	snack box ³⁹ country ⁵³⁰ snack ²⁹¹⁶ culture ³⁹²²
grandcafesjapo.nl	Grand Cafe Sjapo	Grand Cafe Sjapo is a café and grand café in Hoofddorp that offers drinks, parties, and lunches.	Cafes → Brown Cafés ⁵⁹⁹ Cafes → Grand Cafés ²²⁸	café ⁹⁴⁴ table ¹⁷⁷⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹ party ⁵⁹²⁸	Haarlemmermeer → Hoofddorp ²⁷³⁹
lunchroomrigtpunt.nl	Lunchroom het Rigtpunt	Lunchroom het Rigtpunt is a lunchroom in Enschede that offers sandwiches, salads, and other lunches, with the option for online ordering and delivery.	Quick Bites → Cafeteria ⁹⁰⁶ Grilling & Steaks → Restaurant Type ⁵⁰	meetings ¹⁰¹¹ lunch ¹⁵³⁴ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
broodjeschouten.nl	Broodje Schouten	The website of Broodje Schouten is an online shop selling sandwiches, snacks, and drinks in Ermelo.	Cafes & Lunch → Lunch Spots ²³⁷ Sandwiches & Salads → Snacks ⁶⁹³	panini ¹⁵⁶ wrap ⁸²⁶ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Ermelo ¹²⁰⁷
cafetariaheiakker.nl	Cafetaria D'n Heiakker	The website of Cafetaria D'n Heiakker Deurne offers an online ordering system for snacks and meals, with a digital menu, reviews, and the option to sign up for a newsletter.	Quick Bites → Cafeteria ⁹⁰⁶ Nature & Outdoors → Outdoor Recreation ⁶⁰	family package ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Deurne ¹³²⁹
cafetariaxingxing-enschede.nl	Cafetaria Xing Xing Enschede	Cafetaria Xing Xing Enschede is an online ordering platform for various snacks, fries, hamburgers, and Chinese dishes in Enschede.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	chinese dish ¹⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
desnek.nl	De Snek Delft	De Snek Delft is a restaurant in Delft that accepts online orders for delivery and takeout.	Food → Restaurants & Dining ²⁷³²⁵	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Delft ⁵³⁰⁹
eetcafewooldrik.nl	Eetcafe Wooldrik	The website of Eetcafe Wooldrik in Enschede is an online platform where visitors can order dishes, snacks, and drinks for delivery or pickup. It also provides information about the restaurant and customer reviews.	Fast Food → Fries Chain ⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
hollywoodalmere.nl	Panpan Sushi & Snack Almere	The website of Panpan Sushi & Snack in Almere offers an online ordering platform for sushi, snacks, and other dishes with delivery options and a loyalty point system.	Japanese → Sushi ⁹⁷¹	points ⁶¹² sushi ¹⁶⁹⁵ promotion ²⁰⁶² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
frituuropwielen.nl	Frituur op wielen	Frituur op wielen is a mobile fries truck that rents out fries and snacks in South Limburg.	Fast Food → Fries ⁹⁴⁹	fry truck ³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Valkenburg aan de Geul → Berg en Terblijt ⁹²
dogifood.nl	DogiFood	The website DogiFood sells natural dog food and related products online.	Pet Food → Dog Food ³²¹ E-Commerce → Pet Supplies ¹⁰¹³	kibble ⁴⁶ dog food ²⁰⁴ skin ²⁵¹⁸ snack ²⁹¹⁶
cafetariastekje.nl	Cafetaria Youli Groesbeek	The website of Cafetaria Youli Groesbeek provides an online ordering system for takeaway and delivery services from the cafeteria. Customers can visit here to order dishes, view the menu, and earn points for discounts.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Berg en Dal → Groesbeek ⁶⁵³
daily-meat.nl	Daily Meat	The Daily Meat website is an online shop and sales point offering high-quality, natural snacks and fresh meat for dogs, with a focus on quality and sustainability.	Fast Food → Fries ⁹⁴⁹ Pet Food → Dog Food ³²¹	gluten ²⁰ dog food ²⁰⁴ meat ²⁰⁵⁵ ingredients ²³⁴⁶ snack ²⁹¹⁶ sustainability ¹⁸⁴⁵¹	Overijssel → Twente ²⁵⁷⁸
ethuusdekokkerieje.nl	Ethuus De Kokkerieje	The website of Ethuus De Kokkerieje presents the offering of a catering company specializing in sandwiches, meals, buffets, and snacks, with a focus on both business and private clients.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶
nutritastisch.nl	Nutritastisch	Nutritastisch is an online shop offering affordable low-carb products, focusing on healthy and sustainable nutrition.	Nutrition → Healthy Eating ⁶³⁴ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	sweetener ¹³ meal replacement ²² baking mixes ⁴¹ tea ¹¹⁴⁶ snack ²⁹¹⁶
geslaagdcadeautje.nl	Geslaagdcadeautje.nl	The website Geslaagdcadeautje.nl offers unique mailbox gifts and gift packages, including an accompanying online quiz, for various occasions.	Commerce → Gift Baskets ²⁹¹ Human Resources → Employee Benefits ²⁴⁵	gift package ⁵³⁰ quiz ⁷¹⁰ snack ²⁹¹⁶ gift ⁶⁴⁴²
hapjesvoorverjaardag.nl	Hapjesvoorverjaardag.nl	The website aims to provide visitors with information and inspiration about snacks and appetizers for birthday parties.	Sandwiches & Salads → Appetizers ⁴⁰ Parties → Birthday Parties ¹⁰⁰⁸	idea ²³⁶⁷ snack ²⁹¹⁶ inspiration ⁴⁰⁸¹ recipe ⁵¹⁴² party ⁵⁹²⁸
cafetariarbc.nl	Roosendaal Beste Cafetaria	The website of Roosendaal Beste Cafetaria offers an online menu and ordering options for hamburgers, fries, snacks, sandwiches, and milkshakes, with price listings. The website also showcases various catering options for events, family and corporate parties.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	North-Brabant → Roosendaal ²⁶⁷⁷
cafetaria-ganzenpoort.nl	Cafetaria Ganzenpoort	The website Cafetaria Ganzenpoort offers online ordering options for meals from the cafe in Amsterdam, with an extensive menu and customer reviews.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	doner ¹³¹ chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
shantas-amsterdam-zuidoost.nl	Shanta's Roti's	The Shanta's Roti's website allows users to order meals online from Amsterdam, specializing in rotis, rice dishes, bami, and nasi, along with snacks and drinks.	Food Delivery → Surinamese ²⁶⁵	rice dishes ⁷⁶ bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
feath-pets.nl	Feath Pets	Feath Pets is a shop that offers accessories and supplies for pets.	Kitchen → Dining ¹²	basket ²⁷⁵ pet ¹⁶¹⁷ toy ²²⁹⁵ snack ²⁹¹⁶ accessories ¹²⁹⁷⁵
europaeethuis-heemskerk.nl	Europa Eethuis	The website Europa Eethuis is an online ordering platform for dishes from the restaurant Europa Eethuis in Heemskerk. Customers can view the menu and order their favorite meals online.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner ⁶⁷³ wrap ⁸²⁶ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Heemskerk ¹¹¹¹
snackbarrodi.nl	Snackbar Rodi Rotterdam	The website of Snackbar Rodi Rotterdam allows visitors to order snacks online for pickup in Rotterdam.	Restaurants & Dining → Takeaway Restaurants ²⁴⁰	pickup ⁷³⁶ payment ¹³⁸⁹ snack ²⁹¹⁶ employee ⁴⁴²⁹ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
mintyschoice.nl	Minty's Choice	The website Minty's Choice & Advice is an online store that offers natural snacks and nutritional advice for dogs and cats.	Pet Food → Dog Food ³²¹	dog snacks ³⁵ topper ⁹² allergy ²⁵⁴ nutritional advice ³¹⁷ diet ⁷⁴⁷ snack ²⁹¹⁶
dogdeli.nl	Dog Deli	The website Dog Deli offers healthy, luxury dog snacks made from natural BARF meat without added additives, and is suitable for training and enjoyment.	Pet Food → Dog Food ³²¹	barf ¹¹ sample ⁴¹⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ training ²⁸¹³³
barvolt.nl	Bar Volt	Bar Volt is an in-house smoothie bar located at Touchée Dance Company, offering healthy smoothies, juices, coffee, tea, and snacks.	Beverages → Smoothies ⁵¹ Beverages → Juice ²⁶	smoothie bowl ¹⁷ juice ²⁰⁷ smoothie ³⁸⁴ soup ¹⁰⁴³ snack ²⁹¹⁶ coffee ³⁸³⁸
paddockaandedeur.nl	Paddock aan de Deur	The website of Paddock aan de Deur offers a mobile food experience, including cocktails, diverse culinary concepts, and snacks, with a focus on events and company parties.	Bars → Cocktail Bars ²³⁶ Culinary & Tastings → Gastronomic Events ³⁰	cocktail ⁹²⁵ trailer ¹⁶²⁴ snack ²⁹¹⁶ concept ³³³⁸ event ⁴⁵¹⁹⁹	Lansingerland → Bleiswijk ⁵⁷⁹
petshaircare.nl	Pets Haircare Trimsalon & Shop	The Pets Haircare Shop website and salon & shop focuses on providing grooming services and selling products for dogs and cats, including trims and a selection of food, accessories, and care items.	E-Commerce → Pet Supplies ¹⁰¹³ Animal Care → Dog Care ¹³⁹⁸	grooming ⁸⁹⁶ cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ accessories ¹²⁹⁷⁵	Venlo → Arcen ²³⁴
food85.nl	Food85	Food85 is a delivery service that provides sandwiches, breakfast, lunch, and snacks in Utrecht and surrounding areas, offering vegetarian, vegan, and allergy-friendly meal options.	Food Delivery → Delivery ²²²⁷	lunch ¹⁵³⁴ breakfast ¹⁸²² box ¹⁹⁸² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
avondwinkelvanwouamsterdam.nl	Avondwinkel van Wou	The website Avondwinkel van Wou offers an online ordering system for meals and beverages from Amsterdam. Customers can view the menu and order dishes online for delivery.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → International ¹²⁰⁷	meal ¹⁶³⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
eetcafe-babo-amsterdam.nl	Eetcafe Babo	Eetcafe Babo is a cafe in Amsterdam that accepts online orders for sandwiches, burgers, snacks, and drinks.	Fast Food → Fries Restaurants ⁸⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
tuutjevanruudje.nl	Tuutje van Ruudje	The website of Tuutje van Ruudje presents a mobile fry truck that delivers fries and snacks for events and parties in Limburg and surrounding areas.	Fast Food → Fries ⁹⁴⁹	fry truck ³⁸ snack ²⁹¹⁶ reservation ³³⁷³ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹
cafetariavanruyven.nl	Cafetaria van Ruyven	The website of Cafetaria van Ruyven in Maassluis presents the menus, opening hours, and history of the cafeteria, which is decorated in a 1960s style and offers various snacks, sandwiches, and drinks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Maassluis ⁹⁸⁸
cafetariadwars.nl	Cafetaria Dwars	The official website of Cafetaria Dwars in Nijmegen offers online ordering for delivery and takeaway, as well as information about opening hours, contact details, and job openings.	Quick Bites → Cafeteria ⁹⁰⁶	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ salon ⁵⁵⁴¹	Berg en Dal → Groesbeek ⁶⁵³
tigrys-tropical-almere.nl	Tigry's Tropical Bandastraat	Tigry's Tropical Bandastraat is a restaurant in Almere that accepts online orders.	Food Delivery → Surinamese ²⁶⁵ Dishes → Soups ⁸⁷	rice dishes ⁷⁶ roti ³⁰³ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
ragstorichesdogfood.nl	www.privatelabelshop.nl	The website is an e-commerce store primarily focused on selling pet food and pet supplements for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	bone ³⁵ cat food ⁹⁸ dog food ²⁰⁴ oil ⁹⁷⁰ supplement ¹⁹⁶⁸ snack ²⁹¹⁶
cafetariajacquelineloeffen.nl	Jacqueline Loeffen	Cafetaria Jacqueline Loeffen is a catering establishment that serves Mexican-style ground meat with various side dishes and sandwiches.	Quick Bites → Cafeteria ⁹⁰⁶ Features & Services → Traditional Restaurants ⁸³	coziness ²³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Oss → Berghem ²⁵³
receptplek.nl	ReceptPlek B.V.	ReceptPlek.nl is a website offering a collection of recipes and meal ideas, aimed at inspiring and assisting home cooks in preparing their own meals.	Cooking & Recipes → Vegan Recipes ¹¹	dessert ⁴⁹⁶ lunch ¹⁵³⁴ meal ¹⁶³⁸ category ²³¹⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
enkhuizerfriethuys.nl	Enkhuizer Friethuys	The website of Enkhuizer Friethuys describes a traditional french fry stand specializing in freshly cut fries made from locally grown potatoes and a selection of artisanal snacks.	Fast Food → Fries ⁹⁴⁹	potato ⁵⁴² sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	North-Holland → Enkhuizen ¹⁰⁶⁴
deziepe-mobiel.nl	The Ziepe Mobiel	The Ziepe Mobiel is a company that rents out mobile fry carts for various occasions, primarily in the region of Limburg.	Cooking & Recipes → Frying ¹³ Home → Online ²²	fry cart ¹⁹ fry ⁵⁹ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Netherlands → Limburg ³¹⁹⁰⁹
snackbardeknuistboom.nl	Cafetaria de Knuistboom	The website of Cafetaria de Knuistboom in Oisterwijk provides an online ordering system for snacks, drinks, and desserts, with options for delivery and pickup, and a prize wheel with fun prizes.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	ice cream parlor ⁹⁹ prize wheel ⁴⁰² snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Oisterwijk ¹⁴²²
vovgoes.nl	Sociëteit ‘Van Ongenuchten Vrij’	The website of the ‘Van Ongenuchten Vrij’ Society in Goes describes the search for castlemen (servers) for serving members.	Volunteering → Service Clubs ¹⁷¹	society ¹³⁷⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹	Zeeland → Goes ¹⁸⁹⁹
pannenenpumps.nl	Pannen and Pumps	The website offers a variety of festive snacks, platters, and gifts, aimed at creating culinary experiences.	Restaurants & Dining → Seafood Restaurants ⁶¹² Cooking & Recipes → Dishes ³³⁵	platter ⁶⁶ snack ²⁹¹⁶ recipe ⁵¹⁴² drink ⁵¹⁹¹ gift ⁶⁴⁴²
piesofkeek.nl	Pies of Keek	The website Pies of Keek offers a variety of cakes, pastries, and catering services.	Pastry → Cakes ⁸²⁶ Bakery & Food Production → Online Bakeries ⁵⁶	cake ¹⁷³⁰ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶
patatbuffet.nl	Vosmeijer Catering	The website of Vosmeijer Catering offers mobile french fry and snack services for various events and parties.	International Cuisine → Turkish Cuisine ²²	chicken ⁹⁴⁴ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹
plazasnackpaleis.nl	Plaza Snackpaleis - Cafetaria Oudeschoot	The website of Plaza Snackpaleis - Cafetaria Oudeschoot presents the products and services of a snack bar and cafeteria, highlighting the Plaza formula, known for its wide range of products and quality.	Quick Bites → Cafeteria ⁹⁰⁶	folder ³⁰⁰ satay ³²⁰ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Heerenveen → Oudeschoot ³⁷
chanellies.nl	Chanellies	The Chanellies website offers handcrafted cakes and snacks, emphasizing quality, flavor, and presentation, with options for pickup or delivery.	Pastry → Cakes ⁸²⁶	cheese board ²⁸ cupcakes ²⁷⁴ pastries ⁹⁴⁶ cake ¹⁷³⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶	Westerveld → Old Willem ¹⁸
aminozurenkopen.nl	Aminozurenkopen	The website Aminozurenkopen.nl provides information about amino acids and recipes incorporating protein, with a focus on healthy and responsible snacks and recipes.	Supplements → Proteins ⁸⁰ Hobbies → Baking ³²⁹	chickpeas ¹⁵ amino acids ³⁰ protein ²⁹⁹ pancakes ⁵⁶⁸ snack ²⁹¹⁶ recipe ⁵¹⁴²
edexfood.nl	Edex Food Groothandel B.V.	The website of Edex Food Groothandel B.V. serves as an online platform for the purchase of a wide range of Balkan food products, including delicacies, beverages, and meat products.	Wholesale → Food Products ³⁰³ Supply Chain & Logistics → International Trade ¹¹⁵⁶	meat products ²⁷² delicacies ²⁷³ beverage ⁵⁸⁶ snack ²⁹¹⁶ food ³⁸⁷² assortment ⁷⁷⁹⁹
itsteesurhuisterveen.nl	It Stee Surhuisterveen	The website of It Stee Surhuisterveen is an online platform where visitors can order snacks, sandwiches, and other meals online for pickup or delivery in Surhuisterveen.	Catering & Ready Meals → Takeaway ⁴⁰⁹	prize wheel ⁴⁰² pickup ⁷³⁶ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Achtkarspelen → Surhuisterveen ²⁸¹
cafetariaheeze.nl	Cafetaria Heeze	Cafetaria Heeze is a cafe located in Heeze that offers a variety of snacks and meals, including vegetarian and allergen-free options.	Quick Bites → Cafeteria ⁹⁰⁶ Foodservice & Catering → Canteens ¹¹	allergy ²⁵⁴ vegetarian ³³⁷ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶	Heeze-Leende → Heeze ⁴⁶³
feestelijkehapjes.nl	Feestelijkehapjes B.V.	The website FeestelijkeHapjes.nl offers the possibility to order luxury snacks and catering services, both for businesses and for private parties.	Sandwiches & Salads → Snacks ⁶⁹³	trays ⁵³ extras ⁶⁴ bread ¹⁶²² snack ²⁹¹⁶ dish ⁵⁹³⁶
dutta-shop.nl	Dutta's Webshop	Dutta's Webshop is an online store offering a diverse range of dog products.	Pet Supplies → Dog Supplies ¹¹²	harnesses ⁷⁶ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ dog ⁵⁴⁸³ article ⁶⁰⁰⁰ webshop ⁸⁶⁴⁸
voervoormijnhond.nl	Van Baaren Diervoeders	The website is an online shop specializing in hypoallergenic dog food and related products.	E-Commerce → Pet Supplies ¹⁰¹³ Animals → Pet Food ⁵⁸⁴	dog food ²⁰⁴ return ⁹⁰⁹ snack ²⁹¹⁶ ship ⁵¹⁰³ brand ¹⁷⁷³⁷	Utrecht → Rhenen ⁹³⁵
gevuldekoelkast.nl	Bierbuik	The Gevuldekoelkast.nl website offers a service where visitors can assemble their own refrigerator filled with beer, soft drinks, and snacks, which is then delivered on the day of the event.	Household Appliances → White Goods ¹³² Beverages → Beer ¹⁰⁹⁵	refrigerator ⁴⁷⁵ form ⁶⁷⁹ beer ²⁸⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹	Opmeer → Spanbroek ¹⁰⁵
mevlanakip.nl	Mevlana	Mevlana is a company selling doner and other meat products, primarily through the Central Wholesale Market in Amsterdam.	Animal Husbandry → Poultry ²²⁷ Meat → Meat Products ²¹¹	doner ¹³¹ meat ²⁰⁵⁵ market ²⁷⁷² snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
sakis.nl	Cafetaria Sakis	The website Cafetaria Sakis offers online ordering for food and drinks from Utrecht. Visitors can view the menu and place orders.	Quick Bites → Snack Bar ⁵⁸⁰	gyro ⁹⁵ croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariapromenade.nl	Cafetaria / Lunchroom De Promenade Ter Apel	The website of Cafetaria / Lunchroom De Promenade in Ter Apel offers an online ordering system for fries and snacks. It also provides information about the restaurant and customer reviews.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Westerwolde → Ter Apel ³⁴⁵
koi360koivoer.nl	Nutramare	The website offers high-quality fish food, particularly koi food, and related products for Koi carp.	Fish → Koi ⁵⁵ Fish & Seafood → Fish ³⁸⁸	koi food ¹³ koi ¹⁰⁷ snack ²⁹¹⁶ food ³⁸⁷²
cafetariahaagweg.nl	Cafetaria Haagweg	The website Cafetaria Haagweg offers an online ordering system for food and snacks, which are delivered in The Hague and Rijswijk.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
cafetarianoord-hilversum.nl	Cafetaria Noord	Cafetaria Noord is an online ordering platform for food in Hilversum, offering a wide menu selection.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	döner kebab ⁸¹ burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
devissalon.nl	De Vissalon	The website ‘De Vissalon’ offers the possibility to order various types of fish and accompanying dishes online, including cold fish, hot sandwiches, snacks, and grilled fish. Home delivery is also available.	Restaurants & Dining → Seafood Restaurants ⁶¹²	menus ²²¹ fish ¹¹²¹ sauce ¹¹⁴¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
eethoek-10.nl	Eethoek 10	The website Eethoek 10 is an online platform where visitors can order dishes from the Eethoek 10 in Amsterdam. It offers a menu and the possibility to place online orders.	Sandwiches & Salads → Snacks ⁶⁹³ Pastries & Baked Goods → Menus ²²³	hotwings ¹⁹ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
haarlemschesnackbarhaarlem.nl	Haarlemsche Snackbar Haarlem	The website of Haarlemsche Snackbar Haarlem is an online ordering platform for a snack bar in Haarlem.	Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Haarlem ⁸⁶⁷⁴
roopramroti-denhaag.nl	Roopram Roti Den Haag	The website Roopram Roti Den Haag offers the possibility to order food online from Den Haag, with a focus on roti dishes, rice dishes and a variety of snacks and drinks.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	filled sandwiches ¹⁴ rice dishes ⁷⁶ roti ³⁰³ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
snackkiosk-caland.nl	Snackkiosk Caland	The website Snackkiosk Caland offers online ordering for various dishes, including sandwiches, pizzas, wraps and snacks, which are prepared and delivered in The Hague.	Sandwiches & Salads → Sandwich Shops ²²⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
veganpop.nl	Cheesepop B.V.	The Veganpop website promotes and sells a plant-based cheese snack, called Veganpop, focusing on sales, recipes, and news.	Wholesale → Food Products ³⁰³ Vegan & Vegetarian → Vegan ³⁹⁰	snack board ¹²² cheese ¹²⁰⁵ snack ²⁹¹⁶ recipe ⁵¹⁴²
buddies.nl	Buddies	The website of Buddies presents ‘The ONE-MINUTE snack’, a ready-to-eat snack that can be prepared in one minute in the microwave.	Websites → Information Pages ⁷⁵ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	crust ¹⁷ microwave ³³ apple ³²¹ top ³⁷⁷ bread ¹⁶²² snack ²⁹¹⁶
snackbarfrank.nl	Snackbar Frank	Snackbar Frank is a snack bar located in Hoogeveen that focuses on providing good service and fries.	Fast Food → Fries ⁹⁴⁹	snack bar ¹⁶² fries ²⁷⁵³ snack ²⁹¹⁶	Drenthe → Hoogeveen ²²⁹⁴
snoep-shop.nl	Snoep Shop	The website snoep-shop.nl is an online store that offers a wide assortment of candy, drops, nuts, and other snacks.	Chocolate & Sweets → Chocolate ⁵⁸⁷	muesli ¹⁹ drop ⁷⁵ candy ²⁰⁵ nuts ⁴¹⁷ chocolate ⁹¹¹ snack ²⁹¹⁶
kaikesgrill.nl	Kaikesgrill	Kaikesgrill is a catering company that provides services for fries, snacks, BBQ, and buffets, on-site.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Retail & Commerce → Commerce ⁸²⁴⁴	bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ fries ²⁷⁵³ snack ²⁹¹⁶ party ⁵⁹²⁸
frituurhetwagenwiel.nl	Frituur Het Wagenwiel	Frituur Het Wagenwiel is a snack bar in Axel, Netherlands, serving freshly cut fries made from potatoes from the Zeeland clay.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Quick Bites → Cafeteria ⁹⁰⁶	frituur ¹² potato ⁵⁴² fries ²⁷⁵³ snack ²⁹¹⁶	Terneuzen → Axel ²⁰²
pawsomefood.nl	Pawsome food	The website Natural Dog Food offers a range of natural and high-quality food and grooming products for dogs, focusing on fresh and durable options, as well as supplementary foods and snacks.	Pet Food → Dog Food ³²¹	grooming products ⁵² dog food ²⁰⁴ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷²
samsamtopsnacksarnhem.nl	Sam Sam Topsnacks	The Sam Sam Topsnacks website is an online ordering platform for food and drinks in Arnhem. Customers can view a menu and have meals delivered or collected.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ plate ⁷⁸⁷ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Arnhem ⁸⁶⁸⁰
bolleonline.nl	Cafetaria Eetcafe De Bolle Vaassen	Cafetaria Eetcafe De Bolle Vaassen's official website provides online ordering, delivery, and takeaway options for a variety of dishes and drinks.	Fast Food → Fries ⁹⁴⁹ Jobs → Vacancies ¹⁰⁹⁹	fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Epe → Vaassen ⁴⁷⁷
bunnysweets.nl	Bunny Sweets	The website is an online shop offering dried herbs, vegetables, fruit, snacks, and toys for rabbits and guinea pigs.	Pets → Rabbits ⁸⁹ Animals → Pet Stores ⁴⁷⁸	cage ¹⁰⁴ herbs ⁹²⁴ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
thesandwichclubmestreeg.nl	The Sandwich Club Mestreeg	The Sandwich Club Mestreeg website showcases a lunchroom and sandwich shop in Maastricht offering delicious sandwiches and snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Sandwich Shops ²²⁹	flavor ¹⁰³² snack ²⁹¹⁶ food ³⁸⁷² sandwich ⁴⁰⁹⁸ atmosphere ⁵⁵⁹¹	Limburg → Maastricht ⁶⁰⁰⁸
snackbar-mies.nl	Snackbar Mies	The website of Snackbar Mies presents a snack bar in Bergentheim, Netherlands, offering online ordering and information about their menu, opening hours, and contact details.	Quick Bites → Snack Bar ⁵⁸⁰ TravelContent → Maps ¹⁴¹	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶	Hardenberg → Bergentheim ⁹⁶
cafetariawestlede.nl	Cafetaria Westlede	Cafetaria Westlede is a cafeteria in Tiel that serves fries, snacks and other delicacies in a bistro-like atmosphere.	Quick Bites → Cafeteria ⁹⁰⁶ Commerce → Shopping Centers ¹⁰⁰¹	bistro ²¹⁹ promotion ²⁰⁶² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
cafetariaroyaal.nl	Cafetaria Royaal	The website of Cafetaria Royaal Sassenheim offers the possibility to order online, view the menu, and read recent reviews.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Teylingen → Sassenheim ⁵⁹⁹
grillroomada-eijsden.nl	Grillroom Ada	The website of Grillroom Ada from Eijsden offers the possibility to order food online and view the extensive menu.	Delivery → Online Delivery ²⁷ Quick Bites → Cafeteria ⁹⁰⁶	main course ¹⁰² fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Eijsden-Margraten → Eijsden ²⁶⁶
dogfoodlimburg.nl	Dogfood Limburg	Dogfood Limburg is an online store selling natural dog and cat food, accessories and snacks.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ cat food ⁹⁸ dog food ²⁰⁴ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵	Netherlands → Limburg ³¹⁹⁰⁹
dannini-kerkrade.nl	Dannini Kerkrade	The Dannini Kerkrade website is an ice cream parlor and cafeteria offering a variety of ice cream, sandwiches, and snacks.	Quick Bites → Cafeteria ⁹⁰⁶ Ice Cream → Ice Cream Parlors ⁵²¹	milkshake ¹⁹⁵ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
driessen-kaas.nl	Driessen Druten + Kip en Kaas	The website of Driessen Druten + Kip en Kaas Beneden-Leeuwen presents an online shop and retail assortment of chicken, cheese, snacks, and gifts, and provides information about the companies and their collaboration.	Dairy → Cheese ⁵³⁰ Online Retail → Food Retail ³⁴⁰	delicatessen ¹⁴⁷ chicken ⁹⁴⁴ cheese ¹²⁰⁵ snack ²⁹¹⁶ gift ⁶⁴⁴²	West-Maas en Waal → Beneden-Leeuwen ²⁶⁰
hetvrieshuis.nl	Het Vrieshuis	The Vrieshuis website offers an online shop with a selection of frozen meat products, bread and pastries, snacks, and chicken, with the possibility to order and pick up.	Meal Solutions → Frozen Food ²⁵ Food → Supermarkets & Grocery ³⁵⁶⁸	chicken ⁹⁴⁴ bread ¹⁶²² meat ²⁰⁵⁵ snack ²⁹¹⁶ order ⁶⁹¹²	Twenterand → Vriezenveen ⁴⁸⁷
cafetariahetpark.nl	Cafetaria Het Park	Cafetaria Het Park is a cafeteria located in Franeker, Friesland, offering a wide variety of potato snacks, croquettes, and other snacks.	Fast Food → Burgers ⁶⁸⁷	croquette ¹³⁶ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶	Waadhoeke → Franeker ⁶⁹⁴
bar-bruut.nl	Bar Bruut Deventer	Bar Bruut Deventer is a bar in Deventer offering a variety of drinks, snacks, and entertainment, as well as the option to rent the bar for events.	Bars → Cocktail Bars ²³⁶	cocktail ⁹²⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Overijssel → Deventer ⁴⁷⁵¹
bijjohn.nl	Bij John Lelystad	Bij John Lelystad is a restaurant in Lelystad that offers online ordering for delivery and takeout, and customers have the chance to win prizes and enter lotteries.	Fast Food → Fries Restaurants ⁸⁷	prize wheel ⁴⁰² snack ²⁹¹⁶ order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Flevoland → Lelystad ³¹⁸⁰
crazyfruit.nl	Crazyfruit	The website Crazyfruit.nl sells freeze-dried fruit and fruit snacks, focusing on pure fruit, healthy snacks, and easy sales.	Healthy & Dietary → Healthy Food ⁶³ Cooking & Recipes → Food Supplements ²³	flavor ¹⁰³² fruit ¹¹⁶⁶ snack ²⁹¹⁶ ship ⁵¹⁰³
daanscatering.nl	Daans Catering	Daans Catering is a catering company that supplies various meals and snacks for different occasions, including breakfast, lunch, and drinks.	Sandwiches & Salads → Snacks ⁶⁹³	tapas ⁴⁶⁵ breakfast ¹⁸²² salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
daansontbijtservice.nl	Daans Catering	Daans Catering is an breakfast service that delivers fresh breakfasts, lunch buffets and snacks to private individuals and businesses in various regions, including Gouda, Alphen aan den Rijn and Nieuwerkerk aan den IJssel.	Accommodation → Breakfast ³⁶⁴ Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
dbanyan.nl	Dbanyan	Dbanyan is an online retailer specializing in authentic Indian products, offering a wide selection and shipping throughout the Netherlands and Belgium.	Specialty Foods → International Foods ¹⁹	spices ³⁴⁰ rice ⁶³⁵ snack ²⁹¹⁶ ship ⁵¹⁰³
dirksvis.nl	Dirk's Vis & Meer Beverwijk	The website of Dirk's Vis & Meer Beverwijk is an online shop where customers can order fish platters, snacks, and other dishes for delivery. The website also provides information about the restaurant and allows users to subscribe to a newsletter.	Sandwiches & Salads → Snacks ⁶⁹³ Restaurants & Dining → Seafood Restaurants ⁶¹²	sauce ¹¹⁴¹ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Beverwijk ¹⁶⁹⁰
lunchroomparkzicht.nl	Lunchroom Parkzicht	Lunchroom Parkzicht is a lunchroom located in Utrecht offering a variety of lunch and dinner options, including vegan and vegetarian choices.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Parks & Gardens → Parks ¹⁰⁴³	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
qutepets.nl	Qute Pets	Qute Pets is an online pet store that offers a wide range of products and accessories for dogs, cats, and small animals.	Animals → Pet Food ⁵⁸⁴ Animals → Pets ¹³⁸²	collar ²⁴² grooming ⁸⁹⁶ bed ¹³⁸⁴ pet ¹⁶¹⁷ toy ²²⁹⁵ snack ²⁹¹⁶
thfoodservice.nl	Ten Haken Foodservice	Ten Haken Foodservice delivers hot and cold meals to homes, including meal services, buffets, and snacks, with a focus on quality and convenience.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	meal ¹⁶³⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
tonvisser.nl	Ton Visser Patat & Zo	Ton Visser Patat & Zo is a snack truck offering fries and snacks for events and occasions.	Cooking & Recipes → Frying ¹³ Restaurants & Dining → Fries Kiosks ³³	snack truck ³⁵ snack ²⁹¹⁶ party ⁵⁹²⁸ package ⁶¹¹² event ⁴⁵¹⁹⁹	Westland → Maasdijk ³⁸³
vannultothond.nl	Van nul tot hond	Van nul tot hond is a website offering independent nutritional advice, coaching, and natural products for dogs.	Dogs → Dog Training ⁸⁸¹ Animal Care → Dog Care ¹³⁹⁸	trainer ¹⁹⁶⁶ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ dog ⁵⁴⁸³ coach ²⁵⁸¹⁰
woefhoefshop.nl	WoefHoef Shop	The WoefHoef Shop is an online store that offers 100% natural dog snacks, grooming products, and toys.	Dogs → Supplies ¹⁰⁰⁵ E-Commerce → Pet Supplies ¹⁰¹³	basket ²⁷⁵ grooming ⁸⁹⁶ toy ²²⁹⁵ snack ²⁹¹⁶
4stargrill-dordrecht.nl	4stargrill	The website 4stargrill offers the possibility to order food online from the grill restaurant 4stargrill in Dordrecht. The menu includes a variety of grill dishes, snacks, sandwiches, drinks, and desserts.	Fast Food → Grill Restaurant ¹²⁹	grill dishes ⁴⁶ milkshake ¹⁹⁵ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Dordrecht ⁴⁵³¹
adaonline.nl	AdaOnline	The website AdaOnline is an online shop offering exclusive products such as snacks, art, and handmade amigurumi.	Crafts → Crochet ³⁷⁸	amigurumi ¹⁷ frames ²⁵⁵⁶ snack ²⁹¹⁶
akcateringzwijndrecht.nl	AK Kebabhuis	AK Kebabhuis is an online ordering service for Turkish dishes from Zwijndrecht.	Fast Food → Döner ²³⁸ Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	pide ⁵⁶ kebab ²⁷⁶ kapsalon ⁵⁰⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Zwijndrecht ¹⁴⁵⁵
aksuexpressrotterdam.nl	Aksu Express	The website Aksu Express offers online ordering of food from Rotterdam, featuring a menu of pizzas, burgers, sandwiches and Turkish dishes.	Fast Food → Burgers ⁶⁸⁷ Grilling & Steaks → American ⁸⁵	burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
alanya-enkhuizen.nl	Alanya Enkhuizen	The website Alanya Enkhuizen offers the possibility to order food online.	Fast Food → Chicken Dishes ⁹² Restaurants & Dining → Fries Kiosks ³³	beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	North-Holland → Enkhuizen ¹⁰⁶⁴
amatoo-catering.nl	Amatoo Catering	The Amatoo Catering website presents a Moluccan-Indonesian catering service specializing in providing meals for various events, weddings, and businesses in the Assen region.	Cooking & Recipes → Cooking Classes ²⁹²	rice table ²⁷⁷ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ kitchen ⁶⁴⁴³ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Drenthe → Assen ³⁵¹⁶
amigu-rotterdam.nl	Eetcafe Amigu	The website of Eetcafe Amigu in Rotterdam offers the possibility to order online and have ordered dishes delivered. Additionally, a menu is available and customer reviews are displayed.	Fast Food → Fries ⁹⁴⁹ Cafes → Beer Cafes ²⁰⁹	snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
amsterdampokebowlamsterdam.nl	Amsterdam Poke Bowl	The website of Amsterdam Poke Bowl offers online ordering of Poke bowls and related dishes and drinks.	Japanese → Sushi ⁹⁷¹	poke ²² poke bowl ³⁰⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
anadolueethoek-deventer.nl	Anadolu Eethoek Deventer	The website Anadolu Eethoek Deventer offers the possibility to order meals online from the Turkish-Turkish eatery in Deventer.	Fast Food → Döner ²³⁸ Restaurants & Dining → Restaurant Services ¹⁶	lahmacun ⁹³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Overijssel → Deventer ⁴⁷⁵¹
anatolia-eetpunt-babberich.nl	ANATOLIA EETPUNT	Anatolia Eetpunt is an online ordering platform for food in Babberich, Netherlands.	Fast Food → Fries ⁹⁴⁹	kapsalon ⁵⁰⁹ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Zevenaar → Babberich ¹³⁵
angeliquewellerdiervoeding.nl	Angelique Weller Diervoeding	The website of Angelique Weller Diervoeding is an online shop where customers can order pet food, toys, and grooming products for dogs, cats, birds, and small rodents.	Animals → Pet Food ⁵⁸⁴	pet food ¹¹⁰ grooming ⁸⁹⁶ pet ¹⁶¹⁷ toy ²²⁹⁵ snack ²⁹¹⁶
antalya-kebab-house-goes.nl	Antalya Kebab House	The website Antalya Kebab House from Goes offers the possibility to order meals online. Users can view the menu and order their favorite dishes, including pizzas, calzones, and kebabs, online.	Fast Food → Döner ²³⁸	calzone ⁹⁰ kebab ²⁷⁶ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Zeeland → Goes ¹⁸⁹⁹
anytyme-t-harde.nl	AnyTyme ‘t Harde	The AnyTyme ‘t Harde website is an online platform where customers can order meals and various snacks from the restaurant AnyTyme ‘t Harde in ’t Harde.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Takeaway ⁴⁰⁹	family pack ²⁴ hamburger ³⁶⁴ bread ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Elburg → Spoorstraat ¹⁴²
anytyme-t-smulhoekje-heerlen.nl	AnyTyme 't Smulhoekje	The AnyTyme 't Smulhoekje website is an online platform where customers in Heerlen can order dishes from the restaurant.	Cuisine → Dutch Cuisine ¹⁷⁹	schnitzel ⁶¹ pancakes ⁵⁶⁸ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Limburg → Heerlen ²⁷⁵⁵
anytyme-thepoint.nl	Any Tyme The Point Buitenpost	The website of Any Tyme The Point Buitenpost provides information about the snack bar, including contact details, opening hours, online ordering, and a menu of various snacks, fries, and drinks. The platform also promotes a loyalty system with points and offers a newsletter for discounts.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Achtkarspelen → Buitenpost ²¹⁵
aquilaniitalianbakery-enschede.nl	Aquilani Italian Bakery	The Aquilani Italian Bakery website in Enschede allows customers to order food online, specifically Italian bakery products such as Panzerotti's and other snacks, as well as various beverages.	Dairy & Cheese → Delicatessens ⁶¹⁷	beverage ⁵⁸⁶ ingredients ²³⁴⁶ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
arjanvangochcatering.nl	Arjan van Goch Catering	The website of Arjan van Goch Catering presents a range of catering services, with a focus on barbecues, buffets, and snacks, aimed at events and parties in the Schijndel region.	Outdoor → Barbecues ⁷⁴⁴ Events & Hospitality → Parties ³³	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ package ⁶¹¹² catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Meierijstad → Schijndel ⁹⁰⁸
asia-food-heemskerk.nl	ASIA FOOD	The Asia Food website in Heemskerk offers online ordering for Indonesian, Malaysian, and Thai dishes for delivery or takeout.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Mediterranean & Middle Eastern → Takeout ²⁸⁶	rotis ¹² takeaway ⁶⁵³ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Heemskerk ¹¹¹¹
avondwinkel-apeldoorn.nl	Avondwinkel Diouma	Avondwinkel Diouma in Apeldoorn is a late-night shop offering a wide range of groceries, snacks, and other essentials, providing customers with convenient access to items even when regular supermarkets are closed.	Local & Regional Products → Local Shops ²⁴⁵	groceries ³⁵⁸ snack ²⁹¹⁶ opening hours ²⁹⁵³ shop ⁶⁴⁸³	Gelderland → Apeldoorn ⁶⁹⁹⁶
avondwinkel-overtoom.nl	Avondwinkel Overtoom	Avondwinkel Overtoom is an online store in Amsterdam offering snacks, drinks, and various dishes for delivery.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	points ⁶¹² snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
avondwinkelhapje.nl	Avondwinkel Hapje	Avondwinkel Hapje is a late-night convenience store selling snacks and refreshments in various cities.	Performances & Entertainment → Nightlife ⁷⁰¹	pet supplies ¹¹⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹ assortment ⁷⁷⁹⁹	North-Holland → Alkmaar ⁶⁵⁰⁷
awan-sushi-snack.nl	Awan Sushi & Snack	Awan Sushi & Snack is an online ordering platform for sushi and snacks located in Harderwijk.	Japanese → Sushi ⁹⁷¹	nigiri ¹⁴⁶ bowl ⁴⁸² sushi ¹⁶⁹⁵ salad ²⁴⁴⁴ snack ²⁹¹⁶	Gelderland → Harderwijk ²²⁴⁰
ayodesurinaamsesnackbar-gorinchem.nl	Ayo Surinaamse Broodjes en Maaltijden	The website Ayo Surinaamse Broodjes en Maaltijden offers online ordering of Surinamese sandwiches and meals from Gorinchem. Visitors can view the menu and order their favorite dishes online.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	roti ³⁰³ satay ³²⁰ rice ⁶³⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Gorinchem ¹⁹⁴⁷
bakhuusboulevardlunchroomcafetaria-veenendaal.nl	Bakhuus Boulevard Lunchroom & Cafetaria	't Bakhuus Boulevard Lunchroom & Cafetaria is an online ordering platform for food in Veenendaal, offering a comprehensive menu of fries, sandwiches, and snacks.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Quick Bites → Cafeteria ⁹⁰⁶	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht → Veenendaal ²⁶⁴¹
bakkerij-nieuw-oranje-boskoop-boskoop.nl	Eethuis Oranje Boskoop	The website Eethuis Oranje Boskoop allows users to order food online from the Eethuis Oranje restaurant in Boskoop.	Lunch → Sandwiches ⁴⁶⁶ Quick Bites → Snack Bar ⁵⁸⁰	turkish pizza ⁶³ döner ⁶⁷³ cheese ¹²⁰⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
bakkerijkranen.nl	Bakkerij Kranen	Bakkerij Kranen is a bakery in Renkum that sells bread, pastries, chocolate, and snacks and organizes children’s parties.	Employment & Labor → Work ³³⁶² Pastries & Baked Goods → Organic Bread ⁸⁶	chocolate ⁹¹¹ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶	Gelderland → Renkum ¹³⁰¹
bakkerijnieuwwest-amsterdam.nl	Bakkerij Nieuw West	Bakkerij Nieuw West is an online ordering platform for food from Amsterdam.	Fast Food → Burgers ⁶⁸⁷	döner ⁶⁷³ burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
bakkerklinktheresiastraat-denhaag.nl	Bakker Klink	This website allows customers to order food online from Bakker Klink in The Hague, including bread, pastries, snacks, and drinks.	Bakery & Food Production → Bread ⁷⁶⁵ Online Retail → Food Retail ³⁴⁰	pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
balifood.nl	Bali Food B.V.	The website Bali Food is an Indonesian wholesaler specializing in authentic Indonesian dishes, snacks, sauces, and sambal, serving both private and business (B2B) customers.	Wholesale → Food Products ³⁰³ Catering & Ready Meals → Indonesian Restaurant ³⁹²	sambal ⁵⁴ sauce ¹¹⁴¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹
balifrietbutik.nl	Bali Frietbutik Streetfood Waalwijk	Bali Frietbutik Streetfood Waalwijk is a snack bar offering authentic Indonesian and other Asian dishes and snacks.	Japanese → Sushi ⁹⁷¹	indonesian ⁴⁴ toppings ¹⁵³ rice ⁶³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Waalwijk → Waspik ¹⁴²
baraka-nieuwegein.nl	Baraka Nieuwegein	The Baraka Nieuwegein website offers online ordering for various dishes, including sandwiches, döner kebab, Turkish pizza, wraps, snacks, and salads, with a focus on the location of Nieuwegein.	Turkish Cuisine → Fast Food ³²²² Catering & Ready Meals → Takeaway ⁴⁰⁹	döner ⁶⁷³ wrap ⁸²⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Utrecht → Nieuwegein ²²⁶⁴
bastyon.nl	Cafétaria Bastyon	Cafétaria Bastyon is a takeaway restaurant located in Heesch that offers fries, snacks, and Chinese dishes, and also provides employment opportunities.	Jobs → Vacancies ¹⁰⁹⁹ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	chinese ⁶⁸ nasi ²⁴² fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Bernheze → Heesch ³⁹²
bazaaroverstegendoetinchem.nl	BAZAAR OVERSTEGEN	Bazaar Overstegen is an online ordering service for pizzas and other dishes in Doetinchem.	International → Turkish ⁴¹⁶ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Doetinchem ²⁷⁰⁶
beccaro.nl	Frituur Beccaro	Frituur Beccaro's website promotes its fresh fries and snacks, offering online ordering and delivery services within a specific area.	Food Delivery → Delivery ²²²⁷ Fundraising & Charity → Awards ¹⁵	medal ²¹³ fries ²⁷⁵³ market ²⁷⁷² snack ²⁹¹⁶ app ⁴⁵⁹⁵	North-Brabant → Geertruidenberg ⁶⁹⁴
beethovenetendrinken-heemskerk.nl	Beethoven Eten & Drinken	The website, Beethoven Eten & Drinken, located in Heemskerk, offers an online ordering system for meals, drinks, and snacks, with a focus on dishes such as hamburgers, salads, and meat dishes.	Japanese → Sushi ⁹⁷¹ International → Middle Eastern ¹¹⁶	chicken ⁹⁴⁴ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
bella-amica-helmond.nl	Bella Amica Helmond	The website of Bella Amica Helmond offers the possibility to order meals online in Helmond, with an extensive menu and delivery options.	International → Turkish ⁴¹⁶	döner kebab ⁸¹ dürüm ⁹⁷ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Helmond ³⁰⁵⁸
bierenwijnbezorgservice.nl	Bier en Wijn Bezorgservice	The website offers a delivery service for beer, wine, snacks, and other beverages, possibly with the option to order food.	Beverages → Beer ¹⁰⁹⁵	beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶
bierkoerierregiomeppel.nl	Bierkoerier Meppel	Bierkoerier Meppel is an online service that delivers chilled drinks and snacks in the Meppel region.	Delivery → Beverage Delivery ²⁰ Gifts & Souvenirs → Liquor Stores ²³³	beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹ order ⁶⁹¹²	Drenthe → Meppel ¹⁹⁰³
big-snack-leiden.nl	Snackbar de Timor	The website of Snackbar de Timor in Leiden offers the possibility to view the menu online and place orders for a quick meal.	Fast Food → Fries ⁹⁴⁹ Fast Food → FEBO ²⁴	croquettes ¹⁰⁸ milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → Leiden ⁷⁰⁸⁹
big-star-huissen.nl	Big Star	The website of Big Star in Huissen allows customers to order meals online. It offers a wide menu including fries, snacks, meat dishes, vegetarian options, and kapsalon variations.	Food Delivery → Delivery ²²²⁷ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Lingewaard → Huissen ⁵³⁷
bigflevodonercenter-almere.nl	Big Flevo Döner Center	The Big Flevo Döner Center website from Almere offers an online ordering system for a wide variety of Turkish and Italian dishes, including döner, pizzas, sandwiches and snacks.	Fast Food → Döner ²³⁸	döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
bigstarhuissen.nl	Big Star Huissen	The website of Big Star Huissen offers online ordering for catering, delivery, and takeaway of a variety of snacks and meals, including sandwiches, meat dishes, pizzas, and vegetarian options, as well as alcoholic beverages.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	kidsbox ³⁸ meat dishes ⁶⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Lingewaard → Huissen ⁵³⁷
bijdavid-ermelo.nl	Bij David	The website of Bij David in Ermelo offers the possibility to order meals online.	Websites → Local Businesses ⁸⁵ Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹²	Gelderland → Ermelo ¹²⁰⁷
bijzonderfrietwerk-dordrecht.nl	Bijzonder Frietwerk	The Bijzonder Frietwerk website offers an online ordering system for meals and snacks in Dordrecht. Visitors can view a menu and place orders for delivery or pickup.	Cafeteria → Dutch Cafeteria ¹²²	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Dordrecht ⁴⁵³¹
blafenblij.nl	Blaf & Blij	Blaf & Blij is a dog day care providing quality dog food and supplementary care products.	Animal Care → Dog Care ¹³⁹⁸	dog food ²⁰⁴ supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ dog ⁵⁴⁸³	Meierijstad → Schijndel ⁹⁰⁸
bobasandicecream.nl	Boba's And Icecream	The Boba's And Icecream website is an online platform where customers can easily place orders for delivery, pickup or collection of products, including beverages, ice cream and various snacks, in Zwijndrecht.	Ice Cream → Ice Cream Parlors ⁵²¹ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	boba ¹⁴ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Zwijndrecht ¹⁴⁵⁵
bollywoodfoodbar-amsterdam.nl	Bollywood Foodbar	The website of Bollywood Foodbar presents an online menu and offers the possibility to order meals of Indian-inspired dishes online in Amsterdam.	Ethnic → Indian ³⁵² Food Delivery → Indian Cuisine ⁵⁴³	rice dishes ⁷⁶ streetfood ¹⁵¹ vegetarian ³³⁷ curry ³⁵⁵ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
bonappetit-roermond.nl	Food Factory by Bon Appetit	The website Food Factory by Bon Appetit, located in Roermond, offers an online ordering service for meals and snacks. It displays a menu with various dishes and meals.	Turkish Cuisine → Fast Food ³²²² Grilling & Steaks → American ⁸⁵	burger ¹⁴³¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Limburg → Roermond ²⁶⁰²
bongustaamsterdam.nl	Bongusta!	Bongusta! is an online platform for ordering Surinamese sandwiches, soups, and snacks in Amsterdam.	Food Delivery → Indonesian ⁵⁰² Food Delivery → Surinamese ²⁶⁵	bara ²² chicken ⁹⁴⁴ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
botan-barendrecht.nl	BOTAN	Botan is an online ordering service for food and drinks in Barendrecht, allowing customers to easily have dishes delivered directly to their home.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Supermarkets & Grocery → Butchers ⁷⁴⁷	seasoning ¹⁵ pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Barendrecht ¹⁶⁵³
boxtel-bakkal.nl	Bakkal Boxtel	The website Bakkal Boxtel from Boxtel offers online ordering of various dishes and snacks, including pizzas, kapsalons (wraps), döner kebabs, and salads.	Fast Food → Döner ²³⁸	kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	North-Brabant → Boxtel ¹¹⁵⁴
brabantsehap.nl	Cafetaria de Brabantse Hap	The website of Cafetaria de Brabantse Hap is an online platform where visitors can order food online for takeaway or delivery, and find opening hours, the menu, and contact information.	Quick Bites → Cafeteria ⁹⁰⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Waalwijk ¹⁷⁴⁴
braveballsandburgers.nl	Braveballs & Burgers	The website of BraveBalls & Burgers presents and sells vegan falafel variations (BraveBalls) and burgers, emphasizing flavor, fresh ingredients, and a unique use of coriander.	Vegan & Vegetarian → Vegan ³⁹⁰ Cuisine → Vegetarian ⁶⁹⁷	falafel ¹⁰⁸ vegan ⁵⁰⁸ flavor ¹⁰³² snack ²⁹¹⁶
brendanique.nl	Brendanique	Brendanique is a catering business that provides snacks and meals in and around Brunssum.	Fine Dining & Gastronomy → Private Restaurants ¹⁴	birthday ²⁵² box ¹⁹⁸² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Limburg → Brunssum ⁶²⁶
broodje-lekker-lekker-julianadorp.nl	Broodje Lekker Lekker	The website Broodje Lekker Lekker facilitates online ordering of a variety of dishes and drinks from the restaurant Broodje Lekker Lekker in Julianadorp.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Pastries & Baked Goods → Menus ²²³	chicken ⁹⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Den Helder → Julianadorp ³⁰⁴
broodjeszaak-cairo-dordrecht.nl	Broodjeszaak Cairo	The website Broodjeszaak Cairo is an online ordering platform for sandwiches, dishes, and drinks from Dordrecht. It offers a comprehensive menu with various options, including Turkish pizzas, kapsalons, falafel, wraps, and snacks.	Ready-To-Eat Meals → Wraps ¹⁰² Quick Bites → Cafeteria ⁹⁰⁶	falafel ¹⁰⁸ kapsalon ⁵⁰⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Dordrecht ⁴⁵³¹
butcha-emmerichamrhein.nl	Butcha	Butcha is an online restaurant located in Emmerich am Rhein that allows customers to order meals online.	Fast Food → Burgers ⁶⁸⁷ Delivery → Online Delivery ²⁷	appetizer ⁵⁵⁶ burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸
buurtsuper-oud-mathenesse-rotterdam.nl	Buurtsuper-Oud-Mathenesse	The website is an online ordering platform for Buurtsuper-Oud-Mathenesse, a supermarket in Rotterdam, offering a wide selection of Surinamese dishes, sandwiches, snacks, and drinks.	Food Delivery → Surinamese ²⁶⁵ Food → Supermarkets & Grocery ³⁵⁶⁸	bara ²² roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
by-adriana.nl	By-Adriana	By-Adriana is a catering and lunchroom business offering fresh, pure, and honest meals, lunches, and snacks with a focus on health and taste.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	lunch ¹⁵³⁴ meal ¹⁶³⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹
cadushirotterdam.nl	Cadushi	The website Cadushi in Rotterdam offers the possibility to order food online. It presents a menu with various dishes, including Chinese, Antillian, and Surinamese specialties.	Asian → Chinese ⁴¹⁵ Cooking & Recipes → Culinary ³³⁸	wok ²³¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafe-summertime-mussel.nl	Cafe Summertime	The Cafe Summertime website in Mussel allows customers to order food online and view the current menu.	Fast Food → Fries ⁹⁴⁹	frikandel ¹⁸ shoarma ²⁵⁴ plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Stadskanaal → Mussel ³⁷
cafehetplein.nl	Café het Plein	Café het plein in Zeewolde is a cozy pub offering a wide range of drinks, snacks, and dishes, along with a relaxed atmosphere and events such as Formula 1 race days.	Cafes → Brown Cafés ⁵⁹⁹ Combat → Badminton ⁷⁰²	formula 1 ¹⁴⁰ café ⁹⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ atmosphere ⁵⁵⁹¹	Flevoland → Zeewolde ¹²⁴³
cafeorquidea-rotterdam.nl	Café Orquídea	The aim of Café Orquídea's website is to allow online ordering of dishes from the restaurant in Rotterdam.	Fish & Seafood → Fish ³⁸⁸ Restaurants & Dining → Seafood Restaurants ⁶¹²	meat dishes ⁶⁶ seafood ¹⁴⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafesnackbarlucky-almere.nl	Café Lucky Snacks	Café Lucky Snacks is an online platform where customers in Almere can order and receive delivery of dishes from the menu.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	croquette ¹³⁶ spring rolls ¹⁴¹ rib ¹⁹¹ satay ³²⁰ burger ¹⁴³¹ snack ²⁹¹⁶	Flevoland → Almere ⁷⁷⁶⁵
cafetaria-akkerhof.nl	Cafetaria Akkerhof Spijkenisse	The website of Cafetaria Akkerhof Spijkenisse offers an online platform to order burgers, snacks, and other dishes for delivery or pickup. It also includes a menu, reviews, and promotions.	Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Nissewaard → Spijkenisse ¹⁴³³
cafetaria-charly-ugchelen.nl	Cafetaria Charly Ugchelen	The website of Cafetaria Charly in Ugchelen offers an online ordering system for dishes, including fries, snacks, sandwiches, and drinks. It’s intended to allow customers to order and quickly enjoy meals.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Apeldoorn → Ugchelen ¹⁹⁷
cafetaria-cosy-corner-helmond.nl	Cafetaria Cosy Corner	Cafetaria Cosy Corner is an online ordering platform for meals and snacks in Helmond.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	satay ³²⁰ burger ¹⁴³¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Brabant → Helmond ³⁰⁵⁸
cafetaria-cox-corner.nl	Cafetaria Cox Corner	Cafetaria Cox Corner is an online ordering platform for food in Weert, where customers can view the menu and order dishes directly online.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Limburg → Weert ²⁰³⁰
cafetaria-de-driehoek.nl	Cafetaria De Driehoek	Cafetaria De Driehoek is an online ordering platform for meals and snacks in Utrecht. Visitors can view the menu and place their order online.	Cafes → Dutch Restaurants ¹⁰³¹ Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetaria-de-overweg-leeuwarden.nl	Lekker Leeuwarden	The Lekker Leeuwarden website is an online ordering system for food and snacks in Leeuwarden. It provides a comprehensive menu with various types of fries, hamburgers, snacks and drinks, and allows for easy online ordering.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	combo ⁵⁹ hamburger ³⁶⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
cafetaria-de-zilveren-zwaan-zeist.nl	Cafetaria De Zilveren Zwaan	The website of Cafetaria De Zilveren Zwaan offers online ordering options for a variety of dishes and snacks, including fries, snacks, sandwiches, and drinks, in Zeist.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fry ⁵⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht → Zeist ²⁶⁴⁴
cafetaria-double-ff-groningen-groningen.nl	Cafetaria Double FF Groningen	The website of Cafetaria Double FF Groningen offers online ordering options for a wide variety of food, including hamburgers, fries, snacks, and drinks.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	bucket ¹¹³ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
cafetaria-eetplezier-veldhoven.nl	Cafetaria Eetplezier Veldhoven	Cafetaria Eetplezier Veldhoven is an online ordering platform for a variety of snacks and meals in Veldhoven. The website offers a menu, reviews, and the ability to order online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Veldhoven ¹⁴⁸⁵
cafetaria-enschedezuid.nl	Cafetaria Lunchroom Zuid	The website of Cafetaria Lunchroom Zuid in Enschede provides an online platform for ordering fries, snacks, and other dishes, with the option for home delivery and point accumulation via a loyalty card.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
cafetaria-geffen.nl	Cafetaria Geffen	Cafetaria Geffen is an online ordering platform for food from Cafetaria Geffen in Geffen. It offers a menu with various pizzas, sandwiches, salads, and snacks, where customers can easily place online orders.	Fast Food → Fries ⁹⁴⁹	toppings ¹⁵³ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Oss → Geffen ²⁰⁰
cafetaria-hao-wei-utrecht.nl	Cafetaria Hao Wei	Cafetaria Hao Wei is an online ordering platform that allows customers in Utrecht to order food and snacks.	Restaurants & Dining → Fries Kiosks ³³	croquettes ¹⁰⁸ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetaria-lili-utrecht.nl	Cafetaria Lili	The website Cafetaria Lili offers an online ordering system for food and snacks from the cafetaria in Utrecht, with an extensive menu and the possibility of online ordering.	Quick Bites → Cafeteria ⁹⁰⁶	hamburger ³⁶⁴ plate ⁷⁸⁷ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetaria-lunchroom-happy-house.nl	Cafetaria-Lunchroom Happy House	Cafetaria-Lunchroom Happy House is an online platform in Zwijndrecht where visitors can view the menu and order food online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Zwijndrecht ¹⁴⁵⁵
cafetaria-lunchroom-hordijk-rotterdam.nl	Cafetaria Lunchroom Hordijk	The website of Cafetaria Lunchroom Hordijk offers the possibility to order food online from the cafeteria in Rotterdam.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family pack ²⁴ menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-lunchroom-naplace-raalte.nl	Cafetaria Lunchroom Naplace	The website of Cafetaria Lunchroom Naplace in Raalte offers online ordering options for a wide range of dishes, including fries, snacks, salads, and various meat and chicken options.	Fast Food → Fries ⁹⁴⁹ Events → Places ¹²¹⁹	chicken ⁹⁴⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Raalte ¹⁷⁷¹
cafetaria-mistersnack.nl	Mister Snack	The Mister Snack website is a cafeteria located in Kaatsheuvel, Netherlands, offering a variety of snacks, fries, sandwiches, and ice cream.	Quick Bites → Cafeteria ⁹⁰⁶ Events → Local Attractions ¹³	ice cream ¹⁰⁰⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Loon op Zand → Kaatsheuvel ⁶⁸⁸
cafetaria-ons-danny.nl	Cafetaria Ons Danny	Cafetaria Ons Danny is an online ordering platform for food from Eindhoven, where visitors can view the menu and order dishes directly online.	Fast Food → Fries ⁹⁴⁹	family pack ²⁴ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cafetaria-oreo-utrecht.nl	Cafetaria Oreo	The website Cafetaria Oreo provides an online ordering system for dishes at the cafetaria located in Utrecht. Users can view the menu and place their orders here.	Fast Food → Fries ⁹⁴⁹ Cafes → Dutch Restaurants ¹⁰³¹	pita bread ⁵⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetaria-petit-restaurant-family-heemstede.nl	Cafetaria Petit Restaurant Family Heemstede	Cafetaria Petit Restaurant Family Heemstede is a restaurant located in Heemstede that accepts online orders for a wide range of snacks, fries, meals, and drinks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Heemstede ¹¹⁷³
cafetaria-pleintje.nl	Cafetaria ‘t Pleintje Rijssen	The website of Cafetaria ‘t Pleintje in Rijssen offers visitors the opportunity to order and view fries, snacks and other dishes online. It also provides information about the cafeteria and the option to subscribe to the newsletter.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Rijssen-Holten → Rijssen ¹⁰⁴⁸
cafetaria-sabina-fokkesteeg-nieuwegein.nl	Cafetaria Sabina Fokkesteeg	The website of Cafetaria Sabina Fokkesteeg in Nieuwegein allows users to order food online and view the menu.	Fast Food → Fries ⁹⁴⁹	loaded fries ⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Nieuwegein ²²⁶⁴
cafetaria-stratum-eindhoven-eindhoven.nl	Cafetaria Stratum Eindhoven	Cafetaria Stratum Eindhoven is an online ordering platform for food in Eindhoven, specifically focused on fries, snacks, and various meals.	Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
cafetaria-sytwinde.nl	Foodmaster Sytwinde Leidschendam	The website Foodmaster Sytwinde Leidschendam allows customers to order meals online from the restaurant's menu in Leidschendam. It offers a variety of items including fries, pizzas, snacks, sandwiches, salads and various beverages and party services.	Fast Food → Fries ⁹⁴⁹ International → Turkish ⁴¹⁶	party service ²⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
cafetaria-t-smikkelhuukske.nl	Cafetaria 't Smikkelhuukske	The website of Cafetaria 't Smikkelhuukske in Aarle-Rixtel offers the possibility to view the menu online and order dishes for delivery or pickup.	Essential → Food ⁴⁷⁹⁹⁹	portion ³³ soup ¹⁰⁴³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Laarbeek → Aarle-Rixtel ²³⁸
cafetaria123.nl	Cafetaria 123 Nijmegen	The website of Cafetaria 123 Nijmegen offers an online ordering system for home delivery, pick-up, and ordering of various meals and drinks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	plate ⁷⁸⁷ pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Nijmegen ⁹³⁸⁴
cafetariabijnathuiswijlre.nl	Cafetaria Bijna Thuis	Cafetaria Bijna Thuis is an online ordering platform for food from the cafeteria in Wijlre.	Fast Food → Fries Restaurants ⁸⁷ Coffee & Tea → Beverages ⁴⁴⁵³	loaded fries ⁴¹ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Gulpen-Wittem → Wijlre ⁶⁶
cafetariabol-broekoplangedijk.nl	Cafetaria BOL	The website Cafetaria BOL provides an online ordering system for meals and snacks from Cafetaria BOL in Broek op Langedijk. Visitors can view the menu and place orders for delivery or pickup.	Fast Food → Fries ⁹⁴⁹	gyro ⁹⁵ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Dijk en Waard → Broek op Langedijk ²⁴³
cafetariachineesafhaalhettrefpunt-eefde.nl	Cafetaria & Chinees Fusion Het Trefpunt	The website, Cafetaria & Chinees Fusion Het Trefpunt, offers an online ordering option for a variety of dishes, including Chinese and cafe-style dishes, and snacks.	Asian → Chinese ⁴¹⁵ Quick Bites → Cafeteria ⁹⁰⁶	family package ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Lochem → Eefde ¹⁷⁴
cafetariacicek5beuningen.nl	Cicek Beuningen	The Cicek Beuningen website is an online platform where customers in Beuningen can order food from the Cicek Beuningen restaurant and have it delivered to their homes.	Fast Food → Fries Restaurants ⁸⁷ Food Delivery → Delivery ²²²⁷	döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Beuningen ⁸⁸³
cafetariacoret.nl	Cafetaria Coret	The Cafetaria Coret website offers an online ordering system for delivery, takeaway, and delivery services in Zoetermeer, with a digital menu and information on opening hours and payment options.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
cafetariadaantje.nl	Cafetaria Daantje	Cafetaria Daantje is a cafe in Apeldoorn offering snacks and fries.	Quick Bites → Cafeteria ⁹⁰⁶ Commerce → Shopping Centers ¹⁰⁰¹	satay ³²⁰ chicken ⁹⁴⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Gelderland → Apeldoorn ⁶⁹⁹⁶
cafetariadeachterstraat.nl	Cafetaria De Achterstraat Woerden	The website of Cafetaria De Achterstraat Woerden is an online platform where visitors can order snacks for delivery or pickup in Woerden.	Quick Bites → Cafeteria ⁹⁰⁶	toyota aygo ¹²² prize wheel ⁴⁰² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Woerden ²⁶⁴²
cafetariadeboemerangdenbosch.nl	Cafetaria de Boemerang	The website of Cafetaria de Boemerang provides online ordering options for dishes and drinks from the cafeteria in Den Bosch. Users can view a menu and place their order online.	Quick Bites → Cafeteria ⁹⁰⁶ Turkish Cuisine → Fast Food ³²²²	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
cafetariadebrabantsehap-waalwijk.nl	Cafetaria de Brabantse Hap	Cafetaria de Brabantse Hap is an online restaurant in Waalwijk where customers can order food from the menu and place orders online.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Food Businesses ⁵⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Waalwijk ¹⁷⁴⁴
cafetariadeengel.nl	Cafetaria de Engel	The website of Cafetaria de Engel in Hengelo allows visitors to order food online and view the menu.	Websites → Local Businesses ⁸⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	kidsbox ³⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
cafetariadehoef-alkmaar.nl	Cafetaria de Hoef	Cafetaria de Hoef is an online ordering platform for food in Alkmaar.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
cafetariademeridiaan-amersfoort.nl	Cafetaria de Meridiaan	The website of Cafetaria de Meridiaan in Amersfoort offers the possibility to order online. Visitors can view the menu and order their favorite dishes directly online for delivery.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	family package ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Utrecht → Amersfoort ⁸⁰¹¹
cafetariadeploegliempde.nl	Cafetaria De Ploeg	Cafetaria De Ploeg is a cafe in Liempde that accepts online orders for a variety of dishes, including fries, sandwiches, and snacks.	Fast Food → Fries Chain ⁴⁶ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Boxtel → Liempde ²³²
cafetariadepoort-harderwijk.nl	Cafetaria "De Poort"	Cafetaria "De Poort" in Harderwijk provides an online menu with various hamburgers, vegetarian options, plates and snacks, as well as an overview of reviews and contact information.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Seafood Restaurants ⁶¹²	vegetarian ³³⁷ hamburger ³⁶⁴ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Harderwijk ²²⁴⁰
cafetariaderomperts-hertogenbosch.nl	Cafetaria De Rompert	Cafetaria De Rompert is an online ordering platform for food and drinks in 's-Hertogenbosch, allowing customers to quickly order their favorite dishes online.	Fast Food → Fries Chain ⁴⁶	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
cafetariadespoorbrug.nl	Cafetaria De Spoorbrug	The website provides an online ordering system for fries, snacks, and sandwiches at Cafetaria De Spoorbrug in Sliedrecht.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Sliedrecht ⁸⁶³
cafetariadestip.nl	Cafetaria De Stip	Cafetaria De Stip offers an online ordering system for takeaway orders. The website provides information about opening hours and menu offerings.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	North-Brabant → Helmond ³⁰⁵⁸
cafetariadestoofpot-udenhout.nl	Cafetaria De Stoofpot	Cafetaria De Stoofpot is a cafeteria in Udenhout that accepts online orders for a wide variety of dishes, including fries, snacks, sandwiches, and various meat plates.	Quick Bites → Cafeteria ⁹⁰⁶ Websites → Ordering Sites ⁷⁵	menus ²²¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Tilburg → Udenhout ³⁸³
cafetariadeviersprong.nl	Cafetaria de Viersprong	The website of Cafetaria de Viersprong in Vlaardingen offers an online ordering system for their food, including delivery and discount offers, and provides information about the menu and reviews.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
cafetariadevondel-oosterhout.nl	Cafetaria De Vondel	The website Cafetaria De Vondel offers the possibility to order meals online from their menu in Oosterhout. It is an online platform for ordering various snacks and dishes.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	croquette ¹³⁶ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Oosterhout ²⁰⁸⁶
cafetariadevriendschap.nl	Cafetaria de Vriendschap	Cafetaria de Vriendschap Tilburg’s official website offers online ordering of fries, snacks, and other dishes with fast delivery.	Fast Food → Fries Chain ⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
cafetariadezilverenzwaan.nl	Cafetaria De Zilveren Zwaan	Cafetaria De Zilveren Zwaan is a cafeteria located in Zeist that accepts online orders and takeout orders. The website provides an online menu and the possibility of online payment.	Quick Bites → Cafeteria ⁹⁰⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Utrecht → Zeist ²⁶⁴⁴
cafetariaeglantierapeldoorn.nl	Cafetaria Eglantier	Cafetaria Eglantier is an online ordering platform for food from Apeldoorn, where customers can view a menu and order their favorite dishes, including various types of fries, snacks, sandwiches and burgers, online.	Quick Bites → Cafeteria ⁹⁰⁶	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
cafetariagendt.nl	Cafetaria Gendt	The official website of Cafetaria Gendt offers online ordering, delivery, and takeaway options for a wide range of dishes, including sandwiches, snacks, pizza, salads, and beverages.	Quick Bites → Cafeteria ⁹⁰⁶ Economy → Employment & Labor ⁶⁰⁵⁹	menus ²²¹ beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Lingewaard → Gendt ¹⁹⁰
cafetariagoofyscorner-ede.nl	Cafetaria Goofy’s Corner	Cafetaria "Goofy’s Corner" in Ede is a food establishment that offers a variety of snacks, sandwiches and fries.	Fast Food → Fries ⁹⁴⁹ Coffee & Tea → Beverages ⁴⁴⁵³	family pack ²⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Ede ⁵¹⁰⁴
cafetariahatert-nijmegen.nl	Cafetaria Hatert	Cafetaria Hatert is an online ordering platform for meals and snacks in Nijmegen.	Quick Bites → Snack Bar ⁵⁸⁰	chicken ⁹⁴⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Gelderland → Nijmegen ⁹³⁸⁴
cafetariaheistraat-helmond.nl	Cafetaria Heistraat	The website of Cafetaria Heistraat in Helmond allows users to order meals online, including a menu with various dishes and snacks.	Fast Food → Fries ⁹⁴⁹	soup ¹⁰⁴³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
cafetariahettweespan.nl	Cafetaria Het Tweespan	The website of Cafetaria Het Tweespan provides information and a description of the cafeteria, including its menu and atmosphere, aimed at attracting customers.	Quick Bites → Cafeteria ⁹⁰⁶	ambience ¹¹ customer satisfaction ⁵²⁸ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ atmosphere ⁵⁵⁹¹	North-Brabant → Deurne ¹³²⁹
cafetariajanmast.nl	Cafetaria JanAast	The website Cafetaria JanAast features a blog with articles and discussions, including a study into the relationship between cafes and plumbing companies.	Administrative Support → Business Operations ¹¹⁵⁶ Civil & Infrastructure → Infrastructure ¹⁰³³	plumbing company ²⁰ drainage ¹³²² cafe ¹⁶²² snack ²⁹¹⁶ roof ³⁶⁶² article ⁶⁰⁰⁰
cafetariakapteyn.nl	Cafetaria de Kapteyn	Cafetaria de Kapteyn is an online platform and physical location in Groningen that offers delivery, takeaway, and online ordering of food.	Fast Food → Fries ⁹⁴⁹ Economy → Employment & Labor ⁶⁰⁵⁹	hamburger ³⁶⁴ takeaway ⁶⁵³ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
cafetariakennedyplein.nl	Cafetaria Kennedyplein Ulft	The website is an online ordering platform for a cafeteria called Cafetaria Kennedyplein Ulft, which offers various snacks, fries, sandwiches, and drinks.	Quick Bites → Cafeteria ⁹⁰⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Oude IJsselstreek → Ulft ³⁹²
cafetariakennys.nl	Cafetaria Kenny's	Cafetaria Kenny's is a cafe in Munstergeleen that sells fresh fries, snacks, and milkshakes, offering takeaway and delivery services.	Quick Bites → Cafeteria ⁹⁰⁶ Catering & Ready Meals → Takeaway ⁴⁰⁹	milkshake ¹⁹⁵ cafe ¹⁶²² fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ order ⁶⁹¹²	Sittard-Geleen → Munstergeleen ⁶⁶
cafetariakennys-geleen.nl	Cafetaria Kenny's	Cafetaria Kenny's is an online ordering platform for food in Munstergeleen, where visitors can view the menu and order items online.	Websites → Local Businesses ⁸⁵ Quick Bites → Cafeteria ⁹⁰⁶	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Sittard-Geleen → Munstergeleen ⁶⁶
cafetariakomeet.nl	Cafetaria Komeet Eelde	The website of Cafetaria Komeet Eelde offers the possibility to order fries, snacks, and other dishes online, and sign up for a newsletter for exclusive discounts.	Quick Bites → Cafeteria ⁹⁰⁶ Internet → Food Retailers ¹⁰	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Tynaarlo → Eelde ³⁸³
cafetarialeusden.nl	Cafetaria Leusden Doner Kebab	The website of Cafetaria Leusden Doner Kebab offers the possibility to order dishes online from the menu, with a focus on Doner Kebab's, Turkish pizzas, sandwiches, and various snacks.	Fast Food → Döner ²³⁸	doner kebab ²³ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Utrecht → Leusden ¹³⁴⁵
cafetarialing-alphenaandenrijn.nl	Cafetaria Ling	Cafetaria Ling is an online ordering platform for food and drinks in Alphen aan Den Rijn, specializing in Korean dishes and bubble tea.	Quick Bites → Cafeteria ⁹⁰⁶	korean fried chicken ¹⁸ grilled dishes ⁴⁹ bubble tea ¹⁵³ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
cafetarialunchroomthuus-vriezenveen.nl	Cafetaria lunchroom T'huus Vriezenveen	Cafetaria lunchroom T'huus Vriezenveen is a lunchroom in Vriezenveen that accepts online orders for a wide variety of dishes.	Fast Food → Fries ⁹⁴⁹ Cafes & Lunch → Lunch Spots ²³⁷	shawarma ³³⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Twenterand → Vriezenveen ⁴⁸⁷
cafetarialuxor-schijndel.nl	Cafetaria Luxor	Cafetaria Luxor is an online ordering platform for food in Schijndel, allowing visitors to easily order dishes online.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Meierijstad → Schijndel ⁹⁰⁸
cafetariamarco-enschede.nl	Cafetaria-Grillroom Marco	The website Cafetaria-Grillroom Marco offers online ordering for various dishes and snacks in Enschede.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
cafetariamarktzicht-uden.nl	Cafetaria Marktzicht Uden	The website Cafetaria Marktzicht Uden offers online ordering options for a wide variety of snacks, fries, and sandwiches.	Quick Bites → Cafeteria ⁹⁰⁶	loaded fries ⁴¹ soup ¹⁰⁴³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Maashorst → Uden ¹⁵⁴⁰
cafetariamoreno.nl	Moreno	The website of Moreno in Dordrecht offers the possibility to order meals and snacks online, with an extensive menu featuring fries, snacks, sandwiches, burgers, drinks and ice cream.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Dordrecht ⁴⁵³¹
cafetarianeerbosch.nl	Cafetaria Eethuis Neerbosch	The website of Cafetaria Eethuis Neerbosch in Nijmegen offers the possibility to order online, have food delivered, or pick it up.	Online Ordering → Delivery Restaurants ⁷² Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
cafetarianieuwerhoek-soest.nl	Cafetaria Nieuwerhoek	Cafetaria Nieuwerhoek is a cafeteria in Soest that accepts online orders for a wide range of snacks, sandwiches, and dishes.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht → Soest ²⁰²⁷
cafetarianylan.nl	Cafetaria Nylan Leeuwarden	The website of Cafetaria Nylan Leeuwarden offers the possibility to order french fries and snacks online, with the option for delivery and discount promotions.	Fast Food → Fries Chain ⁴⁶	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
cafetariaoffenbach.nl	Cafetaria Offenbach Tilburg	Cafetaria Offenbach Tilburg is an online platform where visitors can order fries, snacks and other dishes. The website offers a digital menu, customer reviews, and an app for quick ordering.	Quick Bites → Cafeteria ⁹⁰⁶ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
cafetariapassantje-wageningen.nl	Cafetaria Passantje Wageningen	The website of Cafetaria Passantje Wageningen offers online ordering options for a wide range of snacks, fries, and drinks, with a focus on the Wageningen region.	Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Wageningen ¹⁹⁴⁹
cafetariaplatia-druten.nl	Cafetaria Platia	The website of Cafetaria Platia in Druten offers online ordering of dishes, with a detailed menu of fries, snacks, sandwiches, and plates, and drinks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Druten ⁵⁹⁰
cafetariariantrejos-breda.nl	Cafetaria Riantrejos	The website of Cafetaria Riantrejos, located in Breda, offers the opportunity to order food online. It features a detailed menu, including various fries, snacks, burgers, salads, and drinks.	Quick Bites → Cafeteria ⁹⁰⁶ Turkish Cuisine → Fast Food ³²²²	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Breda ⁹⁰⁰³
cafetariasofia-utrecht.nl	Cafetaria Sofia	Cafetaria Sofia is an online ordering platform for food in Utrecht, offering a diverse menu including tacos, plates, Turkish pizza, burgers, and snacks.	Fast Food → Burgers ⁶⁸⁷ Cafes → Dutch Restaurants ¹⁰³¹	taco ⁹² kapsalon ⁵⁰⁹ plate ⁷⁸⁷ burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariatavor-breda.nl	Cafetaria Tavor	Cafetaria Tavor is an online ordering platform for dishes and snacks in Breda.	Quick Bites → Cafeteria ⁹⁰⁶ Activities → Dining Out ¹⁸¹	combo meal ⁶⁵ croquettes ¹⁰⁸ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Brabant → Breda ⁹⁰⁰³
cafetariatenbeste.nl	Cafetaria Ten Beste	The website of Cafetaria Ten Beste Utrecht offers online ordering for fries, snacks, döner, and Turkish pizza, with options for delivery or pickup. It’s a well-known snack spot in Utrecht with a long history and a focus on a cozy atmosphere and promotions.	Quick Bites → Snack Bar ⁵⁸⁰	kapsalon ⁵⁰⁹ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
cafetariatermaat.nl	Ter Maat Almelo	Ter Maat Almelo is a restaurant in Almelo that delivers and picks up snacks and meals.	Japanese → Sushi ⁹⁷¹ Websites → Ordering Sites ⁷⁵	prize wheel ⁴⁰² sushi ¹⁶⁹⁵ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Almelo ²⁶⁹⁶
cafetariatermaat-almelo.nl	Cafetaria ter Maat	The website of Cafetaria ter Maat from Almelo offers the possibility to order meals online, including various menus, snacks, sandwiches, and drinks.	Quick Bites → Cafeteria ⁹⁰⁶	wok ²³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Almelo ²⁶⁹⁶
cafetariatrefpunt-venhorst.nl	Cafetaria Trefpunt	Cafetaria Trefpunt is a cafeteria in Venhorst where customers can order meals online, including sandwiches, snacks, dishes, pizzas and salads.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Boekel → Venhorst ⁷⁷
cafetariatspaontje-wehl.nl	Mini Resto 't Spaontje	The website Mini Resto 't Spaontje offers an online ordering system for meals and snacks in Wehl, allowing visitors to easily order dishes from the menu and have them delivered or picked up.	Cafeteria → Dutch Cafeteria ¹²²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Doetinchem → Plantage ²⁰⁰
cafetariavanderlaan.nl	Cafetaria van der Laan	The website of Cafetaria van der Laan in Dwingeloo allows visitors to order burgers and snacks online and view the menu and reviews.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Westerveld → Dwingeloo ³⁹²
cafetariavideosnack.nl	Cafetaria Videosnack	The website 'Cafetaria Videosnack' allows customers to order food, including fries, snacks, and Chinese dishes, in Oldenzaal, with options for takeout or delivery.	Quick Bites → Cafeteria ⁹⁰⁶ Meal Solutions → Food Businesses ⁵⁷	chinese ⁶⁸ movie ¹⁹¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	Overijssel → Oldenzaal ¹²¹⁹
cafetariavogelenzang.nl	Cafetaria Vogelenzang	The website of Cafetaria Vogelenzang in Halsteren provides information about its menu, opening hours, job vacancies, and contact details. It's a place to order or apply for a job.	Fast Food → Fries ⁹⁴⁹ Outdoor & Recreation → Family Fun ³⁰	foodtruck ⁶¹³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Bergen op Zoom → Halsteren ²⁹⁸
cafetariawestwijk.nl	Cafetaria Westwijk	The website of Cafetaria Westwijk in Vlaardingen provides an online platform to order fries, snacks and other dishes. It also features a menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
cafetariawijnbergen.nl	Cafetaria Wijnbergen	Cafetaria Wijnbergen is a cafeteria located in Doetinchem offering a wide range of food and services, including fries, snacks, Chinese dishes, sandwiches, ice cream, event hall rental, and catering services.	Quick Bites → Cafeteria ⁹⁰⁶ Lifestyle → Events ³²⁴⁷⁵	chinese dish ¹⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Doetinchem ²⁷⁰⁶
cafetariawilliam.nl	Cafetaria William Ridderkerk	Cafetaria William Ridderkerk is an online cafetaria where customers can easily order and pay for fries, snacks, and other dishes online.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Ridderkerk ¹³³⁵
cafetariawinssen.nl	Cafetaria Winssen	Cafetaria Winssen is a café and cafeteria offering a variety of snacks, fries, ice cream, and takeaway meals, with the option to have lunch, brunch, or dinner.	Quick Bites → Cafeteria ⁹⁰⁶	ice cream ¹⁰⁰⁰ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶
capelsebrug.nl	Snackbar Capelsebrug	The website of Snackbar Capelsebrug in Rotterdam offers online ordering with delivery and pickup services, as well as a prize wheel and a loyalty program where points can be earned.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Quick Bites → Snack Bar ⁵⁸⁰	prize wheel ⁴⁰² points ⁶¹² snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Rotterdam → Prins Alexander ⁴³²
cateringmijdrecht-vinkeveen-wilnis-ankeveen.nl	Catering Mijdrecht Vinkeveen Wilnis Ankeveen	The website of Catering Mijdrecht Vinkeveen Wilnis Ankeveen provides information about catering services, including party snacks at home, themed catering, and meal delivery services for seniors in the municipalities of Mijdrecht and De Ronde Venen.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹ Social Services → Seniors ⁸²²	seniors ⁹⁰⁴ meal ¹⁶³⁸ snack ²⁹¹⁶ theme ⁴⁰¹⁵ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	De Ronde Venen → Vinkeveen ⁴⁷²
cateringvanalleswat.nl	Catering Van Alles Wat	Catering Van Alles Wat is a catering company serving events and businesses in and around Opende.	Quick Bites → Snack Bar ⁵⁸⁰	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Westerkwartier → Opende ⁸⁶
charlymusketiersveld.nl	Cafetaria Charly Apeldoorn	The website of Cafetaria Charly Apeldoorn offers an online platform to order fries and other snacks and to increase ordering convenience through an app and a simple ordering procedure.	Fast Food → Fries Restaurants ⁸⁷	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
cheff-hicham-almere.nl	Cheff Hicham	The website Cheff Hicham is an online platform where users can order dishes from Cheff Hicham from Almere. The site offers a menu with sandwiches, burgers, snacks, dishes and drinks.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Flevoland → Almere ⁷⁷⁶⁵
chicken-and-more.nl	Chicken And More	The website of Chicken And More from Aalsmeer offers the possibility to order meals online, including sandwiches, burgers, special menus, and various snacks and drinks.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Aalsmeer ¹⁷¹⁰
chinnyrotterdam.nl	Chinny	The website Chinny offers the possibility to order food online from Rotterdam, with a particular focus on Surinamese dishes and snacks.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	rice ⁶³⁵ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
choosetogo-mijdrecht.nl	Choose To Go Mijdrecht	The Choose To Go Mijdrecht website is an online platform where customers can order and have food delivered from restaurants in Mijdrecht.	Fast Food → Fries ⁹⁴⁹ Ready-To-Eat Meals → Wraps ¹⁰²	turkish pizza ⁶³ panini ¹⁵⁶ wrap ⁸²⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	De Ronde Venen → Mijdrecht ⁷⁰⁰
chrislunchsnacksutrecht.nl	Chris Lunch & Snacks	The website Chris Lunch & Snacks offers online ordering of food and snacks from Utrecht, featuring a comprehensive menu.	Cafes → Dutch Restaurants ¹⁰³¹	pita ¹⁹⁹ hamburger ³⁶⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
cihan-bakkerij-spijkenisse.nl	Cihan Bakkerij Doner	The website of Cihan Bakkerij Doner in Spijkenisse offers the possibility to order meals online, including döner, kapsalons, pizzas, and sandwiches, and have them delivered.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Nissewaard → Spijkenisse ¹⁴³³
cleyne-reick.nl	Cafetaria Cleyne Reick	The website of Cafetaria Cleyne Reick in Utrecht offers the possibility to order food online and view the menu.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
cookingjeff.nl	Cooking Jeff	The Cooking Jeff website is a blog that provides recipes, with a focus on flavorful and experience-oriented dishes, and offers insight into the maker’s eating habits.	Nutrition → Diets ⁹⁵¹ Social → Personal Blog ²⁷¹⁸	eating habits ⁵⁴ snack ²⁹¹⁶ recipe ⁵¹⁴² blog ¹³³⁹² collaboration ¹⁶⁰³⁶
cornel-express-diemen.nl	Cornel Express Spareribs & Burgers	The website of Cornel Express Spareribs & Burgers in Diemen offers the possibility to order meals online, including spareribs, hamburgers, snacks and side dishes.	Turkish Cuisine → Fast Food ³²²²	spareribs ²¹³ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Diemen ⁹⁷⁵
cornereethuis-castricum.nl	Corner Eethuis	The Corner Eethuis website allows users to order meals online from the restaurant in Castricum. The website features a menu including sandwiches, wraps, Turkish pizzas, salads, snacks, and beverages.	Cafes → Eateries ⁸²	beverage ⁵⁸⁶ döner ⁶⁷³ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Castricum ¹³⁸⁷
daily-diner.nl	Daily Diner	Daily Diner is an online platform that allows customers in Doetinchem to order and receive food from the restaurant.	Context ¹⁶¹³⁹⁴	snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Doetinchem ²⁷⁰⁶
danas-dierenshop.nl	Dana's Dierenshop	Dana's Dierenshop is an online pet store specializing in pet foods, snacks, grooming products, and supplies for dogs and cats.	Pet Stores → Online Pet Stores ¹⁶ Wellness → Animal Wellness ⁴³	grooming ⁸⁹⁶ cat ¹⁵⁷⁸ wellbeing ²⁶²⁰ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
danysfoodcorner-amsterdam.nl	Dany's Food Corner Amsterdam	The website Dany's Food Corner Amsterdam allows you to order meals online in Amsterdam.	Fast Food → Fries ⁹⁴⁹	shawarma ³³⁵ hamburger ³⁶⁴ döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
daylish.nl	Daylish	Daylish is a snack bar in Ede that sells a variety of snacks and accepts online orders.	Quick Bites → Snack Bar ⁵⁸⁰ Catering & Ready Meals → Takeaway ⁴⁰⁹	snack ²⁹¹⁶ order ⁶⁹¹² price ⁸³²⁸ news ¹⁵²⁹³	Gelderland → Ede ⁵¹⁰⁴
dbettenleur.nl	Dierenbenodigdheden Etten-Leur	Dierenbenodigdheden Etten-Leur is an online shop that offers a variety of food and supplies for dogs and cats.	E-Commerce → Pet Supplies ¹⁰¹³ Gifts & Flowers → Gift Retail ⁷¹	cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³	North-Brabant → Etten-Leur ¹³⁶⁶
de-baan-huizen.nl	Snackbar De Baan	Snackbar De Baan is an online ordering platform for snacks and meals in Huizen, where visitors can order dishes and combo menus.	Quick Bites → Snack Bar ⁵⁸⁰	combo ⁵⁹ milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Huizen ¹⁴¹⁶
de-frietzaak-den-bosch.nl	De Frietzaak Den Bosch	De Frietzaak Den Bosch is an online ordering platform for fries and snacks in 's-Hertogenbosch.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	loaded fries ⁴¹ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
de-smaak-van-schoonhoven.nl	De Smaak van Schoonhoven	The website ‘De Smaak van Schoonhoven’ is an online platform allowing customers to order meals from the restaurant in Schoonhoven.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
de-snackbar.nl	De Snackbar Overdinkel	The De Snackbar Overdinkel website provides an online ordering system for fries, snacks, and other dishes, with the option for home delivery.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶	Losser → Overdinkel ⁹¹
de-veur.nl	Sport Cafe de Veur	Sport Cafe de Veur is a café and event space in Zoetermeer, offering food, drinks, and space for various events.	Cafes → Brown Cafés ⁵⁹⁹	cafe ¹⁶²² hall ¹⁷⁸⁶ snack ²⁹¹⁶ sport ⁴²²⁸ drink ⁵¹⁹¹ event ⁴⁵¹⁹⁹
de-vriendschap-boxmeer.nl	De Vriendschap	De Vriendschap is an online ordering platform for food from Boxmeer, focusing on fries, snacks, and burgers.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	chicken ⁹⁴⁴ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Land van Cuijk → Boxmeer ⁸⁶¹
debeneluxius.nl	De Beneluxius	De Beneluxius is an activities club that organizes activities for people with disabilities in Amstelveen and surrounding areas.	Skating → Inline Skating ⁵⁸	bike tour ⁹⁷ snack ²⁹¹⁶ party ⁵⁹²⁸	North-Holland → Amstelveen ³¹⁸⁰
debeukelsdijkdonerkebab-rotterdam.nl	De Beukelsdijk Doner Kebab	The website provides an online ordering system for dishes from De Beukelsdijk Doner Kebab in Rotterdam.	Fast Food → Döner ²³⁸ Fast Food → Fries ⁹⁴⁹	doner ¹³¹ milkshake ¹⁹⁵ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
deboodschappenbezorger-hoogeveen.nl	De Boodschappen Bezorger	The website De Boodschappen Bezorger offers online ordering of food from Hoogeveen, with a particular focus on beverages and complementary products.	Beverages → Beer ¹⁰⁹⁵ Fitness → Fitness Equipment ³⁶⁸	resistance ²³⁰ bottle ³⁰⁰ occasion ²⁰³⁶ beer ²⁸⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹	Drenthe → Hoogeveen ²²⁹⁴
deeetpuzzelalkmaar.nl	The Eetpuzzel	The Eetpuzzel is an online ordering platform for meals and snacks in Alkmaar.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	menus ²²¹ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
defrietketel.nl	De Frietketel	This website is an online ordering platform for fries and snacks located in Waspik.	Fast Food → Fries ⁹⁴⁹ Cafeteria → Dutch Cafeteria ¹²²	pickup ⁷³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Waalwijk → Waspik ¹⁴²
defrietschuuralmere.nl	De Frietschuur Almere	The Frietschuur Almere's official website offers online ordering of fries, snacks, burgers and other products, with extra chances to win prizes after each purchase.	Fast Food → Fries ⁹⁴⁹ Grilling & Steaks → Grillroom ⁸⁷	prize wheel ⁴⁰² ice cream ¹⁰⁰⁰ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Almere → Almere Hout ⁷¹
degrootedelgebakparticulier.nl	De Groot Edelgebak Particulier	De Groot Edelgebak is an online store selling a variety of bakery products, targeting both businesses and individuals.	Bakery & Food Production → Bread ⁷⁶⁵	bonbons ³²⁹ pastries ⁹⁴⁶ bread ¹⁶²² snack ²⁹¹⁶	Gelderland → Ede ⁵¹⁰⁴
dekaboutergeleen.nl	Cafetaria De Kabouter	Cafetaria De Kabouter is a cafe in Geleen that accepts online orders for a wide range of food and drinks, including sandwiches, fries, snacks, and salads.	Quick Bites → Cafeteria ⁹⁰⁶	soup ¹⁰⁴³ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Sittard-Geleen → Geleen ⁹⁷⁸
dekantine-oud-beijerland.nl	Dé Kantine	Dé Kantine is an online restaurant located in Oud-Beijerland where customers can order food from the menu and pick it up online. The website offers a menu with various sandwiches, fries, snacks, sweets, cakes, and drinks.	Lunch → Sandwiches ⁴⁶⁶ Cafes & Lunch → Lunch Spots ²³⁷	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
dekerriekoning-lelystad.nl	De Kerrie Koning	The website allows users to order food online from De Kerrie Koning in Lelystad.	Food Delivery → Surinamese ²⁶⁵	bara ²² bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Flevoland → Lelystad ³¹⁸⁰
deketting-emmeloord.nl	De Ketting	The website of De Ketting in Emmeloord offers the opportunity to order meals online.	Online Ordering → Food Delivery ¹³	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Noordoostpolder → Emmeloord ¹⁶⁴⁹
dekoepel-zuidbroek.nl	De Koepel	The website provides an online option to order meals from De Koepel in Zuidbroek.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	loaded fries ⁴¹ beverage ⁵⁸⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Midden-Groningen → Zuidbroek ¹⁸⁴
delekkerehap.nl	De Lekkere Hap	The website De Lekkere Hap offers an online webshop where customers can order various dishes and snacks, including burgers, spareribs, Surinamese dishes and pizzas, with delivery options.	Cuisine → Dutch Cuisine ¹⁷⁹	spareribs ²¹³ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Noordoostpolder → Emmeloord ¹⁶⁴⁹
deli-company-amsterdam.nl	Deli Company	The website Deli Company from Amsterdam offers the possibility to order meals, sandwiches, and snacks online.	Food Delivery → Surinamese ²⁶⁵	bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
delilounge-reeuwijk.nl	Deli Lounge	The Deli Lounge website, located in Reeuwijk, offers an online ordering system for various dishes, including sandwiches, salads, panini’s, snacks, and beverages.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	beverage ⁵⁸⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
delmondotilburg.nl	Del Mondo Tilburg	The Del Mondo Tilburg website is an online platform where customers can order fries and snacks for delivery or takeaway.	Fast Food → Burger Restaurants ³⁴⁶ Fast Food → Chicken Dishes ⁹²	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
deloo-coevorden.nl	Snackcounter de Loo	The website of Snackcounter de Loo in Coevorden allows customers to view the menu online and place orders for takeout.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family package ¹⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Drenthe → Coevorden ¹⁴⁹²
denachtsuper.nl	De Nachtsuper	De Nachtsuper is an online store that sells alcohol, snacks, and other products with a focus on fast delivery and easy online ordering.	Beverages → Alcoholic Beverages ²⁰²	alcohol ¹⁵⁰ snack ²⁹¹⁶ reviews ³¹⁷² menu ¹³⁸⁵⁶
deplank.nl	DÉ PLANK	The website DÉ PLANK is an online shop and platform offering various charcuterie boards, carpaccio boards and pastry boards, emphasizing regional products, quality, and handcrafted preparation.	Tea & Coffee → Tea Rooms ²²⁹ Dairy & Cheese → Delicatessens ⁶¹⁷	charcuterie board ³⁴ pastry ²⁰⁶ regional products ³⁹¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ board ³⁴³⁸
deroticorner-kuipersdijk-enschede.nl	De Roti Corner	De Roti Corner is an online platform for ordering Surinamese cuisine, primarily rotis, in Enschede.	Food Delivery → Indian Cuisine ⁵⁴³ Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ curry ³⁵⁵ potato ⁵⁴² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Enschede ⁵⁵⁵⁴
detamboeronline.nl	Eetcafé de Tamboer	The website of Eetcafé de Tamboer offers an online ordering system allowing customers to have Turkish pizzas, sandwiches, snacks and other dishes delivered to their home or picked up. It also includes a menu and information about the establishment.	Sandwiches & Salads → Snacks ⁶⁹³	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶
detempelier-haarlem.nl	Cafetaria Snackbar De Tempelier	The website of Cafetaria Snackbar De Tempelier in Haarlem offers the possibility to order food online and view the current menu.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	satay ³²⁰ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
detokomanamsterdam.nl	De Tokoman Zeedijk	The website of De Tokoman Zeedijk offers the possibility to order food online from their menu in Amsterdam.	Food Delivery → Indonesian ⁵⁰²	wok box ¹⁵ roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
detorensnackssushi-vught.nl	De Toren Snacks & Sushi	De Toren Snacks & Sushi is an online platform allowing customers in Vught to order food from their menu.	Asian → Japanese ¹⁴⁸⁸ Online Retail → Food Retail ³⁴⁰	uramaki ²⁶ side dish ¹¹⁸ maki ¹⁶⁹ poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶	North-Brabant → Vught ¹²³⁰
devlaamschepotijmuiden.nl	De Vlaamsche Pot	De Vlaamsche Pot is a fry shop in IJmuiden selling fresh fries, snacks, and ice cream.	Sandwiches & Salads → Snacks ⁶⁹³ Wellness → Location Specific ²⁶	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ staff ³⁴⁰⁵	Velsen → IJmuiden ¹¹⁰⁹
diekoffiehoekie.nl	Die Koffiehoekie	Die Koffiehoekie is an online platform that takes cake orders to generate profits for development projects in Zambia and Malawi.	International Aid → Development Aid ⁴⁰¹ Pastry → Cakes ⁸²⁶	high tea ⁵⁸⁵ cake ¹⁷³⁰ box ¹⁹⁸² snack ²⁹¹⁶
doner-city-uithoorn.nl	DöNER CITY UITHOORN	The website Döner City Uithoorn allows customers to order food online from the restaurant in Uithoorn. The menu is available online and includes a variety of sandwiches, wraps, salads, and snacks.	Turkish Cuisine → Fast Food ³²²²	wrap ⁸²⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Uithoorn ⁹⁴⁰
doner-delight-beverwijk-beverwijk.nl	Doner Delight Beverwijk	The website Doner Delight Beverwijk offers online ordering of a variety of Turkish dishes, including döner kebab, sandwiches, Turkish pizzas, dürüm, pita, and plates, to be delivered to Beverwijk.	International → Turkish ⁴¹⁶ Food Delivery → Delivery ²²²⁷	döner kebab ⁸¹ dürüm ⁹⁷ pita ¹⁹⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Beverwijk ¹⁶⁹⁰
doner-go.nl	DönerGo Middelburg	The website DönerGo Middelburg is an online platform where visitors can order döner, grilled dishes, and other treats for delivery or pickup.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Zeeland → Middelburg ²³⁴²
doner-max.nl	Doner & Snacks Max Oud Beijerland	The website of Doner & Snacks Max Oud Beijerland offers online ordering of various dishes, including pizzas, döner kebabs, and snacks, with options for delivery and promotions such as discounts and a loyalty program.	Fast Food → Burger Restaurants ³⁴⁶ International → Turkish ⁴¹⁶	döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
donerkebabdampleindordrecht.nl	Doner Kebab Damplein	The Doner Kebab Damplein website is an online ordering platform for dishes and drinks, offering a wide menu of kebab-related meals, pizzas, and snacks.	Fast Food → Döner ²³⁸ International → Middle Eastern ¹¹⁶	kebab ²⁷⁶ shawarma ³³⁵ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Dordrecht ⁴⁵³¹
donerpaleis-leerdam.nl	Donerpaleis Leerdam	The website Donerpaleis Leerdam offers an online ordering system for various dishes, including meat platters, pizzas, Turkish dishes and snacks, in the city of Leerdam.	Food Delivery → Delivery ²²²⁷ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Vijfheerenlanden → Leerdam ⁶⁷²
donerplace-oldenzaal.nl	Döner Place	The website of Döner Place Oldenzaal offers online ordering options for a wide range of dishes, including döner kebab, lahmacun, shoarma and various sandwiches, plates and snacks, with the option for home delivery.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	döner kebab ⁸¹ lahmacun ⁹³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Oldenzaal ¹²¹⁹
donerroom-amsterdam.nl	Döner Room	The Döner Room website, based in Amsterdam, allows customers to order meals online, including döner sandwiches, Turkish pizzas, vegetarian options, and various snacks, drinks, and desserts.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
donersnackmax-oud-beijerland.nl	Döner & Snack Max	The website Döner & Snack Max from Oud-Beijerland offers the possibility to order food online, including döner kebabs, pizzas, sandwiches, and snacks.	International → Turkish ⁴¹⁶ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
donpaniniamersfoort-amersfoort.nl	Don Panini Amersfoort	Don Panini Amersfoort is a restaurant in Amersfoort where customers can order their meals online. It offers a wide range of sandwiches, paninis, plates and other dishes.	Fast Food → Fries ⁹⁴⁹ Fine Dining & Gastronomy → Dining ⁶⁷⁷	lettuce ²⁶ panini ¹⁵⁶ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Utrecht → Amersfoort ⁸⁰¹¹
double-ff-drachten.nl	Double FF Drachten	The website of Double FF Drachten offers the possibility to order food online from the restaurant in Drachten. It presents an extensive menu with a variety of dishes and snacks.	Ready-To-Eat Meals → Wraps ¹⁰²	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Smallingerland → Drachten ²⁰⁵²
doubleffzaailand.nl	Double FF Centrum	The website of Double FF Centrum in Leeuwarden offers the possibility to order fries, snacks, and fresh breakfast items, either for pick-up or delivery.	Fast Food → Fries ⁹⁴⁹	review ¹⁸⁸⁸ fries ²⁷⁵³ snack ²⁹¹⁶ account ⁵⁷⁸¹ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
doy-doy-vlissingen.nl	Doy-Doy	The website Doy-Doy offers the possibility to order food online from the restaurant in Vlissingen. The menu includes sandwiches, döner kebab, pizzas, kapsalon dishes, salads, snacks and desserts.	Turkish Cuisine → Fast Food ³²²²	dessert ⁴⁹⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Zeeland → Vlissingen ¹⁶¹⁴
drankgemak-dordrecht.nl	Drankgemak	The website Drankgemak allows online ordering of food and drinks. It is a webshop focused on beverages and snacks.	Beverages → Beer ¹⁰⁹⁵	beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ dish ⁵⁹³⁶
dunjakeuken-haarlem.nl	Dunja Keuken	Dunja Keuken is an online ordering platform for Indonesian food and snacks located in Haarlem.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	soft drinks ⁸⁷ bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶	North-Holland → Haarlem ⁸⁶⁷⁴
dunyadoner-groningen.nl	Dunya Döner Groningen	The Dunya Döner Groningen website offers online ordering for a variety of Turkish dishes and snacks in Groningen.	Fast Food → Fries ⁹⁴⁹	döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
easydailyfood.nl	Easy Daily Food	The website EASY DAILY FOOD provides a collection of healthy, quick, and easy recipes and ideas focused on weight loss, breakfast, lunch, dinner, healthy snacks, and desserts.	Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷ Cooking & Recipes → Dessert Recipes ²¹	treat ³⁷³ dessert ⁴⁹⁶ weight loss ⁶⁷⁸ breakfast ¹⁸²² snack ²⁹¹⁶ recipe ⁵¹⁴²
eatcorner-potmargeonline.nl	Eatcorner potmarge	Eatcorner potmarge is an online restaurant and takeaway shop in Leeuwarden offering a variety of snacks, meals, and drinks, including hamburgers, fries, sandwiches, and vegetarian options.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Takeaway ⁴⁰⁹	hamburger ³⁶⁴ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Friesland → Leeuwarden ⁶⁰⁶⁸
eatyammy.nl	Yammy	EatYammy is a website focused on providing healthy eating experiences for children through cooking kits, lessons, and educational activities.	Early Years → Early Childhood Education ¹³⁴⁵ Food → Cooking & Recipes ³⁹⁸⁹	kit ⁵²⁶ cooking ⁸⁰¹ memory ¹⁶⁴¹ game ²⁸⁰⁷ snack ²⁹¹⁶ food ³⁸⁷²
edscatering-amsterdam.nl	Ed's Catering	The website Ed's Catering, based in Amsterdam, allows users to order food online, featuring a menu with meals, snacks and drinks.	Sandwiches & Salads → Snacks ⁶⁹³	nasi ²⁴² beer ²⁸⁸⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
edsnack.nl	Edsnack	Edsnack is an online store specializing in the sale of a diverse selection of snacks, including candy, chips, and various beverages.	Sandwiches & Salads → Snacks ⁶⁹³	candy ²⁰⁵ beverage ⁵⁸⁶ snack ²⁹¹⁶
eetboetiek-lemmer.nl	Snack & Eetboetiek De Brekken	Snack & Eetboetiek De Brekken is an online ordering platform for food in Lemmer.	Fast Food → Fries ⁹⁴⁹ Bars & Pubs → Bars ¹⁹³⁸	kibbeling ¹¹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	De Fryske Marren → Lemmer ¹¹⁸⁸
eetcafe-cafe-cafetaria-de-viersprong.nl	Eetcafé Café Cafetaria De Viersprong	Eetcafé Café Cafetaria De Viersprong is a café in Kootstertille that accepts online orders for a wide range of potato-based dishes, burgers, and other snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family pack ²⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Achtkarspelen → Kootstertille ⁶⁶
eetcafe-rams-rotterdam.nl	Eetcafe Rams	Eetcafe Rams is a cafe in Rotterdam that accepts online orders for a variety of dishes, including soups, sandwiches, roti, nasi, bami, and other items.	Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ soup ¹⁰⁴³ beer ²⁸⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
eetcafemirage-groningen.nl	Eetcafé Mirage	The Eetcafé Mirage website offers an online ordering system for meals and snacks in Groningen. Visitors can view the menu and place orders.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
eetcafenoor-breda.nl	Eetcafé Noor	Eetcafé Noor is an online ordering platform for food from Eetcafé Noor in Breda, where customers can order via the website bread, burgers, bowls, pasta, snacks, and drinks.	Sandwiches & Salads → Snacks ⁶⁹³	bowl ⁴⁸² pasta ¹³⁸⁹ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Breda ⁹⁰⁰³
eetcafepunt-roelofarendsveen.nl	Eetcafé Punt	The website of Eetcafé Punt offers online ordering options for food and drinks at the café located in Roelofarendsveen, with an extensive menu and the possibility of reviews.	Fast Food → Fries ⁹⁴⁹ Online Services → Ordering ¹²¹	snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Kaag en Braassem → Roelofarendsveen ³⁴⁸
eetcafesnackbarkokkie-apeldoorn.nl	Eetcafé/snackbar Kokkie	The website of Eetcafé/snackbar Kokkie presents the menu and offerings of the café/snackbar, with a focus on fries, snacks and sandwiches in Apeldoorn.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
eetcounterdekorregroningen.nl	Eetcounter De Korre	The website Eetcounter De Korre from Groningen offers an online ordering system for meals and drinks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
eeterijenfeesterijdedroom-langeweg.nl	Eeterij en Feesterij de Droom	The website of Eeterij en Feesterij de Droom provides visitors with the opportunity to order meals online from the cafe in Langeweg.	Fast Food → Fries ⁹⁴⁹ Cuisine → Dutch Cuisine ¹⁷⁹	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Moerdijk → Langeweg ³⁹
eethoekdonau-utrecht.nl	Eethoek Donau	The website Eethoek Donau in Utrecht offers online ordering of meals, including döner kebab, pizzas, fries, and soft drinks. The goal is to facilitate the ordering of a meal.	Cafes → Dutch Restaurants ¹⁰³¹ Quick Bites → Online Restaurant ¹⁰⁹	döner kebab ⁸¹ soft drinks ⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ order ⁶⁹¹²	Netherlands → Utrecht ⁴⁸⁹⁰¹
eethoekmewa-almere.nl	Eethoek Mewa	Eethoek Mewa is an online restaurant in Almere that offers a menu and the possibility to order meals online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Online Restaurant ¹⁰⁹	köfte ¹² döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Flevoland → Almere ⁷⁷⁶⁵
eethuis-bergen.nl	Eethuis Bergen	The Eethuis Bergen website in Bergen (L.) provides an online ordering system for a wide variety of fast food items, including fries, snacks, plates, pizzas, and drinks.	International → Middle Eastern ¹¹⁶ Quick Bites → Hair Salon ¹¹²	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Limburg → Bergen ³⁹⁹
eethuis-doornenburg.nl	Eethuis Doornenburg	The Eethuis Doornenburg website is an online platform for ordering snacks, grills, and other dishes, with delivery options and catering services for parties and events.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Diner ³⁵	grill ⁵⁶² fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Lingewaard → Doornenburg ¹²⁹
eethuis-helal.nl	Eethuis Helal Haarlem	The website of Eethuis Helal Haarlem provides an online ordering system for dishes and snacks, featuring a comprehensive menu of Turkish and Italian cuisine and snacks.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	dürüm ⁹⁷ pita ¹⁹⁹ kapsalon ⁵⁰⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	North-Holland → Haarlem ⁸⁶⁷⁴
eethuis-krispijn.nl	Krispijn	The website Krispijn from Dordrecht offers online ordering for a variety of dishes, including sandwiches, burgers, Turkish pizza, döner kebab and other meals. It’s an online platform for ordering food.	Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Dordrecht ⁴⁵³¹
eethuis-milano.nl	Eethuis Milano Doetinchem	The Eethuis Milano Doetinchem website provides an online ordering system for dishes and snacks from Turkish-Turkish cuisine, with a focus on Döner boxes and fries.	Fast Food → Döner ²³⁸	chicken dishes ²⁶ dönerbox ³³ dürüm ⁹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Gelderland → Doetinchem ²⁷⁰⁶
eethuisharput-raalte.nl	Eethuis Harput	Eethuis Harput is an online restaurant in Raalte where customers can order food online and have it delivered. The website offers a comprehensive menu with various dishes, including plates, sandwiches, döner, pizzas, and other Turkish specialties.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Overijssel → Raalte ¹⁷⁷¹
eethuisjeduivenvoorde.nl	Eethuisje Duivenvoorde	The website of 'Eethuisje Duivenvoorde' presents information about a cafeteria in Wassenaar, focused on offering food and beverages.	Quick Bites → Cafeteria ⁹⁰⁶	croquette ¹³⁶ seat ²¹⁸ satay ³²⁰ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶	South-Holland → Wassenaar ¹³⁷²
eethuisjudy.nl	Eethuis Judy	The website of Eethuis Judy in Zoetermeer offers online ordering for meals and snacks, including delivery, and promotes the establishment via a newsletter and app.	Cafes → Eateries ⁸² Quick Bites → Cafeteria ⁹⁰⁶	meal ¹⁶³⁸ snack ²⁹¹⁶ reviews ³¹⁷² pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
eethuisnoewthoear-thorn.nl	Eethuis Noew Thoear	The website Eethuis Noew Thoear from Thorn offers the possibility to order dishes online from the eatery, with an extensive menu and reviews.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Quick Bites → Cafeteria ⁹⁰⁶	frikandel ¹⁸ croquette ¹³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Maasgouw → Thorn ¹²⁰
eethuisperis-almere.nl	Pideci Almere	The Pideci Almere website is an online platform where customers can order and have delivered Turkish pide and other dishes, including soups, plates and sandwiches, in Almere.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	pide ⁵⁶ plate ⁷⁸⁷ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Flevoland → Almere ⁷⁷⁶⁵
eethuispizzeriaanadolu-schiedam.nl	Eethuis & Pizzeria Anadolu	The website of Eethuis & Pizzeria Anadolu from Schiedam offers the possibility to order meals online, including sandwiches, pizzas, mini plates, fries and various snacks.	Sandwiches & Salads → Italian Cuisine ⁹⁹	lahmacun ⁹³ dürüm ⁹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Schiedam ²²⁴⁹
eethuissaron-rotterdam.nl	Eethuis Saron	The website of Eethuis Saron from Rotterdam offers the possibility to order meals online and view the menu.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	pastries ⁹⁴⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
eethuissidelandgraaf.nl	Eethuis Side	The website Eethuis Side, located in Landgraaf, offers the possibility to view menus online and order food, focusing on sandwiches, döner, pizzas and other snacks.	Germany → North Rhine-Westphalia ⁵⁸ Bakery & Food Production → Bread ⁷⁶⁵	menus ²²¹ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Limburg → Landgraaf ⁷¹⁹
eetwinkelkwebbles.nl	Eetwinkel Kwebbles	Eetwinkel Kwebbles is a food and drink outlet located in Geertruidenberg, offering a variety of meals and snacks.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ staff ³⁴⁰⁵	North-Brabant → Geertruidenberg ⁶⁹⁴
eightcatering.nl	Eight Catering	The website of Eight Catering offers Indonesian catering services for private and business events, focusing on authentic Indonesian cuisine.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Indonesian ⁵⁰²	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
eiwitlekkernijen.nl	Eiwitlekkernijen	The website Eiwitlekkernijen.nl offers a comprehensive selection of protein-rich products and supplements aimed at athletes and health-conscious consumers.	Supplements → Proteins ⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	protein ²⁹⁹ bar ¹²¹⁶ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² brand ¹⁷⁷³⁷
elgrecosnacks-almere.nl	El Greco Snacks	The El Greco Snacks website in Almere allows users to order food online, featuring a comprehensive menu of fries, snacks, and other dishes.	Food Delivery → Delivery ²²²⁷ Quick Bites → Hair Salon ¹¹²	family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
elpasha.nl	El Pasha	The El Pasha website in Hoensbroek allows customers to order food online, including pizzas, plates and various snacks.	Fast Food → Fries ⁹⁴⁹ International → Turkish ⁴¹⁶	calzone ⁹⁰ plate ⁷⁸⁷ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Heerlen → Hoensbroek ³⁷¹
etentogo-hoogvlietrotterdam.nl	Eten To Go	The Eten To Go website is an online platform where customers can order and view sushi and other Japanese dishes in Hoogvliet, Rotterdam.	Japanese → Sushi ⁹⁷¹	nigiri ¹⁴⁶ maki ¹⁶⁹ roll ³⁵⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	Rotterdam → Hoogvliet ⁵¹⁶
eurocafetaria-groningen.nl	Euro Cafetaria	The Euro Cafetaria website in Groningen offers online ordering for a wide variety of food, including fries, snacks, burgers, and various special combination deals.	Fast Food → Fries ⁹⁴⁹	combo ⁵⁹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Netherlands → Groningen ²³⁷³⁴
evensmullen.nl	SushiShop Evensmullen	The SushiShop Evensmullen.nl website offers the possibility to order fresh sushi and Poké bowls for takeout or delivery within a specific postcode area. The shop is temporarily closed from July 18th to July 27th, 2023.	Japanese → Sushi ⁹⁷¹ Food Delivery → Delivery ²²²⁷	poké bowl ¹⁶⁹ roll ³⁵⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	Bronckhorst → Wichmond ²⁸
family-heemskerk.nl	Family Heemskerk	The Family Heemskerk website allows customers to order food online from their location in Heemskerk, offering a menu with various dishes such as burgers, fries, sandwiches, and seasonal specials.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	special ³¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Heemskerk ¹¹¹¹
famousmisterchickenroosendaal.nl	Famous Mister Chicken Roosendaal	The website Famous Mister Chicken Roosendaal provides an online ordering system for a wide variety of dishes, including chicken burgers, wraps, sandwiches, and snacks. The goal is to offer customers a fast and reliable way to order food.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Roosendaal ²⁶⁷⁷
fancy-food.nl	Fancy Food	The website of Fancy Food is an online platform where visitors can order delicious platters and snacks for various occasions, such as parties and gatherings.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Dairy → Cheese ⁵³⁰	cheese board ²⁸ platter ⁶⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ party ⁵⁹²⁸ catering ⁶⁴⁵⁶
fantasia-denhaag.nl	Fantasia Den Haag	The Fantasia Den Haag website offers online ordering for a variety of dishes, including Turkish and Italian pizzas, sandwiches, and various snacks.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸	dürüm ⁹⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ salon ⁵⁵⁴¹	South-Holland → The Hague ¹⁹⁸⁹⁸
fastpizzacurry-amsterdam.nl	Fast Pizza & Curry Amsterdam	The Fast Pizza & Curry Amsterdam website provides an online ordering system for pizzas, curries, and other Indian and Turkish dishes in Amsterdam.	Food Delivery → Indian Cuisine ⁵⁴³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	curry ³⁵⁵ appetizer ⁵⁵⁶ beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Amsterdam ⁴¹²⁵³
fattalsupermarkt-bergenopzoom.nl	Fattal Supermarkt	The Fattal Supermarkt website in Bergen op Zoom allows customers to view the menu online and order meals for delivery or pickup, offering a variety of dishes including döner, sandwiches, wraps, and plates.	Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ plate ⁷⁸⁷ wrap ⁸²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Bergen op Zoom ²²⁷⁴
feesthapje.nl	feesthapje	Feesthapje is a catering company that delivers delicious snacks and catering solutions for parties and events.	Cooking & Recipes → Culinary ³³⁸	taste ⁹³³ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶
fesleyen-bistro.nl	Fesleyen Bistro	The Fesleyen Bistro website offers the ability to order online and have meals delivered. It features a comprehensive menu with Turkish and other dishes.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ wrap ⁸²⁶ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
fishandchips.nl	Fish & Chips IJmuiden	Fish & Chips IJmuiden is a delivery service offering warm and cold meals, with a focus on fresh fish, throughout the IJmuiden, Haarlem, and Velsen regions.	Online Ordering → Delivery Restaurants ⁷² Quick Bites → Online Restaurant ¹⁰⁹	fish ¹¹²¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Velsen → Santpoort-Noord ⁶⁰⁶
flavoursopzuid-rotterdam.nl	Flavours op Zuid	Flavours op Zuid is a website where you can order dishes from Rotterdam online.	Asian → Chinese ⁴¹⁵	shrimp ²¹⁹ nasi ²⁴² beef ³¹⁹ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
food73sprang-capelle.nl	Food 73	The Food 73 website is an online platform where customers can order food from Waalwijk.	Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Waalwijk ¹⁷⁴⁴
foodfactory-enschede.nl	Foodfactory	Foodfactory Enschede is an online shop where customers can order food and snacks directly online and have them delivered to their home.	Japanese → Sushi ⁹⁷¹ Online Marketing → Promotion ⁶¹⁴	points ⁶¹² deals ¹⁰⁷⁰ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
foodiessnackcorner.nl	Foodies Snack Corner	The Foodies Snack Corner website offers online ordering of snacks and catering services, with the option for delivery or pickup.	Quick Bites → Snack Bar ⁵⁸⁰	baguette ³⁵ croquettes ¹⁰⁸ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
foodimperium-amersfoort.nl	Food Imperium Amersfoort	The Food Imperium Amersfoort website is an online platform for ordering meals, snacks, and drinks in Amersfoort.	Fast Food → Fries ⁹⁴⁹ Meal Solutions → Food Online Shops ⁸⁰	spring roll ⁸² croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Amersfoort ⁸⁰¹¹
foodmaster-nieuwegein.nl	Foodmaster Nieuwegein	The Foodmaster Nieuwegein website allows customers to order food online from the Foodmaster location in Nieuwegein.	Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
foodmaster-wilnis.nl	Foodmaster Wilnis	The Foodmaster Wilnis website is an online platform allowing customers to order dishes and snacks from the Foodmaster Wilnis restaurant in Wilnis. It offers a comprehensive menu with fries, snacks, grill burgers, salads, sandwiches and beverages.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	De Ronde Venen → Wilnis ²²²
foodmaster-wormerveer.nl	Foodmaster Wormerveer	The Foodmaster Wormerveer website offers the opportunity to order meals online from the Foodmaster restaurant in Wormerveer.	Fast Food → Chicken Dishes ⁹² Cooking & Recipes → Dishes ³³⁵	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Zaanstad → Wormerveer ⁵³⁰
frietboutique-rotterdam.nl	Frietboutique Rotterdam	Frietboutique Rotterdam is an online platform where visitors can order fries and snacks from Rotterdam and view the menu.	Quick Bites → Hair Salon ¹¹²	croquette ¹³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
frietboutiqueamsterdam.nl	Frietboutique Amsterdam	Frietboutique Amsterdam is an online platform where customers can order fries, snacks, drinks and sauces in Amsterdam.	Quick Bites → Hair Salon ¹¹²	croquette ¹³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
frietboutiquehillegersberg-rotterdam.nl	Frietboutique Hillegersberg	The Frietboutique Hillegersberg website in Rotterdam offers the possibility to order meals online, consisting of fries, sauces, snacks, and drinks.	Fast Food → Fries ⁹⁴⁹ Fast Food → Chicken Dishes ⁹²	ice cream ¹⁰⁰⁰ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹²	South-Holland → Rotterdam ²⁵⁰⁴⁸
frietje-met.nl	Frietje-met	The website Frietje-met.nl offers catering services for various parties and events, specializing in freshly fried fries and snacks, and serves clients in the Netherlands, Belgium, Germany, and France.	Catering → Mobile Catering ⁸⁷ Online Retail → Food Retail ³⁴⁰	fry truck ³⁸ fry ⁵⁹ snack ²⁹¹⁶ package ⁶¹¹² catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
frietsalon-zuiderkruis-veenendaal.nl	Frietsalon Zuiderkruis Veenendaal	The website of Frietsalon Zuiderkruis in Veenendaal offers the opportunity to order meals online, featuring a comprehensive menu of fries, snacks, sandwiches, main courses, and drinks.	Fast Food → Fries ⁹⁴⁹	frikandel ¹⁸ family pack ²⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Utrecht → Veenendaal ²⁶⁴¹
frietwagen-venlo.nl	Frietwagen de Smulboetiek	The website offers the rental of a mobile fry truck, ‘de Smulboetiek,’ in the Venlo region for events and locations.	Fast Food → Fries ⁹⁴⁹ Catering → Mobile Catering ⁸⁷	fry truck ³⁸ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Limburg → Venlo ⁴¹⁵⁸
frietwagendekempen.nl	Frietwagen De Kempen	The Frietwagen De Kempen website offers a mobile fries and snacks service for various occasions, such as parties, events, and corporate gatherings.	Fast Food → Fries ⁹⁴⁹ Event Styling & Decoration → Event Equipment ⁷⁷⁵	stand ²⁹⁴ fries ²⁷⁵³ snack ²⁹¹⁶ package ⁶¹¹² menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Weert → The Peel ¹⁰⁷
friteriezo-nijmegen.nl	Friterie & zo	The website Friterie & zo is an online platform where visitors can order dishes from the frituur (fast food restaurant) in Nijmegen.	Fast Food → Burgers ⁶⁸⁷ Online Services → Ordering ¹²¹	frituur ¹² vegan ⁵⁰⁸ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
friturewendy.nl	Friture Wendy	Friture Wendy is a frituur (fast food restaurant) in Rijckholt that aims to be a meeting place for young and old, offering delicious fries and snacks.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	frituur ¹² sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ hospitality ³⁴⁹¹ menu ¹³⁸⁵⁶	Eijsden-Margraten → Gronsveld ¹⁰⁴
funspace-nijmegen.nl	FunSpace	The FunSpace website in Nijmegen offers online ordering of a menu with various dishes, snacks, and drinks.	Fast Food → Fries ⁹⁴⁹	vegan ⁵⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
gebr-koning-volendammer-viscircus.nl	Gebr. Koning Volendammer Viscircus	The website of Gebr. Koning Volendammer Viscircus in Almere offers the possibility to order food online, including sandwiches, snacks, lunch meals and drinks.	Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
gijzelks.nl	Gijzel Kantineservice	Gijzel Kantineservice is a distribution company offering catering supplies and consumables.	Coffee & Tea → Beverages ⁴⁴⁵³ Administrative Support → Business Operations ¹¹⁵⁶	restroom ³⁰ disposables ⁹⁷ cleaning supplies ¹⁴⁰ coffee machine ⁴¹⁵ beverage ⁵⁸⁶ snack ²⁹¹⁶	Gelderland → Barneveld ²⁷⁸¹
goasianede.nl	Go Asian	The website Go Asian offers online ordering of Asian food in Ede. The website presents a menu with various meals, snacks and drinks.	Asian → Chinese ⁴¹⁵	meal box ⁵⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Gelderland → Ede ⁵¹⁰⁴
goedgevuld.nl	Goedgevuld	Goedgevuld is a gift shop offering various gift packages for different occasions.	Holidays → Christmas ⁹³⁷ Food → Gifts & Souvenirs ²⁴²¹	christmas package ²³ fruit basket ⁷⁹ gift package ⁵³⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶ webshop ⁸⁶⁴⁸	Netherlands → Drenthe ²⁰⁰⁶²
grandcafederoemer.nl	Grandcafe de Roemer	Grandcafe de Roemer is an informal and cozy cafe offering food and drinks, and recruiting staff.	Asian → Chinese ⁴¹⁵ Work → Jobs ¹⁴⁴³	cafeteria ¹⁶⁹ snack ²⁹¹⁶ staff ³⁴⁰⁵ drink ⁵¹⁹¹ kitchen ⁶⁴⁴³
griekscornergroningen.nl	Grieks Corner	The website Grieks Corner offers the possibility to order Greek dishes and drinks online in Groningen.	International → Greek ⁴⁶⁵ Activities → Dining Out ¹⁸¹	snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
grill-restaurant-shalom-voorschoten.nl	Grill restaurant Shalom	The website of Grill restaurant Shalom from Voorschoten offers the possibility to order food online and view the menu.	Turkish Cuisine → Fast Food ³²²²	main course ¹⁰² rib ¹⁹¹ kapsalon ⁵⁰⁹ meat ²⁰⁵⁵ snack ²⁹¹⁶	South-Holland → Voorschoten ⁸³⁰
grillhousedamascus-drachten.nl	Grillhouse Damascus	Grillhouse Damascus is an online ordering platform for dishes, primarily from the Middle East, with a focus on barbecue and various meat and vegetarian options.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	kebab ²⁷⁶ grill ⁵⁶² plate ⁷⁸⁷ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Smallingerland → Drachten ²⁰⁵²
grillroomnora-hoogeveen.nl	Grillroom Nora	The website Grillroom Nora from Hoogeveen offers online ordering for a wide variety of snacks, sandwiches, shawarma plates, pizzas, lahmacun and other dishes.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	lahmacun ⁹³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Drenthe → Hoogeveen ²²⁹⁴
gusdedrankkoerier.nl	Gus de Drankkoerier	Gus de Drankkoerier is an online evening shop that delivers alcoholic beverages, snacks, and non-food items to Rotterdam.	Delivery → Beverage Delivery ²⁰	evening ²⁸⁷ beverage ⁵⁸⁶ snack ²⁹¹⁶ shop ⁶⁴⁸³	South-Holland → Rotterdam ²⁵⁰⁴⁸
guunkookt.nl	Guun kookt	Guun kookt is a culinary company offering various services including private cooking evenings, luxury snacks and platters, and content creation for businesses.	Blogs & Publications → Press Releases ⁷³¹ Cooking & Recipes → Home Cooking ³⁵	tableware ⁶¹³ chef ⁶³¹ diploma ⁷⁹⁵ snack ²⁹¹⁶ wine ⁴⁴⁷⁶
gym-store.nl	Gym Store	The website is an online store that sells supplements, high-protein products, and fitness equipment.	Shopping → Sports Stores ¹⁴² Apparel → Sporting Goods ¹³⁷⁴	fitness equipment ²³⁰ supplement ¹⁹⁶⁸ snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
hakikidoner.nl	Hakiki Döner	Hakiki Döner is an online ordering platform for Turkish-Turkish cuisine, focusing on döner, sandwiches, and plates, located in Eindhoven.	Fast Food → Döner ²³⁸	dürüm ⁹⁷ döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
halloweenrecepten.nl	Halloween Recepten	Halloweenrecepten.nl is a website that provides users with fun, spooky, and easy-to-make recipes suitable for the Halloween period.	Festivals → Halloween ⁷³	halloween ⁵³ main course ¹⁰² appetizer ⁵⁵⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
hansengrietje-schiedam.nl	Hans en Grietje	The website Hans en Grietje offers the possibility to order food online from the restaurant Hans en Grietje in Schiedam. Customers can view the menu and order dishes for delivery here.	Fast Food → Fries ⁹⁴⁹ Cuisine → Dutch Cuisine ¹⁷⁹	spring roll ⁸² menus ²²¹ satay ³²⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Schiedam ²²⁴⁹
hanzekiosk.nl	HANZE KIOSK KAMPEN	The Hanze Kiosk Kampen website serves as an online platform for a snack bar that provides takeaway and online ordering services for a variety of food items.	Quick Bites → Snack Bar ⁵⁸⁰	hour ³⁶⁵ address ⁹⁰¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Overijssel → Kampen ²¹⁶¹
hap-wat-alkmaar.nl	Hap Wat Alkmaar	The website aims to facilitate online ordering of food from Hap Wat Alkmaar.	Fast Food → Chicken Dishes ⁹²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Alkmaar ⁶⁵⁰⁷
hapjesaalsmeer.nl	Hapjes Aalsmeer	Hapjes Aalsmeer is a catering company based in Aalsmeer that delivers fresh, hot meals and sweets to businesses and individuals.	Events & Hospitality → Corporate Catering ²⁶⁷	meal ¹⁶³⁸ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ order ⁶⁹¹²	North-Holland → Aalsmeer ¹⁷¹⁰
happertjes.nl	Happertjes	Happertjes is a company that provides delicious, handcrafted snacks and dishes for various occasions.	Office & Workspace → Operations ²¹⁹	snack ²⁹¹⁶ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹ event ⁴⁵¹⁹⁹
happygarden-denhaag.nl	Happy Garden Den Haag	The website of Happy Garden Den Haag offers the possibility to order meals online from the restaurant in Den Haag.	Asian → Chinese ⁴¹⁵	soup ¹⁰⁴³ meat ²⁰⁵⁵ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
happyhousezwijndrecht.nl	Happy House Zwijndrecht	The Happy House Zwijndrecht website is an online platform where customers can order fries, snacks, and other meals for delivery or takeaway.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Online Restaurant ¹⁰⁹	fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Zwijndrecht ¹⁴⁵⁵
hasdonerkebab-spijkenisse.nl	HAS Doner Kebab Spijkenisse	The website of HAS Doner Kebab Spijkenisse allows customers to order food online, including döner kebab, Turkish pizza, sandwiches, snacks and plates. It also presents a menu with various combo meals and special dishes.	Fast Food → Döner ²³⁸ Food Delivery → Delivery ²²²⁷	döner kebab ⁸¹ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Nissewaard → Spijkenisse ¹⁴³³
haturessy.nl	Haturessy Catering	The website of Haturessy Catering presents a catering service specializing in authentic Moluccan and Indonesian cuisine, with a focus on quality and a pleasurable dining experience.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Cooking & Recipes → Cuisine ¹¹⁴⁷	menus ²²¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Zeeland → Middelburg ²³⁴²
health-corner-amsterdam.nl	Health Corner	The Health Corner website in Amsterdam offers the possibility to order food online, including rice dishes, soups, snacks, and drinks.	Web Design & Development → Web Services ⁴¹³ Cuisine → Vegetarian ⁶⁹⁷	kombucha ²⁹ rice dishes ⁷⁶ soup ¹⁰⁴³ beer ²⁸⁸⁷ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
heelniedorpproeft.nl	Heel Niedorp Proeft	The website of Heel Niedorp Proeft presents a cycling and tasting event taking place on Saturday, April 12, 2025, in Niedorp, where visitors can enjoy food and drinks with a final afterparty.	Cycling → Cycling Routes ¹⁰⁰² Outdoor & Recreation → Outdoor Events ¹¹⁰	afterparty ²⁴ cycle ¹⁹⁰⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Hollands Kroon → Nieuwe Niedorp ¹⁴⁷
helmonds-friethuys-helmond.nl	Helmonds Friethuys	The website Helmonds Friethuys offers online ordering of dishes and snacks from the fast-food restaurant located in Helmond. The website presents a menu with various fries dishes, meals, snacks and vegetarian options.	Cuisine → Vegetarian ⁶⁹⁷	gluten-free ¹⁵⁶ vegetarian ³³⁷ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Brabant → Helmond ³⁰⁵⁸
hesushisnackbar-veghel.nl	He Sushi & Snackbar	The website He Sushi & Snackbar from Veghel offers the possibility to order sushi and other dishes online.	Japanese → Sushi ⁹⁷¹ Quick Bites → Snack Bar ⁵⁸⁰	poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Meierijstad → Veghel ¹²⁸⁸
het-luifeltje.nl	Kwaliteitszaak 't Luifeltje	Kwaliteitszaak 't Luifeltje is a cafeteria in Bergen op Zoom offering a variety of products and services, including delivery and catering.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	North-Brabant → Bergen op Zoom ²²⁷⁴
het-patatje-lelystad-lelystad.nl	Het Patatje Lelystad	Het Patatje Lelystad is an online ordering platform for fast food in Lelystad.	International → Middle Eastern ¹¹⁶	kebab ²⁷⁶ shawarma ³³⁵ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Flevoland → Lelystad ³¹⁸⁰
hetboetje.nl	Welkom bij 't Boetje	‘t Boetje is an online store selling natural food for cats and dogs, offering delivery and pickup services in the Purmerend and Berkhout regions.	Pet Food → Cat Food ¹²⁴	cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ treatment ²¹²⁰³	Koggenland → Berkhout ⁷⁹
heteethuisjehorst.nl	Cafetaria Het Eethuisje	The website of Cafetaria Het Eethuisje provides an online platform to order burgers and snacks for takeout in Horst. The site also contains information about the menu, reviews and a registration option for the newsletter.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Horst aan de Maas → Horst ⁴⁵⁴
hetfrietje.nl	Cafetaria 't Frietje Ede	Cafetaria 't Frietje Ede's official website offers online ordering of fries, snacks, and other dishes with delivery.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Ede ⁵¹⁰⁴
hetgeveltje-nieuwegein.nl	Het Geveltje	Het Geveltje is an online ordering service for Greek cuisine and snacks located in Nieuwegein. The website offers a menu with various dishes, hamburgers, sandwiches and snacks, as well as individual products and beverages.	International → Greek ⁴⁶⁵	coleslaw ¹⁰ greek ⁴² fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → Nieuwegein ²²⁶⁴
hethapjebyferry-denhaag.nl	Het Hapje by Ferry	The website ‘Het Hapje by Ferry’ offers online ordering for dishes from The Hague, with a focus on sandwiches, snacks and other meals.	Quick Bites → Cafeteria ⁹⁰⁶	vegetarian ³³⁷ sauce ¹¹⁴¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
hetmomentje.nl	Catering De Mobiele Kok	The website ‘Frieten en Snacks op Locatie’ offers a mobile catering service for fries and snacks, delivering to various locations across the Netherlands for private and corporate events.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Utrecht → Houten ¹⁶⁷⁷
hetrotihuisdiemen.nl	Jai Ram's Roti	The website of Jai Ram's Roti offers the possibility to order dishes online, including roti, snacks, and other Surinamese specialties, from the location in Diemen.	Food Delivery → Surinamese ²⁶⁵	peanut sauce ²⁵ roti ³⁰³ potato ⁵⁴² snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Diemen ⁹⁷⁵
hetsurinaamshuisjediemen.nl	Het Surinaamshuisje	Het Surinaamshuisje is an online shop based in Diemen where you can order dishes from the Surinamese restaurant.	Food Delivery → Surinamese ²⁶⁵	bami ¹⁴⁴ roti ³⁰³ vegetarian ³³⁷ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Diemen ⁹⁷⁵
hiennies-heerhugowaard.nl	Hiennies	The Hiennies website is an online platform that allows customers in Heerhugowaard to order food from the restaurant and have it delivered to their homes.	Food Delivery → Asian ²⁷²³ Meal Solutions → Food Online Shops ⁸⁰	banh mi ²¹ bun ²⁷ spring rolls ¹⁴¹ bubble tea ¹⁵³ milkshake ¹⁹⁵ snack ²⁹¹⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
hititafhaalcentrum-wormerveer.nl	Hitit Afhaal Centrum	Hitit Afhaal Centrum is a takeaway restaurant in Wormerveer where customers can order meals online. It offers a diverse menu with Turkish and other dishes.	Restaurants & Dining → Takeaway Restaurants ²⁴⁰	kapsalon ⁵⁰⁹ döner ⁶⁷³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Zaanstad → Wormerveer ⁵³⁰
hondjebrok.nl	Hondjebrok.nl	Hondjebrok.nl is a webshop specializing in pet food and chew products for dogs.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ promotion ²⁰⁶² snack ²⁹¹⁶ food ³⁸⁷²	Bunschoten → Bunschoten-Spakenburg ³⁸²
ijsspecialist-edma.nl	Ijsspecialist EDMA	Ijsspecialist EDMA is an online restaurant delivering meals, snacks, and sushi from Tilburg.	Japanese → Sushi ⁹⁷¹ Fast Food → Fries ⁹⁴⁹	croquettes ¹⁰⁸ chicken ⁹⁴⁴ sauce ¹¹⁴¹ sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
indian-snacks-amstelveen.nl	Indian Snacks Amstelveen	The website Indian Snacks Amstelveen offers an online ordering system for Indian snacks and dishes from Amstelveen, featuring a comprehensive menu and customer reviews.	Ethnic → Indian ³⁵² Food Delivery → Indian Cuisine ⁵⁴³	biryani ⁸⁰ vegetarian ³³⁷ curry ³⁵⁵ bread ¹⁶²² snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amstelveen ³¹⁸⁰
indohouse.nl	Indohouse	Indohouse is an online store that delivers Indonesian dishes and drinks to your home.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	rame ¹⁹ rijsttafel ⁴⁷ beverage ⁵⁸⁶ payment ¹³⁸⁹ snack ²⁹¹⁶ order ⁶⁹¹²	Limburg → Maastricht ⁶⁰⁰⁸
istanbulblaak.nl	Istanbul Döner Kebab	The website Istanbul Döner Kebab offers the possibility to order and have Turkish dishes delivered online, including döner kebab, pizza and sandwiches.	Turkish Cuisine → Fast Food ³²²² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	döner kebab ⁸¹ beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
istanbulpizza.nl	Istanbul Pizza	The Istanbul Pizza website is a restaurant offering a variety of pizzas, döner sandwiches, salads, tosti’s, and snacks, with a blend of Italian and Turkish influences.	Fast Food → Döner ²³⁸	tosti ²³ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸
itsnackhus.nl	Cafetaria It Snackhûs Wommels	The website of Cafetaria It Snackhûs Wommels allows visitors to order online and have burgers, snacks and other products delivered. It also features a menu and newsletter signup.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Southwest-Friesland → Wommels ¹¹³
jajacafetariasushi-wageningen.nl	Jaja Cafetaria & Sushi	The website of Jaja Cafetaria & Sushi offers online ordering of food and drinks, specifically focused on fries, sushi and other snacks in Wageningen.	Japanese → Sushi ⁹⁷¹ Fast Food → Fries ⁹⁴⁹	combination ¹⁸⁹ sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Gelderland → Wageningen ¹⁹⁴⁹
jammie-jammie-kebab.nl	Jammie Jammie Kebab	The website of Jammie Jammie Kebab in Helmond offers the possibility to order food online, including kebabs, burgers, pizzas and other snacks. Users can view the menu and place orders.	Quick Bites → Cafeteria ⁹⁰⁶ Context ¹⁶¹³⁹⁴	kebab ²⁷⁶ burger ¹⁴³¹ bread ¹⁶²² salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	North-Brabant → Helmond ³⁰⁵⁸
jamvanbert.nl	Jam van Bert	The Jam van Bert website presents and sells various sambals and chili sauces, originally produced as accompaniments to jams.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	sambal ⁵⁴ jam ¹²² snack ²⁹¹⁶ webshop ⁸⁶⁴⁸	North-Holland → Den Helder ¹⁸⁸⁶
jays-kalla-utrecht.nl	Jay's Kalla	Jay's Kalla is an online platform where customers in Utrecht can order food, including fries, kapsalons, wraps, burgers, and Turkish pizzas.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
jlbubbletea-denhaag.nl	J&L Bubble Tea	The website of J&L Bubble Tea allows customers to order online and view their extensive menu of bubble tea varieties and snacks.	Tea → Bubble Tea ³¹	bubble tea ¹⁵³ tea ¹¹⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
jmsnacks.nl	JM Snacks	JM Snacks is a family-run restaurant in Scheveningen that serves fresh fries and snacks, offering a friendly and enjoyable experience for families.	Fast Food → Fries ⁹⁴⁹ Beach Life → Beach ⁵³²	tart ²⁰ fish ¹¹²¹ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸	The Hague → Scheveningen ¹⁶²⁵
joethejuice-amstelveen.nl	Joe & The Juice	The website allows customers in Amstelveen to order food and beverages online from Joe & The Juice.	Quick Bites → Snack Bar ⁵⁸⁰ Cuisine → Vegetarian ⁶⁹⁷	shake ¹¹² juice ²⁰⁷ bread ¹⁶²² snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸	North-Holland → Amstelveen ³¹⁸⁰
julias-amsterdam-sloterdijk.nl	Julia's Amsterdam Sloterdijk	This website offers online ordering for food at Julia's Amsterdam Sloterdijk in Amsterdam.	Lunch → Sandwiches ⁴⁶⁶	pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
julias-amsterdam-zuidwtc.nl	Julia's Amsterdam Zuid/WTC Amsterdam	The website Julia's Amsterdam Zuid/WTC Amsterdam is an online platform where visitors can view the menu and order food online from the restaurant in Amsterdam.	Sandwiches & Salads → Salads ¹³³	pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Amsterdam → South ¹⁴⁸⁸
julias-groningen.nl	Julia's Groningen	The website Julia's Groningen offers online the possibility to order meals and drinks in Groningen.	Sandwiches & Salads → Salads ¹³³	pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
julias-utrecht.nl	Julia's Utrecht	Julia's Utrecht is an online platform where customers can order food from Utrecht.	Online Services → Ordering ¹²¹	beverage ⁵⁸⁶ pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
kaassloep.nl	The KaasSloep	The KaasSloep is a canal tour company in Alkmaar that offers exclusive tours for small groups.	Water Recreation → Canal Tours ¹⁰⁶ Planning → Tours ⁸⁷⁰	canal tour ⁹⁹ skipper ¹⁵⁶ tours ¹⁰⁴⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Alkmaar ⁶⁵⁰⁷
karanfoodservice-alphenaandenrijn.nl	Karan's Foodservice	The website of Karan's Foodservice provides the option to order food online from Alphen aan Den Rijn.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
kcchicken-nijmegen.nl	Zekeriya Cicek Weezenhof	The website Zekeriya Cicek Weezenhof is an online ordering platform for dishes from the restaurant in Nijmegen. Visitors can view the menu and order their favorite dishes directly online.	Fast Food → Burger Restaurants ³⁴⁶ Pastries & Baked Goods → Menus ²²³	chicken ⁹⁴⁴ meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Nijmegen ⁹³⁸⁴
kekou-wokgerechtengroningen.nl	Kekou	The website Kekou in Groningen offers an online ordering service for food, featuring an extensive menu and the ability to order dishes such as bowls, noodles, snacks and drinks online.	Food Delivery → Delivery ²²²⁷ Food Delivery → Asian ²⁷²³	noodles ¹⁹¹ bowl ⁴⁸² soup ¹⁰⁴³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
kingsofwok-denbosch.nl	Kings of Wok	The website of Kings of Wok offers an online ordering system for ordering wok dishes, snacks, desserts, and drinks from the location in Den Bosch.	Food Delivery → Asian ²⁷²³ Chocolate & Sweets → Ice Cream ⁷⁷⁴	wok dish ⁶⁶ top ³⁷⁷ dessert ⁴⁹⁶ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
kitchensusan-denhaag.nl	Kitchen Susan	The Kitchen Susan website offers online ordering of a variety of dishes in The Hague, including nasi and bami, roti's, soups, and sandwiches.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
kivodeventer.nl	Kivo versvlees	The website of Kivo versvlees in Deventer offers natural food for dogs, including raw meat, dry food, and snacks.	Pet Food → Dog Food ³²¹	dry food ¹³ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³	Overijssel → Deventer ⁴⁷⁵¹
kleininwijn.nl	Klein in Wijn	The Klein in Wijn website offers wine tasting experiences, enabling customers to sample various wines and enjoy a pleasant afternoon or evening. The website facilitates the organization of both home and corporate events with customized wine packages.	Wine → Wine Tasting ⁷³⁰	wine package ⁴⁷ coziness ²³⁵ wine tasting ²³⁸ taste ⁹³³ snack ²⁹¹⁶ wine ⁴⁴⁷⁶
konditoreinoor-lelystad.nl	Konditorei Noor	Konditorei Noor is an online ordering platform for dishes, salads, pastries, snacks, and other treats in Lelystad.	Pastry → Cakes ⁸²⁶ Quick Bites → Cafeteria ⁹⁰⁶	carpaccio ⁴⁷ cake ¹⁷³⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶	Flevoland → Lelystad ³¹⁸⁰
krish-rotiwinkel.nl	Krish Rotiwinkel	Krish Rotiwinkel is an online ordering service for meals from Amersfoort, offering various types of roti, rice dishes, and sandwiches.	Food Delivery → Delivery ²²²⁷ Food Delivery → Indonesian ⁵⁰²	roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Utrecht → Amersfoort ⁸⁰¹¹
ksp-kiosksportparkhilversum.nl	KSP-kiosk sportpark	The website KSP-kiosk sportpark in Hilversum allows users to order food online from a varied menu of snacks, sandwiches, Turkish dishes and beverages.	Quick Bites → Hair Salon ¹¹² Sport Facility → Sports Parks ⁵⁷	kebab ²⁷⁶ burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
kusvandekok.nl	Kus van de Kok	Kus van de Kok is a catering company specializing in small-scale, vegetarian snacks and meals.	Cooking & Recipes → Cooking Classes ²⁹² Services → Personal Services ¹⁰⁶²	organic ⁴⁷¹ cooking ⁸⁰¹ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶
kwalitaria-boxtel.nl	Kwalitaria Strik	The website Kwalitaria Strik from Boxtel offers online ordering of meals, snacks, and drinks with an extensive menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ meal ¹⁶³⁸ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Boxtel ¹¹⁵⁴
kwalitariadronten.nl	Kwalitaria Dronten	The website Kwalitaria Dronten offers online ordering of meals and snacks from the restaurant in Dronten.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Quick Bites → Snack Bar ⁵⁸⁰	croquette ¹³⁶ burger ¹⁴³¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Flevoland → Dronten ¹⁶⁶⁷
kyriakos.nl	Kyriakos Scheemda	The website of Kyriakos in Scheemda allows online ordering of grill dishes, snacks, and other products, with options for delivery or pickup. The site also offers a newsletter for discounts and promotions and a points reward system.	Fast Food → Grill Restaurant ¹²⁹ Web → Websites ²⁰²⁸	grill plate ¹⁶ wrap ⁸²⁶ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Oldambt → Scheemda ¹⁶⁵
la-bamba-zwolle.nl	La Bamba Zwolle	La Bamba Zwolle is an online ordering platform for food in Zwolle, where customers can order their favorite snacks, fries, and drinks and have them delivered.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Cafeteria ⁹⁰⁶	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
lafresh-leiden.nl	La Fresh	The website La Fresh, located in Leiden, offers the possibility to order meals online, with a particular focus on family meals and various snacks and fries.	Fast Food → Fries ⁹⁴⁹	loaded fries ⁴¹ croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶	South-Holland → Leiden ⁷⁰⁸⁹
lasosta.nl	La Sosta Odijk	The website La Sosta Odijk offers an online ordering system for food from the restaurant La Sosta in Odijk. Visitors can view the menu and place their order online.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Pastries & Baked Goods → Menus ²²³	appetizer ⁵⁵⁶ pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Bunnik → Odijk ²³²
lastvegasutrecht.nl	Last Vegas	The website Last Vegas in Utrecht offers the possibility to order meals online, including fries, burgers, and various snacks.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
lecentro-waalwijk.nl	Le Centro	Le Centro is an online ordering platform that delivers food from Waalwijk.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Turkish Cuisine → Fast Food ³²²²	loaded fries ⁴¹ hamburger ³⁶⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	North-Brabant → Waalwijk ¹⁷⁴⁴
lekkerrr-restaurant.nl	Cafetaria Lekkerrr033	Cafetaria Lekkerrr033 is an online ordering platform for food in Amersfoort.	Quick Bites → Cafeteria ⁹⁰⁶	schnitzel ⁶¹ satay ³²⁰ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶	Utrecht → Amersfoort ⁸⁰¹¹
leudalpetfood.nl	Leudal Petfood	Leudal Petfood is a local specialist offering pet food and accessories for dogs in the Leudal municipality.	Pet Food → Dog Food ³²¹	pickup ⁷³⁶ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ brand ¹⁷⁷³⁷	Limburg → Leudal ¹⁰⁴⁸
lichtavond-thuis.nl	Licht Avond Thuis	The website Licht Avond Thuis offers a service where local entrepreneurs deliver meals, snacks, and drinks for a cozy evening of eating and drinking at home.	Nutrition → Healthy Eating ⁶³⁴ Catering & Ready Meals → Takeaway ⁴⁰⁹	time ⁹³² payment ¹³⁸⁹ meal ¹⁶³⁸ snack ²⁹¹⁶ order ⁶⁹¹²	Vijfheerenlanden → Ameide ⁹⁷
lotsoffood.nl	Lots of Food	The website of Lots of Food provides catering services, nutritional coaching, cooking advice and event planning, with a focus on tasty, healthy and local food.	Cooking & Recipes → Cooking Classes ²⁹² Medical Care & Services → Nutrition ⁵⁷⁹⁹	cooking ⁸⁰¹ snack ²⁹¹⁶ nutrition ⁴⁹³⁵ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Tilburg → Berkel-Enschot ⁴¹²
loveloempia-ijsselstein.nl	LoveLoempia Overtoom	LoveLoempia Overtoom is an online platform where customers in IJsselstein can order loempia's, snacks, and drinks for pickup or delivery.	Food Delivery → Delivery ²²²⁷ Food Delivery → Asian ²⁷²³	vegetarian ³³⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → IJsselstein ¹¹⁰⁷
ludeva.nl	Snackbar Ludeva	The website of Snackbar Ludeva in Gorinchem offers the possibility to order online and have food delivered. The platform features a menu with a variety of fries, snacks, sandwiches and drinks, and promotes a loyalty program.	Quick Bites → Snack Bar ⁵⁸⁰	loyalty program ⁷⁸ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Gorinchem ¹⁹⁴⁷
lunch-hoek-amsterdam.nl	Lunch Hoek	The Lunch Hoek website is an online platform where visitors can order meals from Amsterdam, including sandwiches, hot sandwiches, paninis, snacks, and burgers.	Fast Food → Burger Restaurants ³⁴⁶	panini ¹⁵⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
lunchborrel-amersfoort.nl	Lunch & borrel	The Lunch & borrel website offers online ordering of a variety of sandwiches, flatbreads, snacks, and fries from Amersfoort.	Food & Beverage → Franchising ²⁵⁴ Quick Bites → Snack Bar ⁵⁸⁰	flatbread ¹⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
lunchroompizzeriajimmy-arnhem.nl	Lunchroom Pizzeria Jimmy	The website Lunchroom Pizzeria Jimmy offers online ordering for meals in Arnhem. It presents a menu with various options, including pizzas, fries, sandwiches and snacks.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
lunchroomsnackbardeboei-amsterdam.nl	Lunchroom Snackbar De Boei	The website Lunchroom Snackbar De Boei in Amsterdam offers an online ordering system for a wide range of dishes, including meals, fries, snacks and drinks. Visitors can easily order their favorite meals and enjoy a quick meal.	International Cuisine → Middle Eastern Cuisine ⁷² International → Turkish ⁴¹⁶	kebab ²⁷⁶ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
lunchroomspiespetitrestaurant-driel.nl	Lunchroom Spies Petit Restaurant	The website of Lunchroom Spies Petit Restaurant in Driel offers online ordering options for a wide range of dishes, including fries, soups, snacks and entrees.	Cafeteria → Dutch Cafeteria ¹²² Turkish Cuisine → Fast Food ³²²²	entree ¹⁵ croquette ¹³⁶ soup ¹⁰⁴³ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Overbetuwe → Driel ¹⁵⁹
lunchroomtschouwtje-haarlem.nl	Lunchroom 't Schouwtje	The website of Lunchroom 't Schouwtje in Haarlem offers the possibility to view menus online and order dishes. It is a lunchroom with a diverse menu.	Lunch → Sandwiches ⁴⁶⁶ Quick Bites → Cafeteria ⁹⁰⁶	croquettes ¹⁰⁸ menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
madamejeanetterotterdam.nl	Madame Jeanette Rotterdam	The website Madame Jeanette Rotterdam offers online ordering for a variety of dishes, including sandwiches, snacks, soups, and dishes from Surinamese, Indonesian, Chinese, and Caribbean cuisine.	Food Delivery → Indonesian ⁵⁰² Activities → Dining Out ¹⁸¹	nasi ²⁴² soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
magdyplaza.nl	Magdy Snacks	The website of Magdy Snacks in Sint-Oedenrode offers an online ordering option for various snacks, including fries, pizzas, sandwiches, and vegetarian options, with the possibility of delivery or takeaway.	Fast Food → Burgers ⁶⁸⁷	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Meierijstad → Sint-Oedenrode ⁶³²
magdysnacks.nl	Magdy Snacks	The Magdy Snacks website allows customers to order meals online from the restaurant Magdy Snacks in Sint-Oedenrode. The website displays a menu with various snacks, sandwiches, pizzas, and other dishes.	Pastries & Baked Goods → Menus ²²³ Catering & Ready Meals → Takeaway ⁴⁰⁹	croquette ¹³⁶ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Meierijstad → Sint-Oedenrode ⁶³²
maggastaste-almere.nl	Magga's Taste	Magga's Taste is an online ordering platform for food in Lisse, offering a diverse menu of sandwiches, hot dishes, fish dishes, snacks, and beverages.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	fish dishes ⁴⁷ nasi ²⁴² beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Lisse ¹⁰⁸⁹
maliwanfood-zaandam.nl	Maliwan Food	The website of Maliwan Food, based in Zaandam, offers the possibility to order food online. Visitors can view the menu and order their favorite dishes online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	roll ³⁵⁸ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Zaanstad → Zaandam ²⁷⁴⁰
mamathai-rotterdam.nl	Madame Thai Street Food	The website of Madame Thai Street Food offers an online ordering system for Thai street food from Rotterdam, where visitors can view the menu and have meals delivered to their homes.	Asian → Thai ³⁰¹	thai ⁸⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
manmetbrilkoffietruck.nl	Man Met Bril Koffie	The website promotes a mobile coffee truck, ‘Man Met Koffie Truck,’ offering coffee, snacks, and event catering.	Event Styling & Decoration → Event Equipment ⁷⁷⁵ Driving & Lessons → Vehicles ⁵⁴¹	barista ¹⁴⁶ truck ¹⁴¹² snack ²⁹¹⁶ coffee ³⁸³⁸ event ⁴⁵¹⁹⁹
marcoskaasspecialiteiten.nl	Marco’s Kaasspecialiteiten	The website of Marco’s Kaasspecialiteiten is an online shop and information source for a local cheese merchant who delivers a wide assortment of cheese, snacks, juices, and sausage at home in the Zwolle region.	Dairy → Cheese ⁵³⁰	juice ²⁰⁷ sausage ²⁵⁶ cheese ¹²⁰⁵ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Overijssel → Zwolle ⁷³⁹⁵
maruaidasnacks.nl	Maruaida Snacks Den Helder	The website of Maruaida Snacks Den Helder offers an online ordering system for various snacks, fries, burgers, and other dishes, with the possibility of delivery.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Holland → Den Helder ¹⁸⁸⁶
maxi-foodtilburg.nl	Maxi Food Tilburg	The website of Maxi Food Tilburg offers the possibility to order food online from the restaurant in Tilburg. The menu is available online, including various dishes such as plates, sandwiches, pizzas and snacks.	Food Delivery → Delivery ²²²⁷ Turkish Cuisine → Fast Food ³²²²	pita ¹⁹⁹ shoarma ²⁵⁴ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Tilburg ⁸⁷⁵⁹
mcdonaldszwollecentrum-zwolle.nl	McDonald's Zwolle Centrum	The website of McDonald's Zwolle Centrum offers the possibility to order meals online. Visitors can view the menu and order their favorite dishes directly online for delivery or pickup.	Fast Food → McDonald’s ¹² Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
meatandtreats.nl	Meat & Treats	The Meat & Treats website offers natural snacks and trainers for dogs and cats, emphasizing quality ingredients and the avoidance of artificial additives.	Sandwiches & Salads → Snacks ⁶⁹³	wholesale ²⁸⁰ fish ¹¹²¹ trainer ¹⁹⁶⁶ meat ²⁰⁵⁵ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	Woensdrecht → Hoogerheide ²⁶⁸
melan-enschede.nl	Melan	The Melan website in Enschede offers the possibility to order food online from an extensive menu including sandwiches, toasties, snacks, and paninis.	Cafes & Lunch → Lunch Spots ²³⁷ Sandwiches & Salads → Sandwich Shops ²²⁹	toastie ⁴⁵ panini ¹⁵⁶ ingredients ²³⁴⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
memevietnamesefood-rotterdam.nl	MeMe Vietnamese Food	The MeMe Vietnamese Food website offers online ordering for Vietnamese dishes from Rotterdam. Visitors can view the menu and directly order their favorite meals online.	Asian → Vietnamese ¹²⁴ Cuisine → Vegetarian ⁶⁹⁷	spring rolls ¹⁴¹ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
michels-american-diner.nl	Michel's American Diner	The website of Michel's American Diner in Steenwijk offers online ordering of American dishes and snacks.	Grilling & Steaks → American ⁸⁵	plate ⁷⁸⁷ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Steenwijkerland → Steenwijk ⁸⁷⁶
midnight-roti-vuursteen.nl	Midnight Roti Shop-Ypenburg	The Midnight Roti Shop-Ypenburg website in The Hague offers the possibility to order meals online, including roti dishes, roti rolls and nasi-and bami dishes.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	nasi ²⁴² roti ³⁰³ roll ³⁵⁸ snack ²⁹¹⁶ dish ⁵⁹³⁶	The Hague → Leidschenveen-Ypenburg ³⁹⁵
mini-market-amersfoort.nl	Mini Market Amersfoort	The website Mini Market Amersfoort offers online ordering of meals and drinks, specializing in Syrian snacks and other snacks and beverages.	Catering & Ready Meals → Takeaway ⁴⁰⁹	cheese ¹²⁰⁵ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Amersfoort ⁸⁰¹¹
miss-temaki-eindhoven.nl	Miss Temaki Strijp S.	Miss Temaki Strijp S. is an online restaurant in Eindhoven where customers can order meals and sushi.	Japanese → Sushi ⁹⁷¹	poké bowl ¹⁶⁹ meal ¹⁶³⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
mistersnack-kaatsheuvel.nl	Mistersnack	The Mistersnack website allows customers to order meals online in Kaatsheuvel. It features an extensive menu with a variety of dishes and snacks.	Fast Food → Burger Restaurants ³⁴⁶	entree ¹⁵ milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Loon op Zand → Kaatsheuvel ⁶⁸⁸
moksitandoori-utrecht.nl	Moksi & Tandoori	The Moksi & Tandoori website is an online platform where customers in Utrecht can order meals, including rotis, meals, snacks, and drinks.	Food Delivery → Indonesian ⁵⁰²	roti ³⁰³ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
morefoodshop.nl	Deegmeesters Voorthuizen	The Deegmeesters Voorthuizen website is an online platform where customers can order pizzas, snacks, and bread. The website also provides information and reviews.	Food Delivery → Italian Restaurant ¹⁰⁴⁰	points ⁶¹² bread ¹⁶²² snack ²⁹¹⁶ reviews ³¹⁷² pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶
moskitchen-hoofddorp.nl	Mo's Kitchen	Mo's Kitchen is an online restaurant in Hoofddorp where customers can order and have food delivered.	Food Delivery → Surinamese ²⁶⁵	bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ satay ³²⁰ burger ¹⁴³¹ snack ²⁹¹⁶	Haarlemmermeer → Hoofddorp ²⁷³⁹
moyicafetariasushimeer-mijdrecht.nl	MoYi	MoYi is an online platform allowing customers in Mijdrecht to order food from the restaurant.	Japanese → Sushi ⁹⁷¹	maki ¹⁶⁹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	De Ronde Venen → Mijdrecht ⁷⁰⁰
mrdoner-nijmegen.nl	Mr. Döner Nijmegen	This website allows users to place online orders for Mr. Döner in Nijmegen, offering a wide range of dishes, including fries, snacks, plates, and sandwiches.	Fast Food → Fries ⁹⁴⁹ International → Turkish ⁴¹⁶	döner ⁶⁷³ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Nijmegen ⁹³⁸⁴
multifrietede.nl	Multifriet Ede	The Multifriet Ede website is an online platform for ordering fries, snacks, and sandwiches for delivery or takeaway.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶
nachtwinkel-helmond.nl	Nachtwinkel Helmond	Nachtwinkel Helmond is a 24/7 convenience store delivering various products, such as beverages, snacks, and household items, to customers' doors.	Food Delivery → Delivery ²²²⁷	beverage ⁵⁸⁶ guest ¹³³⁴ snack ²⁹¹⁶ assortment ⁷⁷⁹⁹	North-Brabant → Helmond ³⁰⁵⁸
niceteadelft.nl	Nice Tea Delft	The Nice Tea Delft website provides an online ordering system for bubble tea, various tea options, and other dishes, including Japanese snacks and traditional Chinese cuisine.	Tea → Bubble Tea ³¹	bubble tea ¹⁵³ tea ¹¹⁴⁶ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶
nieuw-donerhuis-oranje-oostvoorne.nl	Nieuw Donerhuis Oranje	Nieuw Donerhuis Oranje is an online ordering platform for Turkish and Turkish-inspired dishes in Oostvoorne.	Fast Food → Döner ²³⁸ Fast Food → Fries ⁹⁴⁹	doner ¹³¹ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Voorne aan Zee → Oostvoorne ²⁶⁰
nikapetfood.nl	NiKaPetfood.nl	NiKaPetfood.nl is an online store that offers natural dog and cat food, snacks, and supplements.	Pet Food → Dog Food ³²¹	cat food ⁹⁸ dog food ²⁰⁴ supplement ¹⁹⁶⁸ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷²
nikoscorner.nl	Nikos Corner Groningen	The website of Nikos Corner Groningen is an online platform where customers can order burgers and other snacks for delivery or pickup.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ snack ²⁹¹⁶ drink ⁵¹⁹¹ price ⁸³²⁸ menu ¹³⁸⁵⁶	Netherlands → Groningen ²³⁷³⁴
nishes-place-utrecht.nl	Nishe's Place	The website Nishe's Place offers the possibility to order food online from Utrecht, specializing in various Roti dishes, Nasi & Bami, Rice dishes and various snacks and extras.	Food Delivery → Indonesian ⁵⁰²	bara ²² nasi ²⁴² roti ³⁰³ rice ⁶³⁵ soup ¹⁰⁴³ snack ²⁹¹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
njam-njam-lommel.nl	Njam Njam	The website Njam Njam is an online platform that allows customers in Lommel to order food from the restaurant. It offers a menu with various sandwiches, snacks, and salads, and the possibility to order them online for delivery or pickup.	Fast Food → Burgers ⁶⁸⁷	burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶
nyan-switi-utrecht.nl	Nyan Switi Amsterdamsestraatweg	Nyan Switi Amsterdamsestraatweg is a website where visitors can order dishes from the restaurant in Utrecht online.	Food Delivery → Indonesian ⁵⁰² Catering & Ready Meals → Takeaway ⁴⁰⁹	vegetarian dishes ³⁴ roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
odelices-enschede.nl	O'delices	The O'delices website is an online platform where customers in Enschede can order food from the restaurant for delivery.	Online Ordering → Delivery Restaurants ⁷²	chicken satay ²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
old-inn-amsterdam-in-almere.nl	Old Inn Amsterdam in Almere	The Old Inn Amsterdam in Almere website offers online ordering options for meals, including appetizers, lunch items, main courses, fries, sandwiches, and snacks. The menu is detailed and provides a wide range of options.	Pastries & Baked Goods → Menus ²²³ Specialty Foods → Outdoor ¹⁷	fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
omai-amsterdam.nl	Ô MAI	The website Ô mai offers online ordering of Vietnamese dishes from Amsterdam.	Asian → Vietnamese ¹²⁴ Food Delivery → Delivery ²²²⁷	spring rolls ¹⁴¹ salad ²⁴⁴⁴ snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
ontbijtenlunch-enjoy.nl	Ontbijt & Lunch bezorgservice Enjoy	The website of Ontbijt & Lunch bezorgservice offers the delivery of breakfast items and snack platters in various locations.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	breakfast ¹⁸²² snack ²⁹¹⁶ kitchen ⁶⁴⁴³ price ⁸³²⁸	Emmen → Klazienaveen ²⁹⁷
oostwaloss.nl	Oostwal	The website Oostwal offers online ordering for food and drinks in Oss. Visitors can view a menu and order dishes directly online, including pizzas, döner kebabs, and various snacks and desserts.	Fast Food → Döner ²³⁸ Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Brabant → Oss ²⁹⁶²
operagrillroom-roosendaal.nl	Opera Grillroom Roosendaal	The website Opera Grillroom Roosendaal provides the ability to order meals online from the restaurant's menu in Roosendaal.	International → Middle Eastern ¹¹⁶ Food Delivery → Delivery ²²²⁷	appetizer ⁵⁵⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Brabant → Roosendaal ²⁶⁷⁷
optimal-group.nl	Optimal Group	Optimal Group operates a diverse portfolio of brands focused on product realization and consumer goods, including pet products, nutritional supplements, and clothing.	E-Commerce → Pet Supplies ¹⁰¹³	underwear ²⁸¹ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² design ²⁷²⁰²
oranjekebabgrill-tilburg.nl	Oranje Kebab & Grill Tilburg	The website Oranje Kebab & Grill Tilburg offers the possibility to order food online, including kebab-based meals, sandwiches, Turkish pizzas, durum wraps, and various snacks.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	kebab ²⁷⁶ kapsalon ⁵⁰⁹ wrap ⁸²⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Tilburg ⁸⁷⁵⁹
orientalfastfoodshi-spijkenisse.nl	Oriëntal Fastfood Shi Spijkenisse	The website of Oriëntal Fastfood Shi Spijkenisse offers the possibility to order food online from their menu, with a focus on Surinamese and Asian fast food dishes.	Food Delivery → Delivery ²²²⁷ Food Delivery → Indonesian ⁵⁰²	soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Nissewaard → Spijkenisse ¹⁴³³
orientaria.nl	Oriëntaria/Dragon city	The website describes the businesses Oriëntaria and Dragon City, two takeaway restaurants in Beuningen that combine an Eastern takeaway and a cafeteria under one roof.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	takeaway ⁶⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵	Gelderland → Beuningen ⁸⁸³
originals-amsterdam.nl	ORIGINALS	The Originals website based in Amsterdam offers the possibility to order Asian dishes online, including buns, wraps, woks, and various snacks.	Food Delivery → Asian ²⁷²³ Sandwiches & Salads → Snacks ⁶⁹³	bun ²⁷ wok ²³¹ wrap ⁸²⁶ snack ²⁹¹⁶	North-Holland → Amsterdam ⁴¹²⁵³
pad-thai-ferdinand-bolstraat-amsterdam.nl	Pad Thai Ferdinand Bolstraat	The website of Pad Thai Ferdinand Bolstraat in Amsterdam offers the possibility to view menus online and order dishes.	Asian → Thai ³⁰¹	pad thai ³¹ curry ³⁵⁵ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
pancks.nl	Pancks!	The website of Pancks! presents the concept of a vegetable snack for children, aiming to increase vegetable consumption.	Healthy & Dietary → Children’s Food ¹⁰ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	spices ³⁴⁰ vegetables ¹⁴¹⁶ snack ²⁹¹⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
panos-langebrugstraat-breda.nl	Panos Breda	The website of Panos Breda from Breda offers the possibility to order meals online, including sandwiches, wraps, and various boxes with snacks and drinks.	Bakery & Food Production → Bread ⁷⁶⁵ Turkish Cuisine → Fast Food ³²²²	wrap ⁸²⁶ bread ¹⁶²² box ¹⁹⁸² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Breda ⁹⁰⁰³
panpizzaman.nl	Pan Pizza Man	The website Pan Pizza Man from Enschede offers the possibility to order pizza, pasta, snacks and drinks online for delivery.	Mexican & South American → Mexican ¹⁵¹	burrito ⁶² pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Overijssel → Enschede ⁵⁵⁵⁴
paramariboleeuwarden.nl	Paramaribo Leeuwarden	The Paramaribo Leeuwarden website is an online platform where customers can order Surinamese specialties and pay online. Orders are delivered quickly to the customer's doorstep.	Food Delivery → Surinamese ²⁶⁵	bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
partypan-leeuwarden.nl	Partypan	Partypan is an online ordering service in Leeuwarden, focused on providing snacks, sandwiches, and meals.	Quick Bites → Snack Bar ⁵⁸⁰ Mediterranean & Middle Eastern → Takeout ²⁸⁶	mystery box ⁴⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Friesland → Leeuwarden ⁶⁰⁶⁸
pashaeetpaleis-rotterdam.nl	Pasha Eet Paleis	The Pasha Eet Paleis website allows customers to order meals online in Rotterdam, featuring a diverse menu of Turkish and international dishes.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	doner ¹³¹ burger ¹⁴³¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
pastardopastabar-terneuzen.nl	Pastardo Pastabar	The website Pastardo Pastabar in Terneuzen offers an online ordering system for a wide range of dishes, including pasta, nachos, snacks, desserts, and drinks.	Sandwiches & Salads → Snacks ⁶⁹³ Mexican & South American → Mexican ¹⁵¹	nachos ³⁵ dessert ⁴⁹⁶ pasta ¹³⁸⁹ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Zeeland → Terneuzen ¹⁵¹⁷
patatzaak-hessesnack-rotterdam.nl	Patatzaak Hessesnack	The website Patatzaak Hessesnack from Rotterdam offers an online ordering system for a wide range of snacks, hamburgers, sandwiches, and beverages.	Fast Food → Fries ⁹⁴⁹	patat ²¹ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
patosasafrikaanseshoptokonijmegen.nl	Patosas Afrikaanse Shop & Toko	The website Patosas Afrikaanse Shop & Toko offers the possibility to order African dishes, such as rice dishes, fufu dishes and vegetarian options, online in Nijmegen.	Food → Restaurants & Dining ²⁷³²⁵	rice dishes ⁷⁶ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	Gelderland → Nijmegen ⁹³⁸⁴
paviljoenbymmf.nl	Het Paviljoen by Man with Fries	Het Paviljoen by Man with Fries is a snack bar in Rotterdam-North that serves traditional and high-quality french fries and other snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	patat ²¹ artisan ⁹⁴ potato ⁵⁴² supplier ¹⁷²⁵ fries ²⁷⁵³ snack ²⁹¹⁶	Rotterdam → Hillegersberg-Schiebroek ⁴⁰⁴
petgigant.nl	PetGigant	PetGigant is a natural food store specializing in healthy and natural snacks, dog and cat food, (frozen) fresh meat, supplements, and grooming products for pets.	Pets → Cats ⁶³⁹ Pet Food → Dog Food ³²¹	cat food ⁹⁸ dog food ²⁰⁴ supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² assortment ⁷⁷⁹⁹	Laarbeek → Lieshout ¹⁶⁵
petplein.nl	PetPlein	PetPlein.nl is an online store that sells pet food, care products, and accessories for dogs, cats, birds, and small rodents.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	collar ²⁴² toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ care ¹²³³⁸
petsgreenbusiness.nl	Gebr. de Boon Groothandel in dierbenodigdheden	The website Pets & Green Business showcases news, advertisements, and products related to pet supplies and sustainable gardening products.	E-Commerce → Pet Supplies ¹⁰¹³ Animal Care → Cat Care ¹³²	scratching post ³⁷ pet supplies ¹¹⁰ grooming ⁸⁹⁶ snack ²⁹¹⁶ flowers ³²⁴⁸
phuketsnack.nl	Sumalee Songkun	The website is an online platform of Sumalee Songkun offering traditional Thai food from Phuket, aiming to transport the feeling of Phuket to her customers in Den Helder.	Asian → Thai ³⁰¹ Southeast Asia → Thailand ¹²³	thai cuisine ¹¹⁰ snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Den Helder ¹⁸⁸⁶
picobellocatering.nl	Picobello Catering	The website of Picobello Catering presents a catering service that caters to various events, such as parties, events and corporate events, offering a wide range of buffets and snacks.	Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	takeaway meals ¹¹ snack platter ¹⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Roermond → Herten ¹³³
pieperz-eerde-veghel.nl	Pieperz Eerde	The website Pieperz Eerde offers an online ordering system for meals and snacks in Veghel. Customers can view the menu and place their order online here.	Fast Food → Chicken Dishes ⁹²	chicken ⁹⁴⁴ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Meierijstad → Veghel ¹²⁸⁸
pieperz-veghel.nl	Pieperz Veghel	The website of Pieperz Veghel offers the possibility to order meals online from the restaurant's extensive menu located in Veghel.	Fast Food → Fries ⁹⁴⁹ Fast Food → Chicken Dishes ⁹²	chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Meierijstad → Veghel ¹²⁸⁸
pierre-zwijndrecht.nl	Grandtaria Pierre	The website of Grandtaria Pierre in Zwijndrecht offers the possibility to order burgers, snacks, and other meals online for home delivery. The platform also includes a menu, reviews, and a newsletter signup option.	Cafeteria → Dutch Cafeteria ¹²²	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Zwijndrecht ¹⁴⁵⁵
pinoytoko.nl	PinoyToko	PinoyToko.nl is an online store specializing in Filipino products, primarily serving customers in Europe.	Turkish Cuisine → International ¹²⁰⁷	frozen products ¹⁶ dessert ⁴⁹⁶ sauce ¹¹⁴¹ snack ²⁹¹⁶ ship ⁵¹⁰³
pizza-shoarma-julianaweg-s-gravenzande.nl	Pizza & Shoarma Julianaweg	The website Pizza & Shoarma Julianaweg from 's-Gravenzande offers online ordering of pizzas, shoarma, and other dishes.	International → Middle Eastern ¹¹⁶ Delivery → Online Delivery ²⁷	shoarma ²⁵⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Westland → 's-Gravenzande ⁵⁹⁹
pizzaking-gronau.nl	Pizza King Gronau	The Pizza King Gronau website allows customers to order pizzas, sandwiches, and other dishes online in the city of Gronau.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	top ³⁷⁷ döner ⁶⁷³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶
pizzaplazahoogezand.nl	Pizza Plaza	Pizza Plaza is an online shop based in Hoogezand where customers can order pizzas, sandwiches, snacks, and other dishes for home delivery.	Catering & Ready Meals → Indonesian Restaurant ³⁹²	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶	Midden-Groningen → Hoogezand ⁶²⁹
pizzariadelal.nl	Pizzeria Delal	The website of Pizzeria Delal in Tolkamer offers online ordering, home delivery, and takeaway options for a wide range of pizzas, snacks, and drinks.	Food Delivery → Italian Restaurant ¹⁰⁴⁰	savings ⁴⁵⁷ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Zevenaar → Tolkamer ¹²⁷
pizzeria-le-nora-hollandscheveld.nl	Pizzeria Le Nora	The website of Pizzeria Le Nora in Hollandscheveld offers online ordering of pizzas, appetizers, snacks, and other dishes, with an accessible menu and reviews.	Online Services → Ordering ¹²¹	appetizer ⁵⁵⁶ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Hoogeveen → Hollandscheveld ¹⁵⁴
pizzeriaromy-hengelo.nl	Pizzeria Romy	The Pizzeria Romy website in Hengelo offers the possibility to order food online, including a menu with pizzas, salads, side dishes, and other accompaniments.	Grilling & Steaks → Grillroom ⁸⁷	salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
plaza-de-tol.nl	Cafetaria de Tol	Cafetaria de Tol is an online ordering platform for food in Tiel, allowing customers to easily order their favorite dishes online and have them delivered.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
plazadeheikant.nl	Plaza de Heikant Veldhoven	The website of Plaza de Heikant Veldhoven is an online platform where visitors can order snacks, grill items and other products. It offers a simple online ordering procedure with the possibility to pay and download an app for faster orders.	Fast Food → Burgers ⁶⁸⁷ Quick Bites → Snack Bar ⁵⁸⁰	snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Veldhoven ¹⁴⁸⁵
plazastadskanaal-stadskanaal.nl	Plaza Stadskanaal	The Plaza Stadskanaal website offers an online ordering service for food and drinks in Stadskanaal, featuring a comprehensive menu and the ability to order meals online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	vegetarian ³³⁷ sauce ¹¹⁴¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Groningen → Stadskanaal ¹⁰⁵⁴
plienproeft.nl	Pauline	Plien Proeft is a cooking blog dedicated to sharing simple and delicious recipes for a wide audience.	Blogs → Food Blogs ²⁴⁶ Cooking & Recipes → Breakfast ⁴⁵	rice dishes ⁷⁶ italian ³²⁰ smoothie ³⁸⁴ snack ²⁹¹⁶ reviews ³¹⁷² recipe ⁵¹⁴²
poesaka-malaccadenhaag.nl	Poesaka-Malacca	The website Poesaka-Malacca offers online ordering for Indonesian dishes and rice tables from The Hague.	Food Delivery → Indonesian ⁵⁰²	peanut sauce ²⁵ rice table ²⁷⁷ rice ⁶³⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
princenhofbreda.nl	Princenhof Breda	The website of cafetaria/restaurant Princenhof in Breda provides visitors with information about the menu, recent news articles, and other relevant details.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ price ⁸³²⁸ menu ¹³⁸⁵⁶ news ¹⁵²⁹³	North-Brabant → Breda ⁹⁰⁰³
proefmoekies.nl	Agape Webdesign	The website of Proef Moekies presents Caribbean specialties, including dishes, snacks, and cakes, and offers catering services for festive occasions.	Turkish Cuisine → International ¹²⁰⁷	caribbean ³³ cake ¹⁷³⁰ market ²⁷⁷² snack ²⁹¹⁶ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
pronksvisbynaat-delft.nl	Pronk's Vis By Naat	The website of Pronk's Vis By Naat offers the possibility to order food online from the fish shop in Delft.	Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Delft ⁵³⁰⁹
q-teahouse.nl	Q-Tea House Apeldoorn	Q-Tea House Apeldoorn is a website that sells online fruit tea, bubble tea, and other beverages and snacks. It offers an online ordering system and an app for faster ordering.	Beverages → Tea ⁸²⁹	bubble tea ¹⁵³ tea ¹¹⁴⁶ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Gelderland → Apeldoorn ⁶⁹⁹⁶
quality-fried-chicken-vijfhuizen.nl	Quality Fried Chicken	The Quality Fried Chicken website, located in Vijfhuizen, offers online ordering of various dishes, including chicken, burgers, snacks, and drinks.	Fast Food → Fries ⁹⁴⁹ Meat → Chicken ¹²⁷	bucket ¹¹³ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Haarlemmermeer → Vijfhuizen ²²⁶
raisheriescorner-werkendam.nl	Raisherie's Corner	The website of Raisherie's Corner offers the possibility to order food online from Werkendam. Customers can view a menu and order dishes directly online for delivery.	Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Altena → Werkendam ³⁹⁹
rattenschatten.nl	Rattenschatten	Rattenschatten is an online shop selling handmade products and supplies for (rodent) animals.	Crafts → Handmade ¹¹⁴⁷ E-Commerce → Pet Supplies ¹⁰¹³	rat ¹⁴⁰ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² house ⁸¹²¹
rawballs.nl	Rawballs	The website of Rawballs provides information about their products, specifically their ‘rawballs,’ which are positioned as healthy and natural snacks, and offers online ordering.	Wholesale → Food Products ³⁰³ Healthy Food → Snacks ²²	superfood ¹⁰³ online shop ¹³¹⁰ ingredients ²³⁴⁶ snack ²⁹¹⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
raymondsnacks.nl	Raymond Catering & Snacks	Raymond Catering & Snacks is a catering company that provides catering services for events and parties.	Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ snack ²⁹¹⁶ arrangement ³¹⁰⁴ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
rembrandtparkshop.nl	Rembrandtpark Shop Amsterdam	The Rembrandtpark Shop Amsterdam is an online store that delivers snacks, drinks, and other food items.	Sandwiches & Salads → Snacks ⁶⁹³	snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
rembrandtshoarma-gouda.nl	Rembrandt Shoarma Gouda	The website Rembrandt Shoarma Gouda offers online ordering for a wide range of shwarma, pizzas, pastas and other dishes in Gouda.	Fast Food → Shawarma ³⁰	shawarma ³³⁵ pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Gouda ³⁵²¹
restariageubeltje.nl	Restaurant 't Geubeltje Cuijk	The website of 't Geubeltje Cuijk offers the possibility to order french fries and snacks online for delivery. Additionally, Chinese dishes and sushi will be offered from April 2025.	Fast Food → Fries ⁹⁴⁹ Meal Solutions → Food Online Shops ⁸⁰	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Land van Cuijk → Cuijk ⁸³²
restariatgeubeltje-cuijk.nl	Restaria 't Geubeltje	Restaria 't Geubeltje is an online restaurant in Cuijk where customers can order and have food delivered. It offers a comprehensive menu with a variety of meals, snacks, and drinks.	Quick Bites → Online Restaurant ¹⁰⁹	kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Land van Cuijk → Cuijk ⁸³²
restariaticarotilburg.nl	Restaria Ticaro	The Restaria Ticaro website is an online platform allowing users in Tilburg to order food. It provides a digital menu and the option to have meals delivered or picked up.	Fast Food → Burger Restaurants ³⁴⁶ Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
restaurantargentina-maarssen.nl	Restaurant Argentina	Restaurant Argentina Maarssen is an online restaurant where customers can order and have food delivered online.	Mexican & South American → Mexican ¹⁵¹	charcoal grill ¹² taco ⁹² rib ¹⁹¹ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Stichtse Vecht → Maarssen ¹⁰⁵¹
restaurantselekt.nl	Selekt	The website of Restaurant Selekt in Hendrik-Ido-Ambacht offers the possibility to order and have delivered snacks, pizza and other dishes online. Additionally, there is a loyalty program for customers and a newsletter for special offers.	Cafeteria → Dutch Cafeteria ¹²²	shawarma ³³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
rhijnsnacks-utrecht.nl	Rhijnsnacks	The website Rhijnsnacks offers online ordering of food from Utrecht, with an extensive menu and various types of snacks, sandwiches, hamburgers, and dishes.	Fast Food → Fries ⁹⁴⁹ Activities → Dining Out ¹⁸¹	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸
ricardossnackcorner-deventer.nl	Ricardo's Snackcorner Deventer	Ricardo's Snackcorner Deventer is an online ordering platform for snacks, fries, sandwiches, and meals in Deventer.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	sauce ¹¹⁴¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Deventer ⁴⁷⁵¹
rolingautomatik-hilversum.nl	Roling Automatik	The Roling Automatik website is an online ordering platform for meals and snacks in Hilversum. It offers a digital menu and the ability to order dishes directly online.	Fast Food → Fries ⁹⁴⁹	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Hilversum ⁴³⁹⁷
rose-garden-ijmuiden.nl	Rose Garden / Poké Garden	The website Rose Garden / Poké Garden offers online ordering for meals and snacks in IJmuiden.	Sandwiches & Salads → Snacks ⁶⁹³ Catering & Ready Meals → Outdoor Dining ⁵⁶	bowl ⁴⁸² fries ²⁷⁵³ snack ²⁹¹⁶	Velsen → IJmuiden ¹¹⁰⁹
roti2daynieuw-vennep.nl	Roti2Day Nieuw-Vennep	The Roti2Day Nieuw-Vennep website allows customers to order meals online from the establishment in Nieuw-Vennep. The business specializes in roti dishes, nasi and bami dishes, and various Surinamese snacks and sandwiches.	Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
rotihuisje-wormer.nl	Roti Huisje	The Roti Huisje website allows customers to order food online from the Roti Huisje restaurant in Wormerveer. The menu is available online, and customers can choose from various dishes, including sandwiches, nasi, bami, and roti.	Food Delivery → Indonesian ⁵⁰² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ rice ⁶³⁵ container ¹⁷⁰⁹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Zaanstad → Wormerveer ⁵³⁰
rotishopmagdalena-groningen.nl	Rotishop Magdalena	The Rotishop Magdalena website offers online ordering for a variety of dishes, including roti, rice and nasi dishes, sandwiches and snacks, from Groningen.	Food Delivery → Indonesian ⁵⁰²	nasi ²⁴² roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Groningen ²³⁷³⁴
royalfoodcorner-weert.nl	Royal Food Corner	The Royal Food Corner website is an online ordering platform for food in Weert, where visitors can view the menu and order meals online.	International → Middle Eastern ¹¹⁶	döner ⁶⁷³ chicken ⁹⁴⁴ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Limburg → Weert ²⁰³⁰
rustemtenkateamsterdam.nl	Rustem Ten Kate	The website Rustem Ten Kate from Amsterdam provides the opportunity to order food online, including a comprehensive menu with various sandwiches, wraps, and dishes including bami and nasi, and different beverages.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Indonesian ⁵⁰²	beverage ⁵⁸⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
saen-food-rotterdam.nl	Saen Food	The website Saen Food, located in Rotterdam, offers the possibility to order food online, featuring a diverse menu including dumplings, soups, salads, snacks, main courses, side dishes, and cakes, as well as a selection of cold drinks.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	dumpling ⁴⁹ main course ¹⁰² soup ¹⁰⁴³ cake ¹⁷³⁰ salad ²⁴⁴⁴ snack ²⁹¹⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
saintgeorgegrillroom-wijchen.nl	Saint George Grillroom	The Saint George Grillroom website in Wijchen allows customers to order meals online from a diverse menu of dishes, snacks, salads, and drinks.	Fast Food → Fries ⁹⁴⁹ Grilling & Steaks → Grillroom ⁸⁷	pita bread ⁵⁰ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Gelderland → Wijchen ¹⁵⁷⁹
saintgeorgewijchen.nl	Saint George Grillroom Wijchen	The website of Saint George Grillroom Wijchen offers online ordering, delivery, and takeaway options for a variety of dishes and drinks.	Grilling & Steaks → Restaurant Type ⁵⁰ Catering & Ready Meals → Takeaway ⁴⁰⁹	durum ¹³ kapsalon ⁵⁰⁹ snack ²⁹¹⁶ drink ⁵¹⁹¹	Gelderland → Wijchen ¹⁵⁷⁹
saladingrillroompizzeria-heerlen.nl	Saladin Grillroom Pizzeria	The website Saladin Grillroom Pizzeria from Heerlen offers the possibility to order meals online, including a comprehensive menu and reviews.	Food Delivery → Delivery ²²²⁷	shawarma ³³⁵ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Limburg → Heerlen ²⁷⁵⁵
samchickenhouse-rotterdam.nl	Sam Chicken House	The website Sam Chicken House from Rotterdam offers the possibility to order meals online, including Turkish pizzas, salads, snacks, and kapsalons.	Quick Bites → Hair Salon ¹¹²	kapsalon ⁵⁰⁹ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
samenfitvending.nl	SamenFit Vending	SamenFit Vending provides specialized vending machine solutions for various locations to promote a healthier lifestyle.	Human Resources → Wellness Programs ³¹⁹ Logistics & Transportation → Vending Machines ⁶⁹	snack ²⁹¹⁶ machine ³⁷²⁷ employee ⁴⁴²⁹ health ⁶³⁶⁶	Apeldoorn → Albert Schweitzerlaan ¹⁹
samsplaceheerhugowaard.nl	Sam’s Place	The Sam’s Place website is an online ordering platform for dishes and snacks in Heerhugowaard, offering an extensive menu and the ability to place orders online.	Quick Bites → Hair Salon ¹¹²	döner ⁶⁷³ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Dijk en Waard → Heerhugowaard ²⁰¹¹
samyseetcafe-denbosch.nl	Samy's Eetcafe	Samy's Eetcafe is an online restaurant in Den Bosch that allows customers to order food and enjoy meals online.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	satay ³²⁰ steak ³³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
santamaria-diemen.nl	Santa Maria Diemen	The Santa Maria Diemen website is an online ordering platform for food in Diemen, where customers can order dishes such as sandwiches, pizzas and kebabs.	Fast Food → Döner ²³⁸ International → Turkish ⁴¹⁶	calzone ⁹⁰ kebab ²⁷⁶ sauce ¹¹⁴¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Holland → Diemen ⁹⁷⁵
saramaccafoodexpress-denhaag.nl	Saramacca Food Express	The website Saramacca Food Express facilitates online ordering of various dishes and snacks from the Saramacca Food Express restaurant in The Hague.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷ Specialty Foods → Surinamese Restaurants ²²	nasi ²⁴² soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
schnitzelkoning-ijsselstein.nl	Schnitzel Koning	The website of Schnitzel Koning IJsselstein offers the possibility to order online from a restaurant in IJsselstein.	Catering & Ready Meals → European Cuisine ⁶¹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	schnitzel ⁶¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Utrecht → IJsselstein ¹¹⁰⁷
schoon-schip-food.nl	Schoon Schip Rotterdam	The website of Schoon Schip Rotterdam is an online restaurant where customers can order snacks and meals for delivery or takeout.	Cafeteria → Dutch Cafeteria ¹²²	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
selekt-hi-ambacht.nl	Selekt	The website Selekt provides an online platform to order food from the restaurant Selekt in Hendrik-Ido-Ambacht. It displays a comprehensive menu with various Surinamese and Turkish dishes.	Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ shawarma ³³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
shenglisushisnackbar-waalwijk.nl	Sheng Li Sushi & Snackbar	The website of Sheng Li Sushi & Snackbar is an online platform where visitors can order sushi, poke bowls and other dishes from the snack bar in Waalwijk.	Japanese → Sushi ⁹⁷¹ Quick Bites → Snack Bar ⁵⁸⁰	maki ¹⁶⁹ poke bowl ³⁰⁸ burger ¹⁴³¹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Waalwijk ¹⁷⁴⁴
shibas-kwispelbox.nl	Shiba's Kwispelbox	Shiba's Kwispelbox is a website offering surprise boxes filled with products and toys for dogs.	E-Commerce → Pet Supplies ¹⁰¹³	box ¹⁹⁸² toy ²²⁹⁵ snack ²⁹¹⁶ decoration ⁴⁰⁸⁵ dog ⁵⁴⁸³
shirleys-delft.nl	Cafetaria Shirley's	Cafetaria Shirley's is an online ordering platform for food and snacks in Delft.	Mediterranean & Middle Eastern → Takeout ²⁸⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Delft ⁵³⁰⁹
shivrotiwinkel-amersfoort.nl	Shiv Roti Winkel	The Shiv Roti Winkel website allows customers to order food online, specifically Surinamese roties, rice dishes and curries, from Amersfoort.	Food Delivery → Indian Cuisine ⁵⁴³ Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ vegetarian ³³⁷ curry ³⁵⁵ rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
shoarma-ceder-roosendaal.nl	Shoarma Ceder Roosendaal	The Shoarma Ceder Roosendaal website offers the ability to place online orders for a wide range of shoarma and other dishes, such as sandwiches, snacks, plates, and kids' menus.	Fast Food → Döner ²³⁸ Fast Food → Shoarma ⁹⁰	shoarma ²⁵⁴ döner ⁶⁷³ plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Brabant → Roosendaal ²⁶⁷⁷
shop-wassenaarsnacks.nl	Wassenaar Snacks	The website shop-wassenaarsnacks.nl is an online shop offering a variety of snacks, hot meals, drinks, and kids' meals for delivery in the Wassenaar region.	Catering & Ready Meals → Takeaway ⁴⁰⁹	meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Wassenaar ¹³⁷²
shop58-amsterdam.nl	Shop 58	The website Shop 58 offers an online ordering service for dishes and drinks from Amsterdam.	Sandwiches & Salads → Snacks ⁶⁹³	snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
shutupandeat-spaubeek.nl	Shut up and eat	The website 'Shut up and eat' from Spaubeek offers an online ordering system for the restaurant's menu, allowing customers to easily and quickly order their favorite dishes online for delivery.	Turkish Cuisine → Fast Food ³²²²	dürüm ⁹⁷ menus ²²¹ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Beek → Spaubeek ⁸⁶
silverpalace-hoeven.nl	Silver Palace	The website Silver Palace offers the possibility to order meals online from Hoeven. The website displays a menu with various sushi-related dishes and snacks, and offers the possibility to order these directly.	Japanese → Sushi ⁹⁷¹	sashimi ¹⁹⁴ roll ³⁵⁸ sushi ¹⁶⁹⁵ box ¹⁹⁸² snack ²⁹¹⁶ drink ⁵¹⁹¹	Halderberge → Hoeven ¹⁹⁸
simospizzanieuwerkerkaandenijssel.nl	Simo's Pizza	The website of Simo's Pizza offers the possibility to order pizzas and various other dishes online in Nieuwerkerk aan den IJssel.	Websites → Online Ordering Services ¹⁷	calzone ⁹⁰ döner ⁶⁷³ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
sirat-restaurant-veenendaal.nl	Sirat-Restaurant	Sirat-Restaurant is a restaurant in Veenendaal that accepts online orders for a wide range of dishes, including sandwiches, döner, pizzas, and snacks.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Utrecht → Veenendaal ²⁶⁴¹
slagerij-meester-amsterdam.nl	Meester maaltijden & lunch	The website Meester maaltijden & lunch is an online platform where visitors can order meals and lunches from Amsterdam. It offers a comprehensive menu with various types of sandwiches and dishes.	Fast Food → Fries Restaurants ⁸⁷	meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
slagerijoverschie-rotterdam.nl	Slagerij Overschie	The website of Slagerij Overschie in Rotterdam offers the possibility to order food online, including grilled products, sandwiches, snacks, fries and various drinks.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Meal Solutions → Meal Boxes ⁶³	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
slagerwim.nl	Slager Wim	The website of Slager Wim in Broek op Langedijk offers various services including meat supply, catering, barbecues, and snacks for both private events and corporate outings.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Outdoor → Barbecues ⁷⁴⁴	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ meat ²⁰⁵⁵ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Dijk en Waard → Broek op Langedijk ²⁴³
smikkelhuukske.nl	Cafetaria 't Smikkelhuukske	Cafetaria 't Smikkelhuukske is a cafeteria offering fries, snacks, and portions with various side dishes and drinks, with the option for delivery or pickup.	Quick Bites → Cafeteria ⁹⁰⁶ Catering & Ready Meals → Takeaway ⁴⁰⁹	portion ³³ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹
smul-express.nl	Smul Express	The website Smul Express is an online platform that allows users in Purmerend to order meals and snacks. It offers an extensive menu with various categories, such as fries, sandwiches, hamburgers, and beverages.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Purmerend ²⁶²⁰
smulsluis.nl	Smulsluis	Cafetaria Smulsluis is a family-friendly cafe located in Vrachelen, offering quality food and friendly service.	Quick Bites → Cafeteria ⁹⁰⁶	milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶
smulwereldpeter-lemmer.nl	Snackbar Peter	The website of Snackbar Peter in Lemmer offers the possibility to order meals, snacks, and drinks online. The website also displays the menu and reviews.	Quick Bites → Snack Bar ⁵⁸⁰ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	De Fryske Marren → Lemmer ¹¹⁸⁸
snack88amsterdam.nl	SNACK 88	The Snack 88 website offers an online ordering system for dishes from Amsterdam, including fries, snacks, croquettes, and various other menu items.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	bitterballen ²² spring roll ⁸² croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackbar-azmat.nl	Snackbar Azmat	Snackbar Azmat is an online ordering platform for food in The Hague, where customers can order dishes and menus online.	Quick Bites → Snack Bar ⁵⁸⁰	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
snackbar-cascade.nl	Cascade Hoogeveen	The website of Cascade Hoogeveen offers online ordering for fries, snacks, and other dishes with delivery service in Hoogeveen.	Fast Food → Fries ⁹⁴⁹ Economy → Employment & Labor ⁶⁰⁵⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶	Drenthe → Hoogeveen ²²⁹⁴
snackbar-dedrieturven.nl	De Drie Turven	Snackbar De Drie Turven is a snack bar located in Drachten that has been serving fresh fries, snacks, and meals for decades and offers catering services.	Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Smallingerland → Drachten ²⁰⁵²
snackbar-dehaven.nl	Snackbar de Haven	The website of Snackbar de Haven in Enschede offers an online ordering system for fries and snacks with the option of home delivery and points earning.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Quick Bites → Snack Bar ⁵⁸⁰	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Overijssel → Enschede ⁵⁵⁵⁴
snackbar-heyhoef.nl	Snackbar Heyhoef Tilburg	The website of Snackbar Heyhoef Tilburg offers an online ordering option for fries, snacks, drinks, and meals. It also provides information about opening hours, the menu, reviews, and a newsletter signup.	Fast Food → Fries ⁹⁴⁹	points ⁶¹² chicken ⁹⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
snackbar-ijssalonjerommeke-veenendaal.nl	Snackbar-IJssalon Jerommeke	The website of Snackbar-IJssalon Jerommeke in Veenendaal offers the possibility to place online orders for sandwiches, fries, dishes and snacks.	Quick Bites → Snack Bar ⁵⁸⁰ Ice Cream → Ice Cream Parlors ⁵²¹	halal ¹⁶⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Utrecht → Veenendaal ²⁶⁴¹
snackbar-johan-amsterdam.nl	Snackbar Johan	The website Snackbar Johan is an online ordering platform for food and snacks in Amsterdam, allowing visitors to easily place their favorite meals online.	Fast Food → Fries ⁹⁴⁹	turkish pizza ⁶³ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackbar-maandag-utrecht.nl	Snackbar Maandag	This website allows you to order meals online from Snackbar Maandag in Utrecht. The menu with various snacks, fries and sandwiches is available online and can be ordered directly.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Netherlands → Utrecht ⁴⁸⁹⁰¹
snackbarardy.nl	Snackbar Ardy	The website of Snackbar Ardy in Almelo offers online ordering services with delivery options and a virtual menu.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	review ¹⁸⁸⁸ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Overijssel → Almelo ²⁶⁹⁶
snackbarardy-almelo.nl	Snackbar Ardy	The website of Snackbar Ardy in Almelo offers the possibility to place online orders for a variety of snacks, sandwiches, fries and drinks.	Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Almelo ²⁶⁹⁶
snackbarbarneveld.nl	Snackbar Barneveld	The website of Snackbar Barneveld presents their selection of fries and homemade snacks, along with their contact information and opening hours.	Places → City Centers ⁹² Quick Bites → Snack Bar ⁵⁸⁰	homemade ¹⁷ croquettes ¹⁰⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ assortment ⁷⁷⁹⁹	Overijssel → Kampen ²¹⁶¹
snackbarcentrale.nl	Snackbar de Centrale	The website of Snackbar de Centrale in Leeuwarden offers online ordering options for snacks, fries, and other dishes, including delivery and discount offers.	Cafeteria → Dutch Cafeteria ¹²²	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Friesland → Leeuwarden ⁶⁰⁶⁸
snackbardebakkerij.nl	Struiksma's Bakkerij	The website of Struiksma's Bakkerij is an online platform for ordering bread, snacks, and other products, with the option for home delivery or pickup in Tzummarum. It also includes a prize wheel and regular giveaways.	Car Selling & Valuation → Cars ²⁶⁹⁸ Quick Bites → Snack Bar ⁵⁸⁰	prize wheel ⁴⁰² bread ¹⁶²² snack ²⁹¹⁶ car ¹⁰⁸⁶⁵ menu ¹³⁸⁵⁶	Waadhoeke → Tzummarum ⁵⁸
snackbardebok.nl	Snackbar De Bok Kampen	Snackbar De Bok Kampen's official website offers online ordering and a menu with a variety of snacks and meals.	Fast Food → Burgers ⁶⁸⁷ Mobile & Wireless Communication → Mobile Apps ⁵³⁴	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Overijssel → Kampen ²¹⁶¹
snackbardejoker.nl	Snackbar de Joker Pijnacker	The website of Snackbar de Joker Pijnacker allows visitors to order snacks, fries and other dishes online and benefit from loyalty programs and newsletters.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
snackbardeklomp.nl	Snackbar De Klomp	Snackbar De Klomp in Bakkum is a snack bar that has been open since 1958 and is a popular meeting place for young and old, offering a wide range of snacks and fries.	Quick Bites → Snack Bar ⁵⁸⁰ Food & Dining → Outdoor Seating ²²⁸	gluten-free ¹⁵⁶ vegetarian ³³⁷ fries ²⁷⁵³ snack ²⁹¹⁶	Castricum → Bakkum ⁸⁹
snackbardelaan.nl	Snackbar de Laan	The website of Snackbar de Laan Rozenburg is an online platform that allows visitors to easily order and have burgers and snacks delivered online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶
snackbardelimbeek-eindhoven.nl	Snackbar de Limbeek	The website of Snackbar de Limbeek in Eindhoven offers the possibility to order meals online and view the menu.	Fast Food → Fries ⁹⁴⁹	milkshake ¹⁹⁵ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
snackbardepalm-rotterdam.nl	Snackbar De Palm	The website of Snackbar De Palm in Rotterdam offers online ordering for a wide range of dishes, including wraps, fries, snacks, pizzas and sandwiches.	Fast Food → Burger Restaurants ³⁴⁶ Quick Bites → Snack Bar ⁵⁸⁰	döner ⁶⁷³ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbardepoppe.nl	Snackbar de Poppe Coevorden	The website of Snackbar de Poppe Coevorden is an online platform where visitors can easily order snacks, sandwiches, and other dishes for delivery or pickup. It also offers an online menu, reviews, a newsletter signup, and a loyalty program.	Websites → Local Businesses ⁸⁵ Quick Bites → Snack Bar ⁵⁸⁰	points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² order ⁶⁹¹² menu ¹³⁸⁵⁶	Drenthe → Coevorden ¹⁴⁹²
snackbardeswartesteeghleusden.nl	Snackbar de Swartesteegh	The website of Snackbar de Swartesteegh in Leusden offers the possibility to place online orders for a variety of snacks, fries, and sandwiches.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Utrecht → Leusden ¹³⁴⁵
snackbardeveluwsejager-nunspeet.nl	Snackbar de Veluwse Jager	The website of Snackbar de Veluwse Jager allows online ordering of dishes from Nunspeet. The menu, reviews and contact information can be found on the site.	Fast Food → Fries ⁹⁴⁹	fry ⁵⁹ croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Nunspeet ¹³⁶⁶
snackbareetcafechynetberkelenrodenrijs.nl	Snackbar Eetcafe Chynet	Snackbar Eetcafe Chynet is an online ordering platform for snacks, fries, sandwiches and drinks in Berkel en Rodenrijs, allowing customers to easily order their favorite dishes online.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Lansingerland → Berkel and Rodenrijs ⁹²⁹
snackbarelhefnawyamsterdam.nl	Snackbar El Hefnawy	Snackbar El Hefnawy is an online platform where customers in Amsterdam can order dishes from their menu.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	potato ⁵⁴² ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
snackbarflorida.nl	Snackbar Florida Rotterdam	The website of Snackbar Florida Rotterdam offers an online ordering system for snacks and other dishes, with the option for home delivery and a newsletter sign-up for exclusive discounts.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family package ¹⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ newsletter ⁶⁵⁰⁴ menu ¹³⁸⁵⁶
snackbargaasperplasamsterdam.nl	Snackbar Gaasperplas	The website Snackbar Gaasperplas offers online ordering for food and drinks, focusing on fries, snacks, hamburgers and vegetarian options, located in Amsterdam.	Quick Bites → Snack Bar ⁵⁸⁰	croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
snackbargruttoutrecht.nl	Snackbar Grutto	Snackbar Grutto is a snack bar located in Utrecht that accepts online orders for a wide variety of fried potato dishes, sandwiches, and snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
snackbarhoekjesurhuisterveen.nl	Snackbar 't Hoekje	The website of Snackbar 't Hoekje in Surhuisterveen offers visitors the opportunity to order fries, snacks, and other dishes online for delivery or pickup. The website also includes information, reviews, and a newsletter signup.	Fast Food → Burgers ⁶⁸⁷	discounts ⁷⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Achtkarspelen → Surhuisterveen ²⁸¹
snackbarjaap.nl	Snackbar Jaap Arnhem	The website of Snackbar Jaap Arnhem is an online platform where visitors can order snacks and meals for delivery in Arnhem. The website also offers chances to win prizes and participate in lotteries.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	prize wheel ⁴⁰² snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
snackbarjaap-arnhem.nl	Snackbar Jaap	The website Snackbar Jaap allows customers to order meals online from their snack bar in Arnhem. It also features a comprehensive menu with various dishes and snacks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	family pack ²⁴ schnitzel ⁶¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Arnhem ⁸⁶⁸⁰
snackbarjansenhendriks.nl	Snackbar Jansen Hendriks	The website Snackbar Jansen Hendriks offers online ordering for a variety of snacks, sandwiches, drinks and extras, with delivery to homes in Haarlem.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Delivery ²²²⁷	specialty ²²⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
snackbarjelle-amsterdam.nl	Snackbar Jelle	The website of Snackbar Jelle is an online platform where visitors can order dishes from the snack bar in Amsterdam and view the menu.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackbarmandoline.nl	Snackbar Mandoline	The website of Snackbar Mandoline presents information about the company, including the menu, opening hours, and contact details.	Quick Bites → Snack Bar ⁵⁸⁰	snack bar ¹⁶² shawarma ³³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹
snackbarrian-zwartemeer.nl	Snackbar Rian Zwartemeer	The website of Snackbar Rian Zwartemeer offers an online ordering platform for fries, snacks, and other menu items, as well as information about the establishment and customer reviews.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	schnitzel ⁶¹ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Emmen → Zwartemeer ⁸¹
snackbartwins-amsterdam.nl	Snackbar Twins	This website allows customers to order food online from Snackbar Twins in Amsterdam.	Quick Bites → Snack Bar ⁵⁸⁰	pita ¹⁹⁹ shawarma ³³⁵ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
snackbarwestertil.nl	Snackbar Westertil	The website of Snackbar Westertil in Zaandam showcases the snack bar’s offerings, including fresh fries, snacks, and milkshakes, and offers the option for online ordering.	Quick Bites → Snack Bar ⁵⁸⁰ TravelContent → Maps ¹⁴¹	fries ²⁷⁵³ snack ²⁹¹⁶ opening hours ²⁹⁵³ menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
snackbistrostadhuisplein-almere.nl	Snackbistro Stadhuisplein	The website Snackbistro Stadhuisplein offers the possibility to order online from a snack bistro in Almere. It presents an extensive menu with various dishes and drinks.	Fast Food → Fries ⁹⁴⁹	family pack ²⁴ menus ²²¹ appetizer ⁵⁵⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶	Flevoland → Almere ⁷⁷⁶⁵
snackhouse-twins.nl	Snackbar Twins Zeist	The website of Snackbar Twins Zeist offers the possibility to order meals online.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	spring rolls ¹⁴¹ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Zeist ²⁶⁴⁴
snackhuisrembrandthardenberg.nl	Snackhuis Rembrandt	The website Snackhuis Rembrandt from Hardenberg offers an online ordering system for various snacks and meals, including fries, croquettes, and hot dogs.	Fast Food → Fries ⁹⁴⁹ Cafes & Lunch → Lunch ⁵⁹¹	frikandel ¹⁸ croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Overijssel → Hardenberg ²³⁰⁹
snackpaleis-desperado.nl	Snackpaleis Desperado	The website of Snackpaleis Desperado in Groningen presents the locations and opening hours of the snack bar, and provides an overview of its offerings.	Restaurants & Dining → Fries Kiosks ³³ Events → Places ¹²¹⁹	meatball ²⁷ hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²	The Hague → Escamp ²⁵⁸
snackpointdevliet.nl	Snackpoint de Vliet	The website of Snackpoint de Vliet presents its menu, offers online ordering for delivery or pick-up, and announces a move to Sushi Nagato.	Fast Food → Fries ⁹⁴⁹	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Amsterdam → East ¹⁴²³
snackpointdonbosco.nl	Snackpoint	The Snackpoint Susteren and Snackpoint Ulestraten website is an online ordering platform for fries, snacks, and hamburgers, offering both takeaway and delivery options. The platform also features a prize wheel and regular lotteries.	Fast Food → Fries ⁹⁴⁹ Websites → Ordering Sites ⁷⁵	prize wheel ⁴⁰² fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Meerssen → Ulestraten ⁷²
snackpointfortuna.nl	Snackpoint Fortuna Sittard	The website of Snackpoint Fortuna Sittard offers online ordering for snacks, delivery, and pickup options, and regularly hosts prize games and lotteries.	Fast Food → Fries ⁹⁴⁹ Websites → Ordering Sites ⁷⁵	prize wheel ⁴⁰² snack ²⁹¹⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Sittard-Geleen → Sittard ¹⁹⁹⁷
snackpointttrefpunt-zwartemeer.nl	Snackpoint 't Trefpunt	Snackpoint 't Trefpunt is an online ordering platform for food in Zwartemeer.	Features & Services → Traditional Restaurants ⁸³	schnitzel ⁶¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Emmen → Zwartemeer ⁸¹
snackpunt-mijnsheerenland.nl	't Patat Huis Mijnsheerenland	The website of ‘t Patat Huis in Mijnsheerenland offers the possibility to order online. Visitors can view the menu and make their favorite dishes available for online ordering.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	croquettes ¹⁰⁸ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Hoeksche Waard → Mijnsheerenland ¹³⁸
snackroomdemarsman.nl	Snackroom De Marsman	Snackroom De Marsman's website allows online ordering of fries and snacks for home delivery.	Fast Food → Fries ⁹⁴⁹	promotion ²⁰⁶² fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Holland → Haarlem ⁸⁶⁷⁴
snacksalonabstede-utrecht.nl	Snacksalon Abstede	The website Snacksalon Abstede from Utrecht offers the opportunity to order meals online, including a menu with various snacks, hamburgers, fries, and sandwiches.	Turkish Cuisine → Fast Food ³²²²	hamburger ³⁶⁴ soup ¹⁰⁴³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Netherlands → Utrecht ⁴⁸⁹⁰¹
snackservicerotterdam.nl	Snackservice Rotterdam	Snackservice Rotterdam is a catering company that provides snacks and meals to businesses and individuals, and caters events.	Quick Bites → Snack Bar ⁵⁸⁰ Administrative Support → Business Closure ¹²	party service ²⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
snacksmorezwolle.nl	Snacks & More Zwolle	The website Snacks & More Zwolle offers an online ordering system for various snacks, sandwiches, fries, salads, and drinks in Zwolle. Customers can easily order their favorite dishes online for delivery.	Fast Food → Fries Chain ⁴⁶	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Zwolle ⁷³⁹⁵
snacktotake.nl	Snack to Take	The Snack to Take website is an online ordering platform for a cafeteria and eatery located in Almere Haven, where customers can order food and drinks.	Quick Bites → Cafeteria ⁹⁰⁶ Restaurants & Dining → Fries Kiosks ³³	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Almere → Almere Haven ²¹⁶
snackworldheerlen.nl	Snackworld Heerlen	The Snackworld Heerlen website allows customers to order food online from the Snackworld Heerlen snack restaurant in Heerlen. The platform features a wide range of snacks, sandwiches, fries, and various dishes.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Indonesian ⁵⁰²	combination ¹⁸⁹ satay ³²⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Limburg → Heerlen ²⁷⁵⁵
snagger.nl	snagger GmbH	The website SNAGGER presents and sells an innovative snack dispenser (SNAGGER) that offers a hygienic way to consume snacks without direct contact with hands.	Promotional Products → Product Promotion ¹⁰ Kitchen → Kitchen Gadgets ¹¹	hygiene ⁷⁰⁶ snack ²⁹¹⁶ design ²⁷²⁰²
solkema-catering.nl	Solkema Catering	The website of Solkema Catering in Assen offers catering services for private and corporate events, including buffets, snacks, BBQs, and the rental of party accessories.	Parties → Party Supplies ¹¹⁰⁸ Performances & Entertainment → Celebrations ⁵⁶⁰	party tent ²⁵⁶ bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Aa en Hunze → Rolde ¹⁷⁶
spar-city-eindhoven.nl	Spar City Eindhoven	The website Spar City Eindhoven allows users to order food online from the store in Eindhoven. The website displays the menu and offers an easy way to place orders.	Catering & Ready Meals → Takeaway ⁴⁰⁹	bread ¹⁶²² salad ²⁴⁴⁴ beer ²⁸⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
spar-leiden.nl	SPAR Zeldenrust IJsselkade Leiden	The website SPAR Zeldenrust IJsselkade Leiden offers the possibility to order meals online, including sandwiches, pizzas, salads and various snacks, which are baked fresh daily.	Bakery & Food Production → Bread ⁷⁶⁵ Hobbies → Baking ³²⁹	pastries ⁹⁴⁶ bread ¹⁶²² salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	South-Holland → Leiden ⁷⁰⁸⁹
speeddateineindhoven.nl	Speeddate in Eindhoven	The website describes the opportunities for speed dating in Eindhoven, where visitors have the chance to meet multiple singles in one evening and find potential matches.	Dating → Speed Dating ²² Community & Social → Social Events ⁴¹⁶	speeddate ⁵³ evening ²⁸⁷ single ⁴⁴⁵ snack ²⁹¹⁶ match ³⁴⁷¹	North-Brabant → Eindhoven ¹¹⁸⁴⁵
speeddateninrotterdam.nl	Speeddate Rotterdam	Speeddate Rotterdam is an event organizer that hosts speed dating nights for singles, with the goal of allowing participants to quickly make matches and have a fun evening.	Entertainment → Social & Events ³³⁸	speeddate ⁵³ hostess ¹⁶⁵ participant ¹⁹³⁴ snack ²⁹¹⁶ match ³⁴⁷¹ atmosphere ⁵⁵⁹¹
sphinxsteenwijk.nl	Sphinx Steenwijk	The Sphinx Steenwijk website allows online ordering of food from the Sphinx restaurant in Steenwijk. It features a comprehensive menu with various dishes, including sandwiches, plates, and different meat options.	International → Turkish ⁴¹⁶	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Steenwijkerland → Steenwijk ⁸⁷⁶
spilllthetea.nl	Spillthetea Now	The website of Spillthetea Now in Utrecht is an online store where visitors can order teas, snacks, and other drinks for home delivery.	Tea & Coffee → Tea Rooms ²²⁹	tea ¹¹⁴⁶ snack ²⁹¹⁶ app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
sportsbar-someren.nl	Sportsbar Someren	The Sportsbar Someren website allows users to order food online from a diverse menu, including burgers, sandwiches, salads, snacks, and beverages.	Fast Food → McDonald’s ¹² Fast Food → Fries Chain ⁴⁶	burger ¹⁴³¹ salad ²⁴⁴⁴ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Brabant → Someren ⁸⁵⁰
sranangyang-zeist.nl	Sranang Yang Roti Take Away	The website Sranang Yang Roti Take Away is an online ordering platform for Surinamese sandwiches, roti dishes and other dishes from Zeist. It offers a comprehensive menu and the possibility to place online orders.	Food Delivery → Surinamese ²⁶⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	rice dishes ⁷⁶ roti ³⁰³ soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Utrecht → Zeist ²⁶⁴⁴
star-arnhem.nl	Star Arnhem	Star Arnhem is an online ordering platform that allows you to order meals and snacks from the restaurant in Arnhem.	International → Middle Eastern ¹¹⁶ Quick Bites → Hair Salon ¹¹²	plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
steakhouseshoarmajoey-hillegom.nl	Steakhouse Shoarma Joey	The website of Steakhouse Shoarma Joey offers the opportunity to order meals online in Hillegom, with an extensive menu including various sandwiches, pita wraps, and vegetarian options.	International → Turkish ⁴¹⁶	pita ¹⁹⁹ shoarma ²⁵⁴ kebab ²⁷⁶ burger ¹⁴³¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Hillegom ⁸⁵¹
stephaniekookt.nl	Stephaniekookt!	The website Stephaniekookt! offers catering services including buffets, snacks, workshops, and cakes, with a focus on festive occasions and self-service options.	Catering → Buffets ²⁷⁷	cake ¹⁷³⁰ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶ workshop ¹⁹³²⁵	Flevoland → Dronten ¹⁶⁶⁷
sugarrush-amsterdam.nl	Sugar Rush	Sugar Rush is an online platform where customers in Amsterdam can order and have delivered meals, sandwiches, snacks, drinks, and desserts.	Cooking & Recipes → Desserts ¹⁴⁰	churros ³⁰ donut ⁵⁴ waffle ²¹⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
suri-jawa-breda.nl	Suri-Jawa	The website Suri-Jawa from Breda offers the possibility to order food online, including a detailed menu with various Indonesian dishes and beverages.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Brabant → Breda ⁹⁰⁰³
surinaams-chineesafhaalrestaurantakko-rotterdam.nl	Akko	The Akko website offers online ordering for a wide range of dishes, including sandwiches, soups, Chinese and Surinamese cuisine, snacks, and beverages, in the city of Rotterdam.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	soup ¹⁰⁴³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
suritaria-utrecht.nl	Suritaria Utrecht	The website Suritaria Utrecht offers online ordering of Indian-inspired dishes, including rotis, snacks, and drinks, with a focus on the city of Utrecht.	Food Delivery → Indian Cuisine ⁵⁴³ Food Delivery → Indonesian ⁵⁰²	mashed potatoes ²⁶ roti ³⁰³ beef ³¹⁹ curry ³⁵⁵ chicken ⁹⁴⁴ snack ²⁹¹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
suritropicalfood-lelystad.nl	Suri Tropical Food	The Suri Tropical Food website in Lelystad offers online ordering for a variety of Indonesian dishes, including bami, nasi, roti and sandwiches, as well as snacks, drinks and salads.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Meal Solutions → Food Businesses ⁵⁷	bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Flevoland → Lelystad ³¹⁸⁰
sushi-wereld-rijswijk.nl	Sushi Wereld Rijswijk	The website Sushi Wereld Rijswijk allows customers to order sushi and other Japanese dishes online and view a digital menu.	Asian → Japanese ¹⁴⁸⁸	sushi rolls ¹¹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rijswijk ²⁰⁵⁴
sushirothem.nl	Sushi Rothem	Sushi Rothem is a restaurant in Meerssen that offers sushi, fries and snacks, as well as a wide selection of dishes.	Asian → Japanese ¹⁴⁸⁸ Meal Solutions → Food Businesses ⁵⁷	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶	Limburg → Meerssen ⁴⁶⁶
sushiwolder.nl	Sushi Wolder	Sushi Wolder is an online shop offering sushi, poke bowls, and complementary drinks and snacks with home delivery.	Japanese → Sushi ⁹⁷¹	poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Limburg → Maastricht ⁶⁰⁰⁸
suvesnacks.nl	Suvé snacks	Suvé snacks is a company that delivers fresh fried potatoes and snacks to locations for various occasions.	Food → Ice ¹⁴	ice ¹⁷⁸ truck ¹⁴¹² fries ²⁷⁵³ snack ²⁹¹⁶ arrangement ³¹⁰⁴	Gelderland → Ede ⁵¹⁰⁴
switi-exotische-broodjeszaak.nl	Switi Exotische Broodjeszaak	The Switi Exotische Broodjeszaak website in Alkmaar allows customers to place online orders for Surinamese sandwiches, snacks and meals.	Turkish Cuisine → Takeout Restaurant ⁸¹ Food Delivery → Surinamese ²⁶⁵	rotis ¹² extras ⁶⁴ rice ⁶³⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Alkmaar ⁶⁵⁰⁷
t-bakhuus-amersfoort.nl	t Bakhuus Amersfoort	't Bakhuus Amersfoort is an online platform where customers can order dishes from the 't Bakhuus restaurant in Amersfoort for delivery or pickup.	Fast Food → Fries ⁹⁴⁹	soup ¹⁰⁴³ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
t-centrum-terneuzen.nl	Cafetaria 't Centrum Terneuzen	The website Cafetaria 't Centrum Terneuzen provides an online ordering system for dishes and snacks from the cafeteria in Terneuzen. Customers can view the menu and place online orders here.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	soup ¹⁰⁴³ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Zeeland → Terneuzen ¹⁵¹⁷
taartenwereld.nl	Panchito delivery service	The website Taartenwereld Tilburg, in partnership with Panchito delivery service, offers a range of cakes and treats for various occasions, with a special focus on delivery in Tilburg.	Food Delivery → Delivery ²²²⁷ Pastry → Cakes ⁸²⁶	delivery service ²³⁶ appetizer ⁵⁵⁶ cake ¹⁷³⁰ snack ²⁹¹⁶	North-Brabant → Tilburg ⁸⁷⁵⁹
tadka-amsterdam.nl	Tadka	The Tadka website is an online platform allowing users in Amsterdam to have Indian food delivered to their homes.	Food Delivery → Indian Cuisine ⁵⁴³	menus ²²¹ vegetarian ³³⁷ soup ¹⁰⁴³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
takeawokamsterdam.nl	Take a Wok Amsterdam	The Take a Wok Amsterdam website offers online ordering for Asian wok dishes and snacks from Amsterdam.	Asian → Chinese ⁴¹⁵	noodles ¹⁹¹ wok ²³¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
tantelienutrecht-utrecht.nl	Tante Lien Utrecht	The Tante Lien Utrecht website provides an online ordering service for Indonesian dishes and rice tables in Utrecht.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	rame ¹⁹ vegetarian dishes ³⁴ saté ³⁷ rice table ²⁷⁷ snack ²⁹¹⁶	Netherlands → Utrecht ⁴⁸⁹⁰¹
taste-the-world-doorn.nl	Taste The World	Taste The World is an online ordering platform that allows customers to order dishes from Doorn. It offers a variety of sandwiches, meals, customizable menus, snacks and extras.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht Hill Ridge → Doorn ⁶¹⁵
tdreefke-eindhoven.nl	t Dreefke	't Dreefke is an online ordering platform for food in Eindhoven, allowing customers to easily order their favorite dishes online and have them delivered quickly.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ wrap ⁸²⁶ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
teds-amsterdam.nl	TEDS Prinsengracht	The website offers online ordering options for dishes at TEDS Prinsengracht in Amsterdam.	Cafes & Lunch → Lunch ⁵⁹¹ Cooking & Recipes → Cuisine ¹¹⁴⁷	orange juice ¹² dessert ⁴⁹⁶ chicken ⁹⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Amsterdam ⁴¹²⁵³
tenthijbakeryenschede.nl	ten Thij Bakery@Shell ten Thij Glanerbrug	The website ten Thij Bakery@Shell ten Thij Glanerbrug is an online platform where customers in Enschede can easily order and have food delivered from the bakery. It offers an extensive menu with various sandwiches, snacks and drinks.	Turkish Cuisine → Takeout Restaurant ⁸¹	kebab ²⁷⁶ sauce ¹¹⁴¹ bread ¹⁶²² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Enschede ⁵⁵⁵⁴
tfrietdeurtje-denhaag.nl	Frietdeurtje	't Frietdeurtje is an online shop based in The Hague that allows customers to order meals and snacks online. The website offers a comprehensive menu including various dishes, snacks, sandwiches, and drinks.	Fast Food → Fries ⁹⁴⁹ Sandwiches & Salads → Snacks ⁶⁹³	menus ²²¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
tfrietmanneke.nl	Restaurant 't Frietmanneke	The website 't Frietmanneke is an online ordering platform for dishes and snacks from the restaurant 't Frietmanneke in Bunnik. Visitors can view the menu here and place their orders online.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	family menu ¹² fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Utrecht → Bunnik ⁸²¹
thanhlong.nl	Eurexco Trading B.V.	Thanh Long is a Dutch producer and supplier of authentic Asian snacks.	Sandwiches & Salads → Appetizers ⁴⁰ Sandwiches & Salads → Snacks ⁶⁹³	spring rolls ¹⁴¹ certificate ¹⁰³⁶ vegetables ¹⁴¹⁶ snack ²⁹¹⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
the-food-box-middenmeer.nl	The Food Box	The Food Box website, located in Middenmeer, allows customers to order meals online, including soups, toasties, club sandwiches, salads, wraps, and bread rolls.	Lunch → Sandwiches ⁴⁶⁶ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	bread roll ²⁸ toastie ⁴⁵ wrap ⁸²⁶ salad ²⁴⁴⁴ snack ²⁹¹⁶	Hollands Kroon → Middenmeer ¹⁶²
thebucketlist-enschede.nl	The Bucket List	The Bucket List website is an online ordering platform for food and drinks from Enschede, offering a wide range of snacks, buckets, sauces, and beverages.	Online Ordering → Delivery Restaurants ⁷²	bucket ¹¹³ vegan ⁵⁰⁸ beverage ⁵⁸⁶ sauce ¹¹⁴¹ beer ²⁸⁸⁷ snack ²⁹¹⁶	Overijssel → Enschede ⁵⁵⁵⁴
thefoodcorner-tiel.nl	The Foodcorner	The Foodcorner website in Tiel allows users to order food online.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Delivery ²²²⁷	panini ¹⁵⁶ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Tiel ¹⁶⁶²
thelmas-tilburg.nl	Thelma's	Thelma's is an online ordering platform that allows you to order meals and snacks from Tilburg for delivery.	Online Ordering → Delivery Restaurants ⁷² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	bara ²² meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
thoeckie-hellevoetsluis.nl	'T Hoeckie	'T Hoeckie is an online ordering platform for food in Hellevoetsluis, allowing customers to have meals delivered or picked up.	Turkish Cuisine → Fast Food ³²²²	pasta ¹³⁸⁹ meat ²⁰⁵⁵ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Voorne aan Zee → Hellevoetsluis ⁹⁷²
tiaslunchroomrotterdam.nl	Tia's Lunchroom	Tia's Lunchroom is a lunchroom in Rotterdam that accepts online orders for a wide range of dishes, including sandwiches, salads, soups, snacks, main courses, desserts, side dishes, and beverages.	Fast Food → Fries Restaurants ⁸⁷ Websites → Ordering Sites ⁷⁵	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
tirolerstuberl-zandvoort.nl	Tiroler Stuberl	The website of Tiroler Stuberl in Zandvoort offers the possibility to view the menu online and order dishes.	Regional Cuisine → German ¹⁷	schnitzel ⁶¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	North-Holland → Zandvoort ¹²⁹⁸
tjapz-alphenaandenrijn.nl	Tjapz	The website Tjapz offers online ordering for a variety of Indonesian dishes in Alphen aan den Rijn.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Indonesian Restaurant ³⁹²	bami ¹⁴⁴ nasi ²⁴² roti ³⁰³ rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
todayskitchen-denhaag.nl	Today’s Kitchen	The website Today’s Kitchen offers the possibility to order meals and snacks online from The Hague.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	roti ³⁰³ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
toko-bandoeng-ijmuiden.nl	Toko Bandoeng IJmuiden	The Toko Bandoeng IJmuiden website offers an online ordering service for Indonesian dishes, including rice tables, snacks and complete meals, which can be delivered to IJmuiden.	Food Delivery → Indonesian ⁵⁰²	meat dishes ⁶⁶ rice table ²⁷⁷ meal ¹⁶³⁸ snack ²⁹¹⁶	Velsen → IJmuiden ¹¹⁰⁹
toko-culindo.nl	Toko Culindo	Toko Culindo is an online shop based in The Hague that delivers Indonesian rice dishes, snacks, and sandwiches to your door, with a focus on various rice specialties.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Indonesian ⁵⁰²	rice dishes ⁷⁶ packaging ²²³⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
toko2walk-heerhugowaard.nl	Toko2Walk	The website Toko2Walk offers the possibility to order food online from the takeaway and delivery restaurant Toko2Walk in Heerhugowaard.	Cuisine → Vegetarian ⁶⁹⁷ Commerce → Shopping Centers ¹⁰⁰¹	bundle ²⁵⁴ soup ¹⁰⁴³ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Dijk en Waard → Heerhugowaard ²⁰¹¹
tokoarum.nl	Toko Arum	The Toko Arum website allows customers to order Indonesian takeaway meals, snacks, and ingredients, both for pickup and delivery.	Food Delivery → Indonesian ⁵⁰² Restaurants & Dining → Takeaway Restaurants ²⁴⁰	whatsapp ³⁸² meal ¹⁶³⁸ ingredients ²³⁴⁶ snack ²⁹¹⁶ kitchen ⁶⁴⁴³	North-Brabant → Veldhoven ¹⁴⁸⁵
tokobenji-voorschoten.nl	Toko Benji	The website Toko Benji offers the possibility to order meals online from the restaurant located in Voorschoten.	Catering & Ready Meals → Indonesian Restaurant ³⁹²	daily menu ¹¹ nasi goreng ⁶⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹	South-Holland → Voorschoten ⁸³⁰
tokomirasa-vlaardingen.nl	Toko Mirasa	The website Toko Mirasa allows customers to order meals and drinks online from the restaurant in Vlaardingen. The website presents a menu with various dishes and beverages.	Catering & Ready Meals → Indonesian Restaurant ³⁹²	milk tea ¹⁵ roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Vlaardingen ¹⁸⁵³
tokonoor-nieuw-vennep.nl	Toko Noor	The website Toko Noor Nieuw-Vennep offers the possibility to order Indonesian dishes online and view an extensive menu.	Fast Food → Fries ⁹⁴⁹ Catering & Ready Meals → Indonesian Restaurant ³⁹²	rice table ²⁷⁷ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
tokotanja-zwolle.nl	Toko Tanja	The Toko Tanja website, located in Zwolle, Netherlands, allows customers to order Indonesian dishes online, including nasi rames, rijsttafels, and a variety of other menu items.	Catering & Ready Meals → Indonesian Restaurant ³⁹²	nasi rames ¹³ rijsttafel ⁴⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Overijssel → Zwolle ⁷³⁹⁵
tongelhoek.nl	Cafetaria de Tongelhoek	The website of Cafetaria de Tongelhoek in Eindhoven allows customers to order hamburgers and other snacks online for delivery or pickup. The website also contains information, reviews, and a newsletter sign-up form.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
tonyswok.nl	Tony’s Wok & Tony’s Streetfood / Sushi Eight Eindhoven	Tony’s Wok & Tony’s Streetfood and Sushi Eight Eindhoven offer a variety of Asian cuisines, including Surinamese, Japanese, sushi, and pokébowls, with options for dine-in, takeaway, and online ordering.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Catering & Ready Meals → Asian Cuisine ¹³⁷	wok ²³¹ sushi ¹⁶⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
trimsalonkwafure.nl	kWAFure	The website of Kwafure is a dog grooming salon located in Huizen, where dogs are groomed, nails are trimmed, and pampered.	Dog Care → Grooming Salons ⁶⁵¹	grooming salon ²⁶³ grooming ⁸⁹⁶ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³	North-Holland → Huizen ¹⁴¹⁶
ttastycorner-zandvoort.nl	T Tasty Corner	The website T Tasty Corner is an online ordering platform for food and snacks in Zandvoort, allowing customers to conveniently have meals delivered to their home.	Sandwiches & Salads → Snacks ⁶⁹³ Quick Bites → Cafeteria ⁹⁰⁶	dürüm ⁹⁷ panini ¹⁵⁶ potato ⁵⁴² salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	North-Holland → Zandvoort ¹²⁹⁸
twentecornerxl.nl	Twente Corner XL Hengelo	The website of Twente Corner XL Hengelo offers online ordering for snacks and more, with delivery to Hengelo. The goal is to provide customers with the ability to easily order and benefit from free delivery with a minimum spend.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
uncle-sams-capelle-aan-den-ijssel.nl	Uncle Sam's	Uncle Sam's is a restaurant in Capelle aan den IJssel that presents online menus and offers the possibility to order meals online.	Food Delivery → Surinamese ²⁶⁵ Context ¹⁶¹³⁹⁴	nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vanderreebezorgd-schiedam.nl	Van der Ree Bezorgd	Van der Ree Bezorgd is an online ordering platform for food from the snack and fry restaurant Van der Ree Bezorgd in Vlaardingen.	Food Delivery → Delivery ²²²⁷ Cooking & Recipes → Dishes ³³⁵	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Vlaardingen ¹⁸⁵³
vanzaanehoeve.nl	Van Zaane Hoeve	Van Zaane Hoeve is a company specializing in the sale of high-quality pet food and related care products for pets, with a focus on health and convenience for pet owners.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	kibble ⁴⁶ supplement ¹⁹⁶⁸ category ²³¹⁶ snack ²⁹¹⁶ food ³⁸⁷²	Hollands Kroon → Winkel ¹⁰⁰
veluvensis.nl	Webwerkplaats	Heeren Sociëteit Veluvensis is a social club in the municipality of Renkum that meets twice a month for lectures or dinners.	Social Organization → Senior Organizations ⁷⁵⁰ Arts → Imaging & Photography ⁷⁶⁸⁷	hostess ¹⁶⁵ dinner ¹⁵³³ lecture ¹⁶²⁴ snack ²⁹¹⁶ club ⁴²²⁵ drink ⁵¹⁹¹	Gelderland → Renkum ¹³⁰¹
verwendogs.nl	Verwendogs	The website Verwendogs.nl offers natural dog snacks and treat boxes, specifically designed for dogs of various ages, sizes, and dietary needs.	Essential → Food ⁴⁷⁹⁹⁹	diet ⁷⁴⁷ ingredients ²³⁴⁶ snack ²⁹¹⁶ dog ⁵⁴⁸³
vinoevita.nl	Vino e Vita	Vino e Vita is a bar offering wine, food, and a cozy atmosphere.	Wine → Wine Tasting ⁷³⁰ Bars → Wine Bars ¹⁷⁰	cozy ²²⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ event ⁴⁵¹⁹⁹
viswinkeldezeeparel.nl	Viswinkel De Zeeparel	Viswinkel De Zeeparel is an online shop and takeaway restaurant in Enschede that offers fresh fish, snacks, and various sandwiches and meals.	Fish & Seafood → Fish ³⁸⁸ Restaurants & Dining → Seafood Restaurants ⁶¹²	fondue ³³ paella ⁶⁸ fish ¹¹²¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Overijssel → Enschede ⁵⁵⁵⁴
vlaamsfriteshuisloket13-overasselt.nl	Vlaams Friteshuis Loket 13 Overasselt	The website of Vlaams Friteshuis Loket 13 in Overasselt offers an online ordering system for fries and other snacks, with a detailed menu and reviews.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	loaded fries ⁴¹ chicken ⁹⁴⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Heumen → Overasselt ¹⁵¹
voyagefood.nl	Voyage Food N57	The website of Voyage Food N57 is an online presence for a food truck/gas station kiosk offering coffee, sandwiches, snacks, and ice cream.	Tea & Coffee → Cafes ²⁴⁹¹ Food → Supermarkets & Grocery ³⁵⁶⁸	ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ staff ³⁴⁰⁵ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸
wandeltukker.nl	Wandeltukker	The Wandeltukker website promotes and organizes walking tours, particularly the ‘Freek Kers tocht’ and other annual tours, focused on social and accessible walking experiences for everyone.	Holidays → Christmas ⁹³⁷ Events → Walking Tours ¹⁶⁶	visit ³⁸⁰ tour ²³¹⁵ snack ²⁹¹⁶ route ³⁴²⁵ coffee ³⁸³⁸	Overijssel → Tubbergen ⁸⁸⁵
warungpadi-amsterdam.nl	Warung Padi	Warung Padi is an online platform that allows customers in Amsterdam to order dishes from the Indonesian restaurant.	Food Delivery → Indonesian ⁵⁰²	rijsttafel ⁴⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
warungsolo-hilversum.nl	Warung Solo	Warung Solo is an online ordering platform for Indonesian cuisine from Hilversum. It offers an extensive menu with various rice dishes, soups, side dishes, snacks, and drinks that customers can order online.	Food Delivery → Indonesian ⁵⁰²	rice dishes ⁷⁶ rice table ²⁷⁷ soup ¹⁰⁴³ snack ²⁹¹⁶	North-Holland → Hilversum ⁴³⁹⁷
whiskybeleving.nl	Whiskybeleving	The website of Whiskybeleving offers whisky tasting experiences at the customer’s home, focused on introducing different types of whisky and sharing knowledge about whisky making.	Hobbies → Whisky ²³⁵ Personal Blog → Experiences ⁷⁴	whisky ³⁷³ taste ⁹³³ question ²²⁶¹ wishes ²⁷¹⁷ tips ²⁷⁸⁹ snack ²⁹¹⁶
willygiesen.nl	't Freubeltje	The website of ’t Freubeltje offers floral arrangements for weddings and funerals, as well as summer-organized snack workshops.	Flowers → Florists ¹⁴¹⁰	wedding arrangement ²⁶ funeral arrangement ¹³³ floral arrangement ³⁴⁴ snack ²⁹¹⁶ workshop ¹⁹³²⁵	Gelderland → Lochem ¹⁵⁸⁷
wokbox-lelystad.nl	Wok Box	The Wok Box website in Lelystad provides the opportunity to order food online, including an extensive menu with various wok dishes, snacks, and drinks.	Catering & Ready Meals → Chinese Restaurants ³⁰³ Catering & Ready Meals → Takeaway ⁴⁰⁹	wok box ¹⁵ wok ²³¹ rice ⁶³⁵ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Flevoland → Lelystad ³¹⁸⁰
wokcity-ijsselstein.nl	Wok City	The website of Wok City in IJsselstein offers the possibility to order food online and view the menu.	Asian → Chinese ⁴¹⁵	wok ²³¹ sauce ¹¹⁴¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Utrecht → IJsselstein ¹¹⁰⁷
wokgo-zwolle.nl	Wok & Go Zwolle	The website Wok & Go Zwolle allows users to order food online.	Asian → Chinese ⁴¹⁵	wok dish ⁶⁶ shrimp ²¹⁹ chicken ⁹⁴⁴ soup ¹⁰⁴³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Overijssel → Zwolle ⁷³⁹⁵
wokkiesnackiehelmond.nl	Wokkie & Snackie	The website Wokkie & Snackie from Helmond offers the possibility to order dishes online, including wok dishes, Vietnamese snacks, sandwiches and snacks.	Asian → Chinese ⁴¹⁵ Catering & Ready Meals → Takeaway ⁴⁰⁹	dumpling ⁴⁹ wok dish ⁶⁶ spring roll ⁸² wok ²³¹ soup ¹⁰⁴³ snack ²⁹¹⁶	North-Brabant → Helmond ³⁰⁵⁸
wrap-world-aalsmeer.nl	Wrap-World	The website Wrap-World from Aalsmeer offers the possibility to order food online, including wraps, desserts, snacks, and drinks.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Desserts ¹⁴⁰	tortilla ²² dessert ⁴⁹⁶ wrap ⁸²⁶ chicken ⁹⁴⁴ cheese ¹²⁰⁵ snack ²⁹¹⁶	North-Holland → Aalsmeer ¹⁷¹⁰
yasami-wok-zaandam.nl	Yasami Wok Zaandam	The Yasami Wok Zaandam website offers online ordering for meals and snacks from the restaurant in Zaandam.	Asian → Chinese ⁴¹⁵ Quick Bites → Cafeteria ⁹⁰⁶	wok ²³¹ sauce ¹¹⁴¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Zaanstad → Zaandam ²⁷⁴⁰
yasamiwok-amsterdam.nl	Yasami Wok Amsterdam	The Yasami Wok Amsterdam website offers online ordering of Chinese food in Amsterdam.	Catering & Ready Meals → Chinese Restaurants ³⁰³	noodles ¹⁹¹ wok ²³¹ snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Amsterdam ⁴¹²⁵³
youkohondenvoer.nl	Youko Hondenvoer	Youko Hondenvoer is an online shop that sells grain-free, compressed dog food and natural snacks.	Pet Food → Dog Food ³²¹ Animals → Pet Stores ⁴⁷⁸	dog school ¹¹⁴ dog food ²⁰⁴ snack ²⁹¹⁶ webshop ⁸⁶⁴⁸	Northeast-Friesland → Dokkum ⁸⁴⁶
yousnightshop-amsterdam.nl	Yous Night Shop	The Yous Night shop website offers the possibility to order meals online from Amsterdam.	Bars → Beer Bars ³⁵ Food Delivery → Delivery ²²²⁷	soda ⁴⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
ythuskedebikker.nl	De Bikker Franeker	The website of De Bikker Franeker is an online ordering platform where visitors can order meals, snacks, and drinks for home delivery.	Fast Food → Burger Restaurants ³⁴⁶ Websites → Ordering Sites ⁷⁵	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶
yumburger.nl	Yum Burger Almere	The Yum Burger Almere website offers the possibility to order burgers and snacks online with options for home delivery and app ordering.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	burger ¹⁴³¹ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Flevoland → Almere ⁷⁷⁶⁵
yummy-snacks-nunspeet.nl	Yummy Snacks	The website Yummy Snacks offers online ordering of meals and snacks from Nunspeet. It presents an extensive menu with pizzas, sandwiches, and other dishes.	Turkish Cuisine → Fast Food ³²²²	döner kebab ⁸¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Gelderland → Nunspeet ¹³⁶⁶
yummysvenlo.nl	Yummy's Venlo	The Yummy's Venlo website offers an online ordering platform for a diverse selection of snacks, sandwiches, and beverages.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	noodles ¹⁹¹ chocolate ⁹¹¹ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Limburg → Venlo ⁴¹⁵⁸
zaanse-snackhouse.nl	Zaanse Snackhouse	The Zaanse Snackhouse website offers the possibility to order meals online in Zaandijk, featuring an extensive menu with various snacks, sandwiches, and meat dishes.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	menus ²²¹ chicken ⁹⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Zaanstad → Zaandijk ²¹⁴
zinin-catering.nl	Zin in Catering Den Bosch	Zin in Catering Den Bosch is an online shop offering dinner buffets, lunch boxes, snacks, and drink packages for home delivery and parties.	Catering → Buffets ²⁷⁷	lunchboxes ⁴¹ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
zobot.nl	ZOBOT Vereniging	ZOBOT is a social club for former members of the organization Het Zinkstuk, which organizes activities and offers membership.	Sport Facility → Pools ⁹⁵	pool ¹⁵³² beer ²⁸⁸⁷ snack ²⁹¹⁶ membership ¹⁰⁴⁴²
smulensmaak.nl	Smul & Smaak	Smul & Smaak is a company specializing in the supply of various delicacies, including tapas platters, snacks, bread sticks, and cake glasses, with a special focus on catering services for different occasions.	Woodworking → Cutting Boards ⁵² Parties → Party Supplies ¹¹⁰⁸	platters ⁵⁴ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Overijssel → Almelo ²⁶⁹⁶
lunbert.nl	Lúnbert.nl	Lúnbert.nl is an online store specializing in the supply of premium food and snacks for dogs and cats.	Pet Food → Dog Food ³²¹ Pet Food → Cat Food ¹²⁴	cart ³⁸¹ cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
falafellashatert-nijmegen.nl	FalaFellas Hatert	FalaFellas Hatert is an online restaurant in Nijmegen where customers can order meals and snacks.	Vegan & Vegetarian → Vegan ³⁹⁰	gluten free ¹² falafel ¹⁰⁸ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	Nijmegen → Nijmegen-South ⁷⁴
winkelenwijn.nl	Studio Brederoo	Winkel en Wijn is an event designed to promote local shops and bring the community together.	Local & Regional Products → Local Shops ²⁴⁵ Fashion → Secondhand Fashion ¹¹	snack ²⁹¹⁶ glass ²⁹¹⁹ route ³⁴²⁵ wine ⁴⁴⁷⁶ shop ⁶⁴⁸³ event ⁴⁵¹⁹⁹	Westland → Monster ³⁶⁰
freshgovending.nl	Freshgo Vending	The website Freshgo Vending provides a complete vending machine service, including stocking, maintenance, and customized adaptations.	Dogs → Supplies ¹⁰⁰⁵ Logistics & Transportation → Vending Machines ⁶⁹	vending machine ¹²⁷ customization ¹⁷²³ snack ²⁹¹⁶ drink ⁵¹⁹¹ maintenance ²⁰⁰⁹³
chefsburgerii-haarlem.nl	Chef's Burger II	This website, Chef's Burger II, offers an online ordering system for meals in Haarlem, including burgers, fries, Turkish pizzas, and various snacks.	Quick Bites → Hair Salon ¹¹² Coffee & Tea → Beverages ⁴⁴⁵³	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Haarlem ⁸⁶⁷⁴
beekhuiscatering.nl	Beekhuis Catering	Beekhuis Catering is a catering service offering a variety of dishes, snacks, and sandwiches, aimed at catering to dinners and events.	Lunch → Sandwiches ⁴⁶⁶	buffet ¹⁷⁴⁷ salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶	Bunschoten → Bunschoten-Spakenburg ³⁸²
snackbartcentrum-amsterdam.nl	Snackbar 't Centrum Amsterdam	The website 'Snackbar 't Centrum Amsterdam' provides an online ordering system for snacks, sandwiches, and other dishes in Amsterdam. Visitors can easily view the menu and place orders.	Quick Bites → Snack Bar ⁵⁸⁰ Events → Places ¹²¹⁹	ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
warungsayang-rotterdam.nl	Warung Sayang	Warung Sayang is an online ordering platform for Indonesian cuisine from Rotterdam.	Food Delivery → Indonesian ⁵⁰²	roti ³⁰³ soup ¹⁰⁴³ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbar-t-trefpunt-voorschoten.nl	Snackbar 't Trefpunt	The website of Snackbar 't Trefpunt from Voorschoten allows visitors to order meals online. It also presents a comprehensive menu with various snacks, potato dishes, sandwiches and drinks.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	hamburger ³⁶⁴ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Voorschoten ⁸³⁰
snackbar-denuyl.nl	Snackbar Den Uyl	The website of Snackbar Den Uyl Bergambacht provides the opportunity to order food online for takeaway or delivery, including a menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
nani-noordwijk-bomstraat.nl	Nani Noordwijk	The website of Nani Noordwijk offers the possibility to order food online from the restaurant in Noordwijk. The menu is available online and orders can be placed directly.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² roti ³⁰³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	South-Holland → Noordwijk ²⁵⁰⁷
selamatmakandenhelder.nl	Selamat Makan	The Selamat Makan website in Den Helder provides an online ordering platform for a variety of Surinamese dishes, including chicken, beef, fish, satay, and vegetable dishes. It also offers snacks, drinks and special rice dishes.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Food Delivery → Surinamese ²⁶⁵	satay ³²⁰ rice ⁶³⁵ chicken ⁹⁴⁴ vegetables ¹⁴¹⁶ snack ²⁹¹⁶ dish ⁵⁹³⁶	North-Holland → Den Helder ¹⁸⁸⁶
jammytaarthapjesenmeer.nl	Jammy	Jammy is a bakery specializing in creating custom cakes, snacks, and other sweet treats.	Pastry → Cakes ⁸²⁶ Delicacies & Specialty Foods → Specialty Foods ²⁶⁵	passion ⁷⁹² facebook ⁸⁵⁰ instagram ¹²¹⁶ cake ¹⁷³⁰ snack ²⁹¹⁶ kitchen ⁶⁴⁴³
linsmikkelbar.nl	Lin's Smikkelbar	The website of Lin's Smikkelbar in Noordwijkerhout allows customers to order and have delivered french fries, snacks, and other dishes. The platform offers a simple and fast ordering process and includes an online menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
tizzme.nl	Tizz Me	The Tizz Me website offers an online store where customers can order snacks, sandwiches, rice dishes and Surinamese specialties, including drinks, for delivery to their home. The website also lists available products.	Online Ordering → Delivery Restaurants ⁷²	rice dishes ⁷⁶ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Gelderland → Arnhem ⁸⁶⁸⁰
klasvan2004.nl	skyhighmedia	This website is a reminder and invitation for the graduating class of 2004 from Dr.-Knippenbergcollege to reunite and reminisce about their high school years.	Secondary Education → VWO ⁴⁸ Community & Social → Social Events ⁴¹⁶	reunion ²⁶⁷ beer ²⁸⁸⁷ snack ²⁹¹⁶ event ⁴⁵¹⁹⁹	North-Brabant → Helmond ³⁰⁵⁸
cafetariafoodmasterboskoop-boskoop.nl	Cafetaria Foodmaster Boskoop	Cafetaria Foodmaster Boskoop is an online platform allowing visitors to order food from the cafeteria in Boskoop.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
cafetarialorentzpleindenhaag.nl	Cafetaria Lorentzplein	The website of Cafetaria Lorentzplein in The Hague offers the possibility to order food online and view the menu.	Quick Bites → Cafeteria ⁹⁰⁶ Cooking & Recipes → Dishes ³³⁵	chicken dishes ²⁶ croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
damdonk-homecooking.nl	Damdonk Homecooking	The website Damdonk Homecooking offers a selection of recipes and ideas for homemade meals, with a focus on Indian dishes, but also other types of dishes such as Mexican, Italian and vegetarian.	Hobbies → Baking ³²⁹ Cooking & Recipes → Home Cooking ³⁵	puff pastry ¹² snack ²⁹¹⁶ recipe ⁵¹⁴²
pizza-marino-pizza-23-den-haag.nl	Pizza Marino & Pizza 23	The website of Pizza Marino & Pizza 23 offers the opportunity to order meals online in The Hague. It displays a comprehensive menu with pizzas, pasta, wraps, and other dishes.	Sandwiches & Salads → Italian Cuisine ⁹⁹	wrap ⁸²⁶ pasta ¹³⁸⁹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
afterpartykoning.nl	AfterpartyKoning	The website is an online shop that offers chilled drinks, snacks, and party rental, with a focus on fast home delivery, primarily in the Nieuwkuijk region.	Parties → Party Supplies ¹¹⁰⁸ Gifts & Souvenirs → Liquor Stores ²³³	can ⁴⁶ party rental ¹²⁴ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹	Heusden → Nieuwkuijk ¹⁷²
snackpaleisdijkje.nl	Snackpaleis T Dijkje	Snackpaleis T Dijkje is an online shop offering various snacks, dishes, and drinks, with delivery services available.	International → Turkish ⁴¹⁶ Mediterranean & Middle Eastern → Takeout ²⁸⁶	doner ¹³¹ shoarma ²⁵⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Haarlemmermeer → Spaarndam ²⁰⁷
bombaystreetfood-eindhoven.nl	Bombay Street Food	The Bombay Street Food website offers an online ordering service for street food in Eindhoven. Visitors can view the menu and order their favorite dishes online with the option for fast delivery.	Food Delivery → Indian Cuisine ⁵⁴³ Food Delivery → Indonesian ⁵⁰²	dumpling ⁴⁹ samosa ⁶⁰ main course ¹⁰² snack ²⁹¹⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
tiptopvelsennoord.nl	Tip Top Velsen-Noord	The Tip Top Velsen-Noord website is an online platform allowing customers to order takeaway or delivery items. It offers a wide menu of snacks, sandwiches, and salads, as well as special dishes such as party salads and assortment boxes.	Quick Bites → Snack Bar ⁵⁸⁰	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶
kookdan.nl	KOOK DAN!	The website 'KOOK DAN!' offers a collection of recipes, including vegan and vegetarian options, for various meals and snacks.	Cooking & Recipes → Vegan Recipes ¹¹ Cooking & Recipes → Vegetarian Recipes ¹³	ramen ¹⁰⁶ vegan ⁵⁰⁸ wrap ⁸²⁶ snack ²⁹¹⁶ recipe ⁵¹⁴²
snackbarrondeweibos.nl	Pay Fast Forward B.V.	The website of Snackbar Ronde Weibos offers online ordering for a wide range of dishes, drinks, and snacks, with the possibility of delivery to Rockanje.	Food Delivery → Delivery ²²²⁷ Sandwiches & Salads → Snacks ⁶⁹³	milkshake ¹⁹⁵ sauce ¹¹⁴¹ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	Voorne aan Zee → Rockanje ²⁹⁸
friterie-ijssalon-emmen-emmen.nl	Friterie IJssalon Emmen	The website of Friterie IJssalon Emmen offers online ordering for fries, snacks, and other dishes.	Food Delivery → Delivery ²²²⁷ Catering & Ready Meals → Takeaway ⁴⁰⁹	croquette ¹³⁶ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Drenthe → Emmen ³³⁴⁸
sushifriturewolder.nl	Sushi Friture Wolder	Sushi Friture Wolder is a restaurant located in Maastricht, Netherlands, offering sushi, fries, and other snacks with options for take-away, delivery, and catering.	Japanese → Sushi ⁹⁷¹ Online Ordering → Food Delivery ¹³	sushi ¹⁶⁹⁵ fries ²⁷⁵³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Limburg → Maastricht ⁶⁰⁰⁸
robinscatering.nl	Robin's Catering	The website of Robin's Catering showcases the catering services offered by the company, focusing on providing breakfast, lunch, snacks, and buffets for businesses and private events in the Badhoevedorp region.	Catering → Buffets ²⁷⁷	lunch ¹⁵³⁴ meal ¹⁶³⁸ buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶
horecavacatures-utrecht.nl	Horecavacatures	The website offers job postings for professionals in the hospitality industry, specifically for roles in cafetarias.	Japanese → Sushi ⁹⁷¹ Quick Bites → Cafeteria ⁹⁰⁶	cafetaria ²¹ salary ⁵¹³ snack ²⁹¹⁶ work ³¹²² hospitality ³⁴⁹¹	Utrecht → IJsselstein ¹¹⁰⁷
frietloungeheugemerveld-maastricht.nl	Frietlounge Heugemerveld	The website Frietlounge Heugemerveld in Maastricht offers the possibility to place online orders for fries, snacks, and other dishes.	Fast Food → Fries Restaurants ⁸⁷	croquette ¹³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Limburg → Maastricht ⁶⁰⁰⁸
spaansedingen.nl	Spaanse Dingen	The website Spaanse Dingen is a Spanish delicatessen shop located in Eindhoven, offering a wide range of Spanish products including wines, snacks, olives, cosmetics and paella ingredients.	Dairy → Cheese ⁵³⁰	olive ⁹² gift package ⁵³⁰ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
padthaidenhaag.nl	Pad Thai Scheveningen	The Pad Thai Scheveningen website offers online ordering for Thai and other dishes, with menu listings, reviews, and contact information. The website focuses on delivery services in Scheveningen and The Hague.	Asian → Thai ³⁰¹ Food Delivery → Delivery ²²²⁷	noodle soup ²⁴ pad thai ³¹ curry ³⁵⁵ rice ⁶³⁵ snack ²⁹¹⁶	The Hague → Scheveningen ¹⁶²⁵
cafetariareuver.nl	Cafetaria Reuver	Cafetaria Reuver is a cafe in Reuver that serves a variety of snacks and meals, with seasonal offerings and special dishes.	Quick Bites → Cafeteria ⁹⁰⁶	croquettes ¹⁰⁸ asparagus ¹⁸⁶ nasi ²⁴² snack ²⁹¹⁶ dish ⁵⁹³⁶
cafetariaborger.nl	Cafetaria Borger	Cafetaria Borger is a cafe located in Borger that offers a wide range of snacks, burgers, fried potatoes, sandwiches, and salads.	Quick Bites → Snack Bar ⁵⁸⁰ Quick Bites → Cafeteria ⁹⁰⁶	burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ terrace ⁴⁸⁴⁷	Borger-Odoorn → Borger ²⁸⁸
cafetariadegraaf.nl	Cafetaria de Graaf	The website of Cafetaria de Graaf presents the cafeteria with its range of snacks and meals, located in Rijssen, and provides information about opening hours and contact details.	Quick Bites → Cafeteria ⁹⁰⁶	platter ⁶⁶ cafeteria ¹⁶⁹ vegetarian ³³⁷ snack ²⁹¹⁶	Rijssen-Holten → Rijssen ¹⁰⁴⁸
dapurisa.nl	Dapur Isa	Dapur Isa is an online shop that delivers Indonesian snacks and dishes to Haarlem and Santpoort.	Food Delivery → Indonesian ⁵⁰² Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	snack ²⁹¹⁶ newsletter ⁶⁵⁰⁴	Velsen → Santpoort-Noord ⁶⁰⁶
dogactive.nl	Dogactive	The website dogactive.nl offers 100% natural dog snacks, food, and supplements, as well as private detection training for dogs.	Animals → Pet Stores ⁴⁷⁸	supplement ¹⁹⁶⁸ snack ²⁹¹⁶ food ³⁸⁷² training ²⁸¹³³
mooksopzond.nl	Mooks op Zond	Mooks op Zond is a company that organizes catering with beers and snacks for groups of people.	Beverages → Beer ¹⁰⁹⁵ Gifts & Souvenirs → Liquor Stores ²³³	beer ²⁸⁸⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
broodjeszaak-can.nl	Broodjeszaak Can Bussum	The website of Broodjeszaak Can Bussum offers an online ordering system for a wide range of dishes, including sandwiches, wraps, Turkish pizzas, döner boxes, snacks, burgers, and dishes, which are delivered locally in Bussum.	Online Ordering → Delivery Restaurants ⁷² Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ wrap ⁸²⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Gooise Meren → Bussum ²²⁰¹
maaltijdtogo.nl	Maaltijd To Go Doetinchem	The website of Maaltijd To Go Doetinchem is an online platform where customers can order burgers and snacks for delivery or pickup.	Cafeteria → Dutch Cafeteria ¹²²	points ⁶¹² burger ¹⁴³¹ snack ²⁹¹⁶ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Gelderland → Doetinchem ²⁷⁰⁶
onlinedierenvoershop.nl	Brekz	The website offers online pet food and accessories, focusing on affordable prices and fast delivery.	Animals → Pet Food ⁵⁸⁴ Animals → Dogs ⁵⁸⁷⁹	leash ⁶⁹ cat ¹⁵⁷⁸ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³ accessories ¹²⁹⁷⁵
vulcano-online.nl	Vulcano	The website Vulcano Online bestellen is an online shop where customers can order a variety of dishes, salads, sandwiches and snacks for delivery to their home. The website offers a wide selection of popular dishes and snacks, including katsups, pizzas, sandwiches and rolls.	Food → Restaurants & Dining ²⁷³²⁵	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ dish ⁵⁹³⁶	Altena → Hank ¹¹³
bij-ons-eten-en-drinken-groningen.nl	Bij Ons Eten en Drinken	The aim of the website Bij Ons Eten en Drinken is to provide customers with the opportunity to order meals and drinks online.	Catering & Ready Meals → Indonesian Restaurant ³⁹² Pastries & Baked Goods → Menus ²²³	satay ³²⁰ burger ¹⁴³¹ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Netherlands → Groningen ²³⁷³⁴
happieness.nl	Happieness - Catering Best	The website Happieness - Catering Best in Waalre offers catering services for various occasions, providing fresh, homemade snacks and dishes.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	soup ¹⁰⁴³ snack ²⁹¹⁶ arrangement ³¹⁰⁴ sandwich ⁴⁰⁹⁸ package ⁶¹¹²
automatiekandrejansenkampen.nl	Automatiek Andre Jansen	The website of Automatiek Andre Jansen in Kampen allows users to order meals online, featuring a comprehensive menu and various snacks and drinks.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Overijssel → Kampen ²¹⁶¹
restaurant-ellies.nl	Restaurant ELLIES	Restaurant ELLIES is a restaurant located in Schiedam that offers online ordering of meals and dishes.	Online Services → Ordering ¹²¹ Mediterranean & Middle Eastern → Lebanese Restaurant ⁴⁴	rice ⁶³⁵ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Schiedam ²²⁴⁹
snackmobiel-roodbeen.nl	Snackmobiel Roodbeen	Snackmobiel Roodbeen is a company that delivers snacks and lunch to individuals, at parties, and for businesses in the Neder-Betuwe.	Fast Food → Fries ⁹⁴⁹ Food → Foodservice & Catering ⁵⁷⁷	mobile ²⁴³ snack ²⁹¹⁶ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Neder-Betuwe → Dodewaard ²²²
my2l.nl	MY2L	MY2L is an online store specializing in dog toys and snacks.	Dogs → Supplies ¹⁰⁰⁵ Children → Supplies ¹⁴	toy ²²⁹⁵ snack ²⁹¹⁶ innovation ⁴⁶⁵⁹	Altena → Almkerk ¹⁵⁹
cateringhuisman-almelo.nl	Huisman Partyservice and Catering	The website of Huisman Partyservice and Catering in Almelo presents a catering company that has been operating since 1982 and offers a variety of party snacks, sandwiches, salads and hot and cold dishes.	Quick Bites → Snack Bar ⁵⁸⁰ Parties → Party Supplies ¹¹⁰⁸	salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶	Overijssel → Almelo ²⁶⁹⁶
hondenvoer-bestellen.nl	hondenvoer-bestellen.nl	The website provides information and a platform for ordering dog food online.	E-Commerce → Pet Supplies ¹⁰¹³	dog biscuits ¹⁶ dog food ²⁰⁴ online store ⁹⁰⁵ snack ²⁹¹⁶
spareribskingsate4you-rotterdam.nl	Spareribs King Sate 4 You	The website of Spareribs King Sate 4 You in Rotterdam offers the possibility to order meals online, with an extensive menu and various options for ribs, chicken, beef, and other dishes.	Fast Food → Burgers ⁶⁸⁷ Mediterranean & Middle Eastern → Takeout ²⁸⁶	combo meal ⁶⁵ rib ¹⁹¹ appetizer ⁵⁵⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
collegasarnhem.nl	Eetcafe Collega's	The website of Eetcafe Collega's in Arnhem provides the option to order online, have food delivered, or pick it up.	Food Delivery → Delivery ²²²⁷	plate ⁷⁸⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹ order ⁶⁹¹²	Gelderland → Arnhem ⁸⁶⁸⁰
foodzbysha.nl	FoodzBySha	FoodzBySha is a catering company that provides sandwiches, meals, and snacks on location, with the goal of sharing the pleasure of eating.	Fast Food → Fries ⁹⁴⁹	beverage ⁵⁸⁶ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶
cafetariamariaberg.nl	Cafetaria Mariaberg Maastricht	The website of Cafetaria Mariaberg in Maastricht provides an online ordering system and information about the menu, opening hours, and customer reviews.	Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² app ⁴⁵⁹⁵ order ⁶⁹¹² menu ¹³⁸⁵⁶	Limburg → Maastricht ⁶⁰⁰⁸
het-frietje.nl	Cafetaria 't Frietje	The website of Cafetaria 't Frietje allows customers to order food online, including fries, sandwiches, snacks, and drinks, with delivery options available. The site also features special offers and a menu with various choices.	Fast Food → Fries ⁹⁴⁹ Lunch → Sandwiches ⁴⁶⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Gelderland → Ede ⁵¹⁰⁴
cafetaria-happyfood-driebergen.nl	Cafetaria de Sluis Driebergen-Rijsenburg	Cafetaria de Sluis Driebergen-Rijsenburg is a cafeteria located in Driebergen-Rijsenburg that accepts online orders for various snacks, fries, and sandwiches.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Cafeteria ⁹⁰⁶	family pack ²⁴ beverage ⁵⁸⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Utrecht Hill Ridge → Driebergen-Rijsenburg ²³⁷
florinsdelicatesse.nl	FlorinsDelicatesse	FlorinsDelicatesse is a caterer offering fresh cakes, luxury snacks, desserts, and homemade salads prepared with passion and unique recipes using natural ingredients from the Achterhoek.	Hobbies → Baking ³²⁹	cake ¹⁷³⁰ salad ²⁴⁴⁴ snack ²⁹¹⁶ recipe ⁵¹⁴² catering ⁶⁴⁵⁶ order ⁶⁹¹²
cafetaria-gemonde.nl	Cafetaria Gemonde	The website of Cafetaria Gemonde allows users to order food online from the cafeteria located in Gemonde. The website features the full menu, including fries, snacks, sandwiches, salads, and beverages.	Fast Food → Fries ⁹⁴⁹ Food Delivery → Delivery ²²²⁷	croquette ¹³⁶ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Sint-Michielsgestel → Gemonde ⁸⁵
cookwithmanouk.nl	Avant van Kaira	The website offers healthy snacks and high tea/brunch catering services.	Nutrition → Healthy Eating ⁶³⁴ Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	high tea ⁵⁸⁵ time ⁹³² snack ²⁹¹⁶ catering ⁶⁴⁵⁶ price ⁸³²⁸	Sint-Michielsgestel → Berlicum ³²⁷
baohausbytc-rotterdam.nl	Bao Haus by T&C	The website Bao Haus by T&C provides an online ordering system for food in Rotterdam, offering a menu of rice dishes, bao buns, snacks, and bubble tea.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	bao bun ¹⁶ rice dishes ⁷⁶ bubble tea ¹⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbarvollenhove.nl	Snackbar ’t Akkertien	The website of Snackbar ’t Akkertien presents the opening hours, location, and facilities of a snack bar located on Vakantiepark ’t Akkertien in Vollenhove, with the possibility of online ordering.	Accommodation → Holiday Parks ¹⁰²⁴ Quick Bites → Snack Bar ⁵⁸⁰	snack bar ¹⁶² holiday park ⁵⁶⁶ ice cream ¹⁰⁰⁰ snack ²⁹¹⁶ terrace ⁴⁸⁴⁷	Steenwijkerland → Vollenhove ²⁰⁷
cafetariadegrotebeer.nl	Cafetaria De Grote Beer Groningen	The website of Cafetaria De Grote Beer is a snack bar/cafeteria located in Groningen, Paddepoel, offering specialties and providing information about its history, specialties, opening hours, contact details, and recent news.	Quick Bites → Snack Bar ⁵⁸⁰ Food → Direction ⁴⁹	specialty ²²⁹ facebook ⁸⁵⁰ snack ²⁹¹⁶ news ¹⁵²⁹³	Groningen → West ¹⁴¹
gezelligsloepen.nl	Gezellig Sloepen	Gezellig Sloepen offers sloop rentals with skippers, including wine and snacks, for enjoying exclusive boat trips in and around Utrecht.	Water Travel → Boat Tours ⁶⁴⁰ Water Recreation → Sloop Rental ¹⁴	skipper ¹⁵⁶ sloop ²⁷² tour ²³¹⁵ snack ²⁹¹⁶ wine ⁴⁴⁷⁶	Voorst → Terwolde ¹²⁶
vandersteensnacks.nl	Van der Steen Snacks	Van der Steen Snacks is a snack bar and restaurant located in Bleiswijk, Lansingerland, offering a variety of snacks, sandwiches, and beverages.	Quick Bites → Snack Bar ⁵⁸⁰ Sandwiches & Salads → Snacks ⁶⁹³	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
wenderz.nl	Wenderz Home Horeca Vacatures	Wenderz Home Horeca Vacatures is a website offering vacancies and information about the hospitality experience.	Fast Food → Fries ⁹⁴⁹ Business → Industry ³⁶⁹⁷⁷	part-time job ⁴⁴ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹²
grills-fastfood-amsterdam.nl	Grill's Fastfood	Grill's Fastfood, a fast food restaurant located in Amsterdam, offers online ordering for a wide variety of fast food items, including snacks, burgers, and fries.	Fast Food → Chicken Dishes ⁹²	bucket ¹¹³ wrap ⁸²⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ menu ¹³⁸⁵⁶	North-Holland → Amsterdam ⁴¹²⁵³
snackbardenbosch.nl	Snackbar Restaurant 's-Hertogenbosch	The website of Snackbar Restaurant 's-Hertogenbosch provides information about the restaurant, including the menu, location, opening hours, and contact details.	Quick Bites → Cafeteria ⁹⁰⁶	seating area ²⁶ salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Brabant → 's-Hertogenbosch ⁸⁸⁶⁸
snackbartsmikkelhuus.nl	Snackbar 't Smikkelhuus	The website of Snackbar 't Smikkelhuus in Hoogeveen offers online ordering options for a wide range of snacks, fries and drinks. Visitors can view the menu and place online orders here.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	loaded fries ⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Drenthe → Hoogeveen ²²⁹⁴
heilooerdijk.nl	Heilooerdijk Alkmaar	This website serves as an invitation to a neighborhood party (buurtborrel) in Heilooerdijk Alkmaar, a repeat of a successful event from last year.	Local Events → Neighborhood Events ⁵⁷ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	hotdog ³⁵ bouncy castle ³⁶⁶ snack ²⁹¹⁶ music ¹³¹⁷⁰	North-Holland → Alkmaar ⁶⁵⁰⁷
julias-den-haag-cs.nl	Julia's Den Haag CS	The website of Julia's Den Haag CS is an online ordering platform where customers can order dishes from the restaurant in The Hague.	Food Delivery → Italian Restaurant ¹⁰⁴⁰	sap ¹²⁰ pasta ¹³⁸⁹ salad ²⁴⁴⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
nouveausiensien.nl	Sien Sien	The website Sien Sien allows customers to order food online from the restaurant Sien Sien in Rotterdam.	Catering & Ready Meals → Chinese Cuisine ¹⁸⁷	dim sum ⁸⁷ snack ²⁹¹⁶ drink ⁵¹⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
cafetaria-t-smulhuis-hoensbroek.nl	Cafetaria 't Smulhuis	Cafetaria 't Smulhuis is a cafe in Hoensbroek that accepts online orders for a wide range of snacks, fries and meals.	Food Delivery → Delivery ²²²⁷ Quick Bites → Cafeteria ⁹⁰⁶	fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	Heerlen → Hoensbroek ³⁷¹
mjbcatering.nl	MJB Catering	MJB Catering is a catering company that also offers rental services for events, focusing on Dutch snacks and fries, as well as seafood dishes.	Property Rentals → Rental ¹¹⁶⁹ Economy → Retail & Commerce ⁹⁹⁴¹	seafood ¹⁴⁸ snack ²⁹¹⁶ catering ⁶⁴⁵⁶ rental ⁷²⁵⁷ event ⁴⁵¹⁹⁹
nederlandshop.nl	Nederlandshop.nl	Nederlandshop.nl is a website showcasing various articles and product categories.	Freight & Logistics → Trucks ⁸⁹⁹	comfort ¹⁴⁷³ inventory ¹⁶¹³ battery ¹⁷⁵¹ snack ²⁹¹⁶ shop ⁶⁴⁸³ clothing ⁹⁴⁴³
bodrum-eethuis-rotterdam.nl	Bodrum Eethuis	This website allows you to order food online from Bodrum Eethuis in Rotterdam.	Turkish Cuisine → Takeout Restaurant ⁸¹ Turkish Cuisine → Fast Food ³²²²	döner ⁶⁷³ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
eetcafe-de-wilhelminaboom-dordrecht.nl	Eetcafé De Wilhelminaboom	The website of Eetcafé De Wilhelminaboom offers online ordering for a wide range of sandwiches, snacks, and hot meals from Dordrecht.	Bakery & Food Production → Bread ⁷⁶⁵	bread ¹⁶²² meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Dordrecht ⁴⁵³¹
tasteseecatering.nl	TasteSee Catering	TasteSee Catering is a catering business specializing in Moluccan and Indian cuisine, with a food truck that regularly visits Epe.	Cooking & Recipes → Cuisine ¹¹⁴⁷	indian cuisine ²⁸ sambal ⁵⁴ foodtruck ⁶¹³ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
lotgering-by-schrader.nl	Lotgering by Schrader BV	The website lotgering-by-schrader.nl offers natural, raw meat food and snacks for dogs and cats, with the goal of improving the health and well-being of pets.	Animals → Pet Food ⁵⁸⁴	cat ¹⁵⁷⁸ supplement ¹⁹⁶⁸ meat ²⁰⁵⁵ snack ²⁹¹⁶ food ³⁸⁷² dog ⁵⁴⁸³
debuikspieren.nl	debuikspieren.nl	The website provides information and examples of balanced snacks that can help achieve a slimmer figure and improve nutrition.	Healthy Food → Snacks ²²	calories ⁷⁴ iron ²³⁷ protein ²⁹⁹ snack ²⁹¹⁶ nutrition ⁴⁹³⁵
thevy.nl	The Vy	The website of The Vy is an Asian wholesaler and snack production company specializing in the production and sale of Vietnamese fried snacks, primarily for the hospitality sector.	Commerce → Wholesale ¹⁸⁵⁵ Essential → Food ⁴⁷⁹⁹⁹	wholesaler ²²⁵ producer ⁴⁶⁴ snack ²⁹¹⁶ hospitality ³⁴⁹¹ recipe ⁵¹⁴²
het-haasje.nl	Cafetaria Het Haasje	Cafetaria Het Haasje is an online webshop and restaurant located in Maassluis, offering a wide selection of snacks, sandwiches, meals, and beverages, including fries, Turkish pizza, salads, and various value menus. Delivery is possible.	Quick Bites → Cafeteria ⁹⁰⁶ Coffee & Tea → Beverages ⁴⁴⁵³	salad ²⁴⁴⁴ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Maassluis ⁹⁸⁸
cammeraatcatering.nl	Cammeraat Catering	Cammeraat Catering is a catering company based in Zoetermeer that offers a variety of catering services.	Events & Hospitality → Corporate Catering ²⁶⁷	walking dinner ²² bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	South-Holland → Zoetermeer ⁴⁰⁴⁶
cafetariarubensstraat-eindhoven.nl	Cafetaria Rubensstraat	The website Cafetaria Rubensstraat, located in Eindhoven, offers an online ordering system for a variety of snacks, fries, and drinks.	Fast Food → Fries ⁹⁴⁹	burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹ order ⁶⁹¹² menu ¹³⁸⁵⁶	North-Brabant → Eindhoven ¹¹⁸⁴⁵
frituurvriend.nl	Frituurvriend	The Frituurvriend website offers an app to track the times of snacks cooked in a deep fryer.	Apps → Productivity ²⁴ Cooking & Recipes → Frying ¹³	time ⁹³² snack ²⁹¹⁶ app ⁴⁵⁹⁵
joannsdenhaag.nl	Joann's	The website of Joann's in The Hague offers the possibility to order meals online from a diverse menu with various dishes, snacks, extras and drinks.	Food Delivery → Indonesian ⁵⁰² Food Delivery → Surinamese ²⁶⁵	nasi ²⁴² rice ⁶³⁵ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → The Hague ¹⁹⁸⁹⁸
puurvis-leidschenveen-den-haag.nl	Puurvis	The Puurvis website offers online ordering for baked fish, snacks, and sandwiches in The Hague. Visitors can view the menu and order directly online.	Restaurants & Dining → Seafood Restaurants ⁶¹²	baked fish ¹² menus ²²¹ sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → The Hague ¹⁹⁸⁹⁸
petsnek.nl	Petsnek	Petsnek.nl is an online store selling snacks, food, and accessories for various pets.	Animals → Pets ¹³⁸² Pet Supplies → Pet Nutrition ¹⁸	bone ³⁵ cooling ³²⁰ toy ²²⁹⁵ snack ²⁹¹⁶ food ³⁸⁷² accessories ¹²⁹⁷⁵
toetanchamonbezorgd.nl	Toetanchamon Den Helder	The website Toetanchamon Den Helder is an online restaurant where customers can order online and order a wide range of dishes, including ribs, chicken dishes, pizzas, sandwiches and snacks.	Grilling & Steaks → Meat Dishes ⁴⁰	chicken dishes ²⁶ rib ¹⁹¹ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸
linchos.nl	Linchos Home	Linchos Home offers a variety of dishes and menus, including tasting plates and surprise menus, for small and large groups.	Mediterranean & Middle Eastern → Takeout ²⁸⁶ Restaurants & Dining → Takeaway Restaurants ²⁴⁰	platters ⁵⁴ snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶
habesha-dukan.nl	Habesha Hindi Dukan	Habesha Hindi Dukan is an online retailer specializing in Ethiopian and Indian products.	Coffee & Tea → Specialties ¹⁶⁴	flour ¹⁴³ spices ³⁴⁰ cosmetics ⁶⁴⁸ snack ²⁹¹⁶ coffee ³⁸³⁸ jewelry ⁴⁵⁹⁹
guiltfreepleasures.nl	Guilt-Free Pleasures	The website Guilt-Free Pleasures provides a platform for finding healthier and tasty alternatives to popular 'feelgood' foods and drinks, without sacrificing flavor.	Blogs → Food Blogs ²⁴⁶ Nutrition → Healthy Eating ⁶³⁴	granola ⁶⁵ alternative ¹⁰⁸ chip ¹³⁸ snack ²⁹¹⁶ food ³⁸⁷² drink ⁵¹⁹¹
deweidetafel.nl	De Weidetafel	De Weidetafel is a catering company offering bespoke catering solutions, with a focus on enhancing customers’ experiences.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Personal Development → Inspiration ¹²⁰	dream ⁸⁸³ trust ¹¹⁴⁷ snack ²⁹¹⁶ catering ⁶⁴⁵⁶
bierkoerierzwolle.nl	Bierkoerierzwolle.nl	Bierkoerierzwolle.nl is an online shop that delivers beverages, soft drinks, and snacks in the Zwolle area.	Delivery → Beer Delivery ¹¹ Coffee & Tea → Beverages ⁴⁴⁵³	soft drinks ⁸⁷ alcohol ¹⁵⁰ beer ²⁸⁸⁷ snack ²⁹¹⁶	Overijssel → Zwolle ⁷³⁹⁵
maxborrelbox.nl	Maxwijn	The MaxBorrelbox website offers complete party boxes, consisting of various snacks and drinks, suitable for private and business occasions or as a gift.	Parties → Party Supplies ¹¹⁰⁸ Outdoor → Play Equipment ³¹³	party box ³⁵ beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹	Limburg → Heerlen ²⁷⁵⁵
sandrinastapas.nl	Sandrina's Tapas & Zo	Sandrina's Tapas & Zo is a webshop offering various tapas, buffets, and snacks, with the option to order custom-made items.	Spanish Restaurants → Tapas ²⁹	deposit ¹³⁵ plank ¹⁶² tapas ⁴⁶⁵ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ order ⁶⁹¹²
hetrijdendebroodje.nl	The Rijdende Broodje	The Rijdende Broodje provides snack catering with Dutch specialties on location throughout the Netherlands.	Fast Food → Fries ⁹⁴⁹ Cooking & Recipes → Dishes ³³⁵	snack ²⁹¹⁶ hospitality ³⁴⁹¹ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
popijohninternationaal-rotterdam.nl	Popi John Kitchen	Popi John Kitchen is an online restaurant in Rotterdam that allows customers to order food online.	Quick Bites → Online Restaurant ¹⁰⁹	bami ¹⁴⁴ nasi ²⁴² snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
antakyabakkerij-amsterdam.nl	Antakya Bakkerij	The Antakya Bakkerij website, located in Amsterdam, allows customers to order food online, including Turkish pizzas, döners, sandwiches, and various other treats.	Turkish Cuisine → Fast Food ³²²² Meal Solutions → Food Businesses ⁵⁷	pide ⁵⁶ döner ⁶⁷³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
darrascoffeeroastersamsterdam.nl	Darras Sandwiches	Darras Sandwiches is an online ordering service for sandwiches, salads, snacks, and drinks in Amsterdam.	Sandwiches & Salads → Sandwich Shops ²²⁹	wrap ⁸²⁶ bread ¹⁶²² salad ²⁴⁴⁴ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
goedlekker.nl	GoedLekker	The GoedLekker.nl website is an online platform offering a variety of recipes and information about tasty food.	Food → Cooking & Recipes ³⁹⁸⁹	dessert ⁴⁹⁶ appetizer ⁵⁵⁶ sauce ¹¹⁴¹ snack ²⁹¹⁶ recipe ⁵¹⁴² dish ⁵⁹³⁶
late-at-night.nl	Late at Night Hengelo	The Late at Night Hengelo website is an online store where customers can order alcoholic beverages, snacks and other products which are then delivered to their homes.	Delivery → Beer Delivery ¹¹ Dairy & Cheese → Delicatessens ⁶¹⁷	alcohol ¹⁵⁰ snack ²⁹¹⁶ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Overijssel → Hengelo ³⁴⁹⁹
thespicyguru.nl	TheSpicyGuru.nl	The website ShopinDuitsland! offers the possibility to order groceries and various products, including Surinamese dishes, from Germany and have them delivered in the Netherlands.	Online Retail → Food Retail ³⁴⁰ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	grill ⁵⁶² pastries ⁹⁴⁶ promotion ²⁰⁶² snack ²⁹¹⁶
deloempiakar.nl	Loempiakar.nl	The website Loempiakar.nl offers catering services specializing in loempia's (dumplings) and other Asian snacks, both at fixed locations and on-site for events and parties.	Quick Bites → Snack Bar ⁵⁸⁰	snack ²⁹¹⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Hilvarenbeek → Haghorst ⁵¹
pizza-express-snackpoint.nl	Snackpoint de Korenbloem	The website of Snackpoint de Korenbloem in Bennekom allows users to order food online, including fries, snacks, sandwiches, sauces, and drinks.	Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Ede → Bennekom ⁵⁵⁷
snackbardespits-rotterdam.nl	Snackbar de Spits	The website of Snackbar de Spits in Rotterdam allows users to order food online and view the menu.	Fast Food → Fries ⁹⁴⁹ Fast Food → Burger Restaurants ³⁴⁶	hamburger ³⁶⁴ sauce ¹¹⁴¹ meal ¹⁶³⁸ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackbarhola-leeuwarden.nl	Snackbar Hola	Snackbar Hola is an online ordering platform for snacks and meals located in Leeuwarden. Visitors can view menus and place orders online.	Fast Food → Burgers ⁶⁸⁷	bucket ¹¹³ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Friesland → Leeuwarden ⁶⁰⁶⁸
nonstopdrinks.nl	Nonstop Drinks	Nonstop Drinks is a company that provides a 24-hour delivery service for drinks and snacks in the Amsterdam region.	Food Delivery → Delivery ²²²⁷ Beverages → Beer ¹⁰⁹⁵	beer ²⁸⁸⁷ snack ²⁹¹⁶ wine ⁴⁴⁷⁶ drink ⁵¹⁹¹	Zaanstad → Zaandam ²⁷⁴⁰
mobielekeukens.nl	Mobielekeukens.nl	Mobielekeukens.nl is an online database providing data and knowledge for caterers and mobile kitchen owners.	Resources → Databases ³⁴⁸ Catering → Mobile Catering ⁸⁷	fry ⁵⁹ snack ²⁹¹⁶ concept ³³³⁸ vehicle ³⁷⁴³ kitchen ⁶⁴⁴³ energy ⁹⁰⁷⁵
dayminimarkt.nl	Day minimarkt	Day minimarkt is a shop that daily sells fresh and healthy products, including sandwiches, salads and coffee.	Commerce → Shopping Centers ¹⁰⁰¹ Food → Supermarkets & Grocery ³⁵⁶⁸	salad ²⁴⁴⁴ snack ²⁹¹⁶ coffee ³⁸³⁸ sandwich ⁴⁰⁹⁸ safety ⁵⁸¹⁹	Utrecht → Nieuwegein ²²⁶⁴
mavodrunen.nl	Reunion JP van Rooij Mavo 1986	This website provides information about the reunion of former students of J.P. van Rooij Mavo 1986, which took place on November 18, 2017, at the Zeuve Lantaarns.	Secondary Education → Mavo ⁴¹ Fundraising & Charity → Reunions ⁷⁷	former students ¹¹ reunion ²⁶⁷ facebook ⁸⁵⁰ snack ²⁹¹⁶ photo ⁷⁷⁷⁸ music ¹³¹⁷⁰	Maashorst → Schaijk ³¹⁰
thesmallkitchen.nl	The Small Kitchen	The website ‘The Small Kitchen’ is a foodblog that regularly publishes recipes and reviews, primarily focused on small quantities and snacks.	Blogs → Food Blogs ²⁴⁶	vanilla ²⁰ raspberry ³¹ chocolate ⁹¹¹ review ¹⁸⁸⁸ snack ²⁹¹⁶
kiesvoorjegeluk.nl	Geluk024	The website ‘Choose for your luck’ presents a collection of recipes and meal ideas, with a seemingly humorous tone. However, the content is largely nonsense and not useful.	Entertainment → Humor ²¹⁶ Food → Cooking & Recipes ³⁹⁸⁹	stew ⁶² meal ¹⁶³⁸ breakfast ¹⁸²² snack ²⁹¹⁶ recipe ⁵¹⁴²
luckylucsnacks-maastricht.nl	Lucky Luc Snacks	The Lucky Luc Snacks website, located in Maastricht, allows customers to order food online, featuring a comprehensive menu of fries, snacks, sandwiches, and drinks.	Fast Food → Fries ⁹⁴⁹	sauce ¹¹⁴¹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	Limburg → Maastricht ⁶⁰⁰⁸
snackbarrocky-ijmuiden.nl	Snackbar Rocky	Snackbar Rocky is an online ordering platform for food and snacks located in IJmuiden.	Fast Food → Fries ⁹⁴⁹	frikandel ¹⁸ hamburger ³⁶⁴ kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	Velsen → IJmuiden ¹¹⁰⁹
de-smickel.nl	Smularia de Smickel	The website of Smularia de Smickel presents a fast-food restaurant offering a wide range of fries, snacks, dishes, and ice cream, as well as children's parties.	Quick Bites → Cafeteria ⁹⁰⁶	childrens party ¹⁴² ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ menu ¹³⁸⁵⁶
luckyhillsnacks-tilburg.nl	Lucky Hill	The Lucky Hill website in Tilburg allows customers to order food online and view the menu featuring various dishes, snacks, and drinks.	Quick Bites → Snack Bar ⁵⁸⁰ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	satay ³²⁰ plate ⁷⁸⁷ fries ²⁷⁵³ snack ²⁹¹⁶ drink ⁵¹⁹¹	North-Brabant → Tilburg ⁸⁷⁵⁹
snackbartraay.nl	Snackbar Traay	The website of Snackbar Traay in Driebergen-Rijsenburg allows customers to order snacks and other food items online, with options for delivery or pick-up. It also provides information, menus, and customer reviews.	Quick Bites → Snack Bar ⁵⁸⁰	menus ²²¹ fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Utrecht Hill Ridge → Driebergen-Rijsenburg ²³⁷
amsterdamfilipinostore.nl	Amsterdam Filipino Store	The website Pinoy Food Dolly's Groceries is an online store offering authentic Filipino food products and ingredients, with a focus on snacks, ingredients and ingredient mixes.	Mexican & South American → International Cuisine ⁴¹¹	noodles ¹⁹¹ ingredients ²³⁴⁶ snack ²⁹¹⁶ drink ⁵¹⁹¹ assortment ⁷⁷⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
chickenmafia.nl	Chicken Mafia Nederland B.V.	The Chicken Mafia website offers online ordering and takeaway options for Dutch chicken dishes, catering services, and franchise opportunities.	Food & Beverage → Franchising ²⁵⁴ Fast Food → Chicken Dishes ⁹²	franchise ²⁸⁴ chicken ⁹⁴⁴ snack ²⁹¹⁶ store ³⁹⁰¹ catering ⁶⁴⁵⁶ order ⁶⁹¹²	South-Holland → Rotterdam ²⁵⁰⁴⁸
counterwalburg.nl	Counter Walburg	Counter Walburg is a fast-food restaurant and snack bar located in Zwijndrecht, Netherlands, that has been operating for over 40 years and is now owned by the Roodnat family.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Fries ⁹⁴⁹	hamburger ³⁶⁴ ice cream ¹⁰⁰⁰ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ party ⁵⁹²⁸	South-Holland → Zwijndrecht ¹⁴⁵⁵
dekaaidraaier.nl	Kaaidraaier	The Kaaidraaier is a vessel operating on the water, selling goods in the vicinity of Landsmeer, offering a wide range of beverages, snacks, and sandwiches.	Water → Boats ⁹³⁵ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	vessel ²⁶² beverage ⁵⁸⁶ goods ⁶⁶⁶ snack ²⁹¹⁶	North-Holland → Landsmeer ⁴¹³
webshop.bakkerpim.nl	Bakkerij Pim	Bakkerij Pim's website provides online ordering for a variety of baked goods and snacks.	Bakery & Food Production → Bread ⁷⁶⁵ Pastry → Cakes ⁸²⁶	apple pie ⁹⁸ baked goods ¹⁴⁸ cookie ⁶⁰² bread ¹⁶²² cake ¹⁷³⁰ snack ²⁹¹⁶
cateringexpresse.nl	Catering Expresse Zaanstreek	Catering Expresse Zaanstreek is a catering company that provides lunches, sandwiches, snacks and buffets for business and private events.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Venues → Party Venues ³⁶³	lunch ¹⁵³⁴ buffet ¹⁷⁴⁷ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Amsterdam → Zunderdorp ⁷³¹
defrietsalon.foodmaster.nl	Foodmaster de Frietsalon	Foodmaster de Frietsalon is a frituurzaak (fry shop) in Maasland that offers fries, snacks, and burgers for pickup or delivery.	Websites → Ordering Sites ⁷⁵ Economy → Employment & Labor ⁶⁰⁵⁹	pickup ⁷³⁶ burger ¹⁴³¹ fries ²⁷⁵³ snack ²⁹¹⁶	Midden-Delfland → Maashorst ²⁷⁵
delispizza.ordersys.nl	Deli's Pizza Italia Thuisbezorging V.O.F.	Deli's Pizza Italia is an online platform offering pizza, snacks, and beverages for home delivery.	Fast Food → Fries ⁹⁴⁹	toppings ¹⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸ drink ⁵¹⁹¹
dewissel.snackbesteld.nl	SnackBesteld.nl	SnackBesteld.nl is a website that allows customers to order snacks online from various snack specialists in the Netherlands, with the option of pickup or delivery.	Quick Bites → Cafeteria ⁹⁰⁶	cafeteria ¹⁶⁹ fries ²⁷⁵³ snack ²⁹¹⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Hardenberg → Dedemsvaart ⁴¹³
popijohnchips.nl	Popi John Internationaal	The website of Popi John Internationaal is an online shop selling authentic, handmade Surinamese snacks and meals, with a physical pick-up location in Rotterdam.	Coffee & Tea → Specialties ¹⁶⁴	chip ¹³⁸ pickup ⁷³⁶ meal ¹⁶³⁸ snack ²⁹¹⁶ order ⁶⁹¹²	South-Holland → Rotterdam ²⁵⁰⁴⁸
snackjacker.nl	SnackJacker Dalfsen	The SnackJacker Dalfsen website is an online platform where visitors can order snacks, fries, and other meals for takeaway or catering.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fries ²⁷⁵³ snack ²⁹¹⁶ app ⁴⁵⁹⁵ party ⁵⁹²⁸ menu ¹³⁸⁵⁶	Overijssel → Dalfsen ¹⁰⁹⁹
vondelhoek.nl	Cafetaria Vondelhoek	Cafetaria Vondelhoek is a snack bar located in Zevenaar that offers a variety of fries, snacks, and sandwiches, including vegetarian options. They are known for their high quality and responsible frying.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	fry ⁵⁹ croquette ¹³⁶ vegetarian ³³⁷ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸	Gelderland → Zevenaar ¹⁵⁰⁸
snackhuisrembrandt.nl	Snackhuis Rembrandt	Snackhuis Rembrandt in Hardenberg is a restaurant and snack bar that accepts online orders and offers customers the opportunity to earn points for discounts.	Quick Bites → Snack Bar ⁵⁸⁰	patat ²¹ points ⁶¹² fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Overijssel → Hardenberg ²³⁰⁹
tinybites.nl	Tiny Bites	Tiny Bites is a modern 'micromarket' offering a variety of snacks, drinks, and meals.	Quick Bites → Cafeteria ⁹⁰⁶ Human Resources → Payroll ⁵¹⁵	hour ³⁶⁵ meal ¹⁶³⁸ snack ²⁹¹⁶ drink ⁵¹⁹¹	Zutphen → De Hoven ¹⁹
tjinstoko-amsterdam.nl	Tjin's Toko	Tjin's Toko is an online ordering platform for food from Amsterdam, where customers can choose from a diverse menu of sandwiches, meals, snacks, and drinks.	Food Delivery → Indonesian ⁵⁰² Coffee & Tea → Beverages ⁴⁴⁵³	roti ³⁰³ meal ¹⁶³⁸ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹	North-Holland → Amsterdam ⁴¹²⁵³
speeddateinarnhem.nl	SPEEDDATE ARNHEM	The website SPEEDDATE ARNHEM offers speed dating events for singles in Arnhem.	Social Media → Dating ¹⁶⁴⁴ Entertainment → Social & Events ³³⁸	speeddate ⁵³ hostess ¹⁶⁵ evening ²⁸⁷ snack ²⁹¹⁶ match ³⁴⁷¹	Gelderland → Arnhem ⁸⁶⁸⁰

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.