Businesses and Services in Krimpenerwaard

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳Netherlands ⁴²³⁶⁰⁵	Dutch websites by location	Websites related to specific locations in the Netherlands, including cities, towns, and regions.
↳Netherlands→South-Holland ⁹²³⁸²	South Holland: Local Businesses & Services	This collection of websites features a diverse range of local businesses and service providers across South Holland.
↳Netherlands→South-Holland→Krimpenerwaard ¹⁸⁴⁰	Krimpenerwaard Businesses and Services	Websites listed showcase businesses and service providers operating within the Krimpenerwaard region of South Holland.
↳Netherlands→South-Holland→Krimpenerwaard + Other ¹⁷⁴⁶	Businesses and Services in Krimpenerwaard	This category showcases a diverse range of businesses and services operating within the Krimpenerwaard region and beyond. Featured websites include local entrepreneurs, construction companies, artisans, recreational facilities, and service providers, encompassing sectors like finance, retail, healthcare, and more.

1746 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
bergambacht-oost.nl	Erik van Erk projectontwikkeling B.V.	The website provides information about the Bergambacht-Oost housing development initiative, a project aimed at adding 4,000 homes to the Krimpenerwaard municipality by 2040.	Local Governance → Civic Engagement ⁵¹⁵ Tourism → Rural Tourism ⁵⁹	site ⁴²² agreement ¹⁰²⁹ resident ³²⁴⁵ municipality ⁶⁸³⁷ home ⁷⁹⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
pa-marine.nl	PA Marine B.V.	PA Marine is a company specializing in marine electronics and provides installation, service, and maintenance services for inland and cruise ships.	Maritime → Ship Maintenance ²⁹ IT → Network Management ⁷⁰²	office automation ⁵² electronics ⁹⁷¹ ship ⁵¹⁰³ communication ¹⁰¹⁶² installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
reparatiecentrale-witgoed-rotterdam.nl	ReparatieCentrale Witgoed Rotterdam	The website of ReparatieCentrale Witgoed Rotterdam offers professional appliance repair services in Rotterdam and the surrounding areas. The aim is to provide a reliable and quick repair service with experienced technicians and transparent rates.	Household Appliances → Appliance Repair ²²⁴ Repair → Mobile Phone Repair ¹⁰¹²	technician ⁸¹⁵ appliance ⁹⁵⁶ rate ²⁶⁰⁶ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
realfoodproductions.nl	Real Food Productions	The website of Real Food Productions presents its developments and marketing of fresh, high-quality food products and provides information about the company, its partners and its values.	Wholesale → Food Products ³⁰³ Hospitality → Suppliers ¹⁰⁵⁷	foodservice ³³ food products ⁵⁶ salad ²⁴⁴⁴ innovation ⁴⁶⁵⁹ sustainability ¹⁸⁴⁵¹	Zaanstad → Zaandam ²⁷⁴⁰
orbitbv.nl	Orbit Interieurprojecten B.V.	Orbit Interieurprojecten B.V. is an interior design firm based in Schoonhoven, Netherlands, specializing in creating custom interior designs and providing advice on colors, materials, lighting, and accessories.	Project & Custom Work → Furniture Design ²⁶ Interior Design → Interior Consulting ⁶¹⁵	style advice ⁶³ interior design ¹⁸⁰² space ³⁸⁴⁶ color ⁴¹⁵⁹ light ⁵¹⁴⁸ furniture ⁸⁷⁵¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
trouwbeurskrimpenerwaard.nl	Krimperenwaard Wedding Fair	The website is a platform for the Krimperenwaard Wedding Fair, a fair for engaged couples, brides, grooms, family and friends looking for inspiration and ideas for their wedding.	Festivals → Local Festivals ¹⁷⁰ Family Gatherings → Weddings ¹⁹⁹⁰	wedding fair ¹¹ visitors ¹⁰⁴⁸ supplier ¹⁷²⁵ ticket ²⁷⁸⁵ inspiration ⁴⁰⁸¹ wedding ⁴²⁵⁸
vanheteckeveld.nl	Field Trail Labrador Kennel van het Eckeveld	The website of Field Trail Labrador Kennel van het Eckeveld presents a beginning kennel focused on breeding hardworking, trainable, and social field trial labradors that meet all health requirements.	Breed → Labrador Retriever ¹⁰²	labrador ⁸⁵ puppy ¹³⁶⁷ breed ¹⁷⁴⁴
autopoetsbedrijfgrim.nl	Autopoetsbedrijf Grim	Autopoetsbedrijf Grim is a company specializing in the restoration and cleaning of classic cars with a focus on detail and quality.	Car Care & Detailing → Detailing ⁹⁴¹	classic car ⁴⁰⁴ restoration ³⁴¹⁷ cleaning ⁴⁵⁶⁷ paint ⁸⁷⁴⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
speelweekstolwijk.nl	Speelweek Stolwijk	The website of Speelweek Stolwijk presents the annual event, a week full of activities, outings and parties that takes place in the last week of the summer holidays in Stolwijk.	Local Events → Markets ¹⁰⁹⁷ Family Fun → Children’s Activities ¹⁹⁰⁶	summer holiday ³⁶ tent ¹³²⁸ registration ⁴³⁶⁶	Krimpenerwaard → Stolwijk ²³²
studiobrada.nl	Studio Brada Media	Studio Brada offers photography and film studios near Rotterdam, in Ouderkerk aan den IJssel.	Accommodation → Studios ²⁰⁰ Arts → Imaging & Photography ⁷⁶⁸⁷	daylight ⁸⁷ wifi ¹³⁷² studio ⁵⁴⁶⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
meetbureaudebruijn.nl	Meetbureau de Bruijn	Meetbureau de Bruijn is a surveying and engineering firm specializing in accurate measurements and solutions for the construction sector.	Engineering → Engineering Firms ⁹⁸⁹ Technology & Innovation → Construction Technology ⁷⁹⁰	technical solutions ²⁹ measurement ⁷³¹ construction ⁷⁴²¹	Krimpenerwaard → Bergambacht ³⁰³
yourmomentfotografie.nl	Your Moment Fotografie	Your Moment Fotografie is a website showcasing photographs, organizing events, and documenting equestrian and canine competitions.	Football → Competitions ¹⁰⁷² Dogs → Breeding ⁶⁶⁷	photoshoot ¹⁰¹⁸ horse ⁴³³⁷ competition ⁴⁷⁵⁹ dog ⁵⁴⁸³ photo ⁷⁷⁷⁸ event ⁴⁵¹⁹⁹	Teylingen → Voorhout ⁴²⁶
infinixfires.nl	Luxury Fires	The website of Infinix Fires showcases electric fireplaces featuring a unique Ultra HD flame effect, controllable via an app and compatible with smart home systems.	Fireplaces → Electric Fireplaces ⁴⁷ Technology → Smart Home & Automation ¹¹⁴⁶	smart home ⁴³⁹ fireplace ⁷⁵² app ⁴⁵⁹⁵	Zaanstad → Wormerveer ⁵³⁰
zonnevos.nl	Gezinshuis Zonnevos	Gezinshuis Zonnevos is a family home providing a safe and stable living environment for children in youth care who need a perspective.	Childcare → Family Home ⁴⁰	family home ¹⁵⁸ youth care ²²⁸ method ¹⁵⁰⁵ municipality ⁶⁸³⁷ child ¹¹⁵⁶⁶
kinderwerklekkerkerk.nl	Stichting Kinderwerk Lekkerkerk	Stichting Kinderwerk Lekkerkerk is an organization that organizes fun activities for children in Lekkerkerk.	Social Organization → Children’s Organizations ⁴⁶⁷ Family Fun → Children’s Activities ¹⁹⁰⁶	hut ¹¹⁷ sponsors ²⁶⁴² volunteer ⁸³⁶⁷ child ¹¹⁵⁶⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
e3advies.nl	E3 Advies	E3 Advies is an advisory firm specializing in energy saving, sustainability, and energy management.	Energy → Energy Saving ¹¹⁵¹ Energy → Energy Management ⁵⁰⁴	energy management ¹⁴⁴ energy advice ¹⁶⁵ energy saving ⁵⁹⁹ subsidy ²⁶⁴⁹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bizdewetering.nl	Stichting BIZ De Wetering	Stichting BIZ De Wetering is a foundation that facilitates joint investment in a safe and attractive business environment on De Wetering industrial park in Bergambacht.	Local Economy & Development → Regional Development ²⁹⁶ Associations & Groups → Business Associations ¹⁰¹⁸	industrial park ¹¹ biz ⁵² investment ²⁰⁷⁰ board ³⁴³⁸ municipality ⁶⁸³⁷	Krimpenerwaard → Bergambacht ³⁰³
stekaandelek.nl	Bed & Breakfast Stek aan de Lek	The website of Bed & Breakfast Stek aan de Lek presents a B&B in Ammerstol, located in the Krimpenerwaard, offering two rooms with sleeping accommodations and various amenities.	Accommodation → Overnight Stays ¹⁴⁵ Nature → National Parks ⁸⁹⁸	recreation room ¹⁶ veranda ¹⁰⁵⁵ barbecue ¹¹⁷⁵ room ³⁴¹¹	Krimpenerwaard → Ammerstol ⁴⁹
gemeenteinformatiegids.nl	Gemeente Informatiegids B.V.	The website provides a guide with information about local businesses in the Netherlands, including contact details and locations.	Office & Workspace → Business Directories ⁴²¹ AccommodationTypes → Accommodation ¹²¹³⁰	stay ⁷⁰² category ²³¹⁶ region ⁵⁴¹²	Krimpenerwaard → Lekkerkerk ²⁴⁴
nationaleondernemersgids.nl	Nationale Ondernemers Gids	The Nationale Ondernemers Gids is a directory of businesses in the Netherlands.	TravelBrands → Travel Agencies ¹⁸⁴⁰ Marketing & Advertising → Business Information ²⁹⁴	list ⁵⁷⁵ sector ¹³³² region ⁵⁴¹²	Vijfheerenlanden → Everdingen ⁶⁴
tvs-design.nl	TVS Design	The website of TVS Design presents the company's services as a specialist in interior design and stand construction, with a focus on customized solutions.	Finishing & Trades → Interior Construction ⁵⁰² Event Styling & Decoration → Stand Construction ¹²⁴	customized solutions ³¹ stand construction ⁹⁷ interior construction ²⁴⁰ decoration ⁴⁰⁸⁵ partner ⁴²⁷² interior ⁸⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
berktas-sz.nl	Berktas Sociale Zekerheid	The website of Berktas Sociale Zekerheid presents the services of a private company that provides support to social affairs departments.	Legal → Guardianship ⁸⁷⁹ Community → Social Issues & Welfare ²⁸¹⁵⁹	representation ¹⁰⁰ counseling ⁷⁴¹ guardianship ⁷⁶⁷ legal ⁹³⁷	Voorne aan Zee → Brielle ⁶¹³
bouwsupportschoonhoven.nl	Bouwsupport Schoonhoven	Bouwsupport Schoonhoven is a construction company with over 40 years of experience focused on satisfying its clients through quality and attention to detail.	Masonry & Plastering → Masonry ⁵⁷⁶ Painting → Contemporary Painting ⁴⁵²	detail ⁶³⁸ work ³¹²² construction ⁷⁴²¹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
broodjebab.nl	Broodje BAB	The Broodje BAB website is an online shop where customers can order sandwiches, salads, and Big Tosti's for pick-up or delivery. The website also features a prize wheel and the chance to win.	Sandwiches & Salads → Sandwich Shops ²²⁹	prize wheel ⁴⁰² sandwich ⁴⁰⁹⁸ webshop ⁸⁶⁴⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
degrootfaunabeheersing.nl	De Groot Faunabeheersing	De Groot Faunabeheersing provides pest control and advice services to individuals and businesses in the Krimpenerwaard region, Rotterdam, Gouda, and Schoonhoven.	Pest Control → Pest Management ⁹⁸	ipm ³⁶ pest ³⁵⁴ control ⁹¹¹ prevention ¹⁷⁶³ plan ²⁵⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dezevender.nl	Stichting 'De Zevender	The Zevender is an apartment complex in Schoonhoven offering independent living for seniors.	House Types → Apartment Living ³⁵⁵⁹	bicycle storage ⁵⁷ complex ⁵⁶⁸ living room ¹³²⁵ apartment ⁵⁰⁸⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
edwinterlouw.nl	Edwin Terlouw Timmer & Onderhoudsbedrijf	Edwin Terlouw Timmer- and Maintenance Company is a business that focuses on carpentry, renovation, and restoration of homes in Bergambacht and the surrounding area.	Building & Materials → Carpentry & Joinery ⁸³⁰	craftsmanship ¹⁸⁵⁸ carpentry ²²¹⁸ home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
hbrevet.nl	H.B.Revet & Zn. V.O.F.	H.B.Revet & Zn. V.O.F. is a construction company in the Gouda, South Holland region that undertakes renovations, carpentry and maintenance work.	Installation & Repair → Tradespeople ⁴⁰⁹ Renovation & Restoration → Interior Renovation ⁸⁷⁹	garden furniture ⁵⁷⁸ skylight ⁹⁶⁶ extension ¹⁹⁴¹ window ²⁰³⁰ carpentry ²²¹⁸ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
infra-rent.nl	Infra-Rent B.V.	The website of Infra-Rent B.V. presents the organization as an independent partner providing asphalt support for the maintenance of public and private infrastructure, primarily through the rental of asphalt finishing machines and associated personnel.	Machine & Equipment → Machine Rental ¹⁹² Civil & Infrastructure → Earthworks ³⁷⁰	asphalt ¹⁶⁵ machine park ⁶⁴² rental ⁷²⁵⁷ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
slagerijgelderblom.nl	Slagerij Gelderblom	The website serves as a directory for the locations of Slagerij Gelderblom.	Coffee & Tea → Beverages ⁴⁴⁵³ Food → Meat ¹¹²³	meat ²⁰⁵⁵	Bernheze → Heesch ³⁹²
decokay.nl	Decokay	Decokay is a company that helps customers transform their homes by offering a variety of products and services for interior design and improvement.	Interior → Wallpaper ¹⁰⁰¹	curtains ¹⁰¹⁵ wallpaper ¹⁷⁵⁶ frames ²⁵⁵⁶ floor ⁴⁷⁸¹ kitchen ⁶⁴⁴³	Medemblik → Wognum ¹⁸⁵
driestarwartburg.nl	Driestar Wartburg Scholengroep	The Driestar Wartburg Scholengroep operates several schools offering various educational pathways, including vmbo, havo, and vwo, with a focus on Christian education and fostering a supportive environment for students.	Primary Education → Christian Education ⁴⁴⁶	vwo ⁵⁹ havo ⁸¹ vmbo ¹⁹⁸ school ⁷⁸⁵⁶ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Barendrecht → Rotterdam-IJsselmonde ²⁴
krimpenerwaard.nl	Gemeente Krimpenerwaard	The website of the Krimpenerwaard municipality provides residents and businesses with information and online services related to various aspects of life in the municipality.	Municipalities → Dutch Municipalities ⁵¹⁶ Government & Administration → Municipal Services ⁸³⁴	waste ¹³¹² healthcare ²³¹⁶ work ³¹²² housing ⁴³⁷⁸ news ¹⁵²⁹³
dewerkendewebsite.nl	Werkende Website AI	The Werkende Website AI is a platform that automatically builds and improves websites, without requiring technical expertise.	Business Software → Marketing Software ⁹⁰ Web Design → Website Builders ⁸⁸⁸	knowledge base ⁵⁶⁹ story ⁸²⁸⁵ design ²⁷²⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
reprovinci.nl	Reprovinci	Reprovinci is a company that helps businesses develop their brand.	Business → Business Services ¹¹⁵³⁷⁹	brand style ²⁷⁶ branding ⁴⁶¹⁴ logo ⁴⁶⁶⁰ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
adviseert.nl	Adviseert.nl	Adviseert.nl provides information and advice on various topics, including business management, finance, and more.	Entrepreneurship → Business Support & Advice ²⁸⁵ Finance & Insurance → SMEs ⁴³³	event location ¹¹⁰ business advice ¹⁷⁹ financial advice ⁶⁰⁵ accountant ⁶¹¹ catering ⁶⁴⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
enjoy.nl	Enjoy.nl	This website offers weekend getaways and day trips throughout the Netherlands.	Family Activities → Day Trips ⁴¹⁹ Events → Weekend Getaways ¹⁰⁶	weekend getaway ²⁰ day trip ²⁵⁷ destination ²⁵⁸⁰	Schagen → Dirkshorn ¹⁰⁵
efwah.nl	EFWAH	The website showcases Carlijn EFWAH's work and creative projects, ranging from robots and websites to baking products and handmade decorations.	Metalworking → Machines ³⁰⁷ Food & Beverage → Food Industry ⁸³⁵	baking ¹¹⁹ robot ⁴²³ artwork ²²⁴⁸	De Bilt → Maartensdijk ²⁰²
hetadresomintelijsten.nl	Atelier Lijst in Beeld K5	Atelier Lijst in Beeld K5 is an atelier located in Bergambacht specializing in creating and framing artwork and other images.	Visual Arts → Framing ¹³⁹	hanging system ⁴¹ frame ⁸⁸³ artwork ²²⁴⁸ frames ²⁵⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
ghz.nl	Groene Hart Ziekenhuis	The Groene Hart Ziekenhuis is a general hospital in Midden-Holland providing high-quality care and offering a patient portal.	Hospital & Acute Services → Hospitals ⁷³⁵ Specialty Medicine → Specialists ¹⁵⁸	blood test ²⁰⁰ specialist ⁹³⁸ patient ⁴⁰⁸² care ¹²³³⁸ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tjampoer.nl	Event Platform	This website provides an overview of various Indonesian and Moluccan events.	International Relations → Diplomacy ²⁵ Travel Agencies → Bus Tours ¹⁰²	trip ²⁰³² market ²⁷⁷² band ²⁹⁷⁷ hotel ³⁵⁴³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hervormd.nl	Bergschenhoek Reformed Congregation	The website of the Bergschenhoek Reformed Congregation is an online platform for members and visitors to find information about services, events, and the community.	Protestantism → Reformed ¹³²³ Protestantism → Churches ¹⁰⁰⁹	steiger ¹¹ community ⁷⁹³¹ child ¹¹⁵⁶⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
vaartland.nl	Vaartland	Vaartland.nl is a website where second-hand cars, primarily used cars, are offered for sale. The website provides a wide selection of various brands and models and facilitates online purchases, financing, and the trade-in of cars.	Used Cars → Occasions ²⁵⁷ Car Selling & Valuation → Cars ²⁶⁹⁸	test drive ¹⁷⁷ occasion ²⁰³⁶ model ³⁵⁴⁶ finance ⁵³⁴¹ quote ¹²⁸⁶³ brand ¹⁷⁷³⁷	Krimpenerwaard → Stolwijk ²³²
rolloos.nl	Familie Rolloos	This website provides an overview of the extensive history of the Rolloos family, tracing back to Viking Rollo.	Architecture & Sites → Middle Ages ¹⁸² Social Sciences → Genealogy & Family History ¹⁴⁰³	brittany ²¹ normandy ²⁹ coat of arms ⁴² family tree ⁴⁴⁸ family ⁶⁴⁶² history ⁷²⁸⁶	Krimpenerwaard → Berkenwoude ⁶²
intermaris.nl	Intermaris	The Intermaris website facilitates the rental and finding of homes and provides information about projects and vacancies.	Law → Housing Law ¹¹⁴ Organizations → Society ⁷⁶⁷	rent ⁹⁸¹ resident ³²⁴⁵ vacancy ⁶⁵⁹⁸ home ⁷⁹⁷⁶ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Gouderak ¹⁰³
scoutingouderkerk.nl	Scouting Christiaan de Wet	The website of Scouting Christiaan de Wet provides information about the scouting association, its activities, members, and contact details.	Youth Organizations → Scouting ¹⁰⁰⁴	youth members ²¹ troop ⁷⁷ campfire ⁸⁷ scouting ⁸⁶⁰ volunteer ⁸³⁶⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
glasdraad.nl	GlasDraad	This website from GlasDraad provides information about the rollout of fiber optic networks in rural areas and small towns in the Netherlands.	Local Economy & Development → Regional Development ²⁹⁶ Mobile & Wireless Communication → Broadband Internet ⁴⁰	fiber optic ²⁷⁹ initiative ¹²⁹⁷ internet ¹⁶⁷⁸ campaign ³⁴²⁸ region ⁵⁴¹² network ¹¹¹²³	Amsterdam → North ⁶⁵⁷
recruitment-marketeers.nl	Recruitment Marketeers	The website Recruitment Marketeers provides specialized services in job marketing, employer branding, and content creation, aimed at improving the effectiveness of recruitment campaigns and strengthening employer brands.	Online Marketing → Recruitment Marketing ¹⁷⁹ Online Marketing → Employer Branding ²⁰²	employer branding ¹⁰ job marketing ¹⁷ content creation ¹⁹⁰ campaign ³⁴²⁸ data ⁵⁸⁷²	Krimpenerwaard → Bergambacht ³⁰³
dcmr.nl	DCMR	The DCMR website provides information and services related to environmental inspections, enforcement, and promoting a healthy and sustainable living environment in the Rijnmond region.	Government & Administration → Regional Government ³⁶⁷ Context → Environment ⁵⁴⁴³⁷	enforcement ¹⁰⁷ circular economy ³⁶⁵ permit ⁷⁴⁴ inspection ⁴²⁷⁹ report ⁴⁵⁵¹	Krimpenerwaard → Bergambacht ³⁰³
kraamzorgdewaarden.nl	Kraamzorg de Waarden	The website Kraamzorg de Waarden provides information and applications for maternity care, support for expectant and new parents, and an online shop with supplies for the postpartum period.	Pregnancy & Childbirth → Postpartum Care ⁶⁵⁸	babywearing ²² maternity care ²³⁰ childbirth ⁸⁹⁴ online shop ¹³¹⁰ baby ¹⁸⁹⁵ pregnancy ²⁷³⁹	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
ozhw.nl	Onderwijsgroep OZHW	The website of OZHW (Primary & Secondary Education Group) provides information about the public schools within the organization located in the municipalities of Ridderkerk, Barendrecht, Zwijndrecht, Alblasserdam and Krimpenerwaard.	Special Needs & Support → Educational Organizations ³¹⁵ Government & Administration → Administrative Bodies ⁵⁰	teacher ²⁸⁹⁰ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶ news ¹⁵²⁹³	South-Holland → Barendrecht ¹⁶⁵³
janvanhoof.nl	Scouting Jan van Hoof group	The website of the Scouting Jan van Hoof group in Gouda provides information about the group, its activities, scout troops, and membership.	Social Organization → Youth Organizations ¹⁷²⁶	family day ⁴⁹ troop ⁷⁷ scouting ⁸⁶⁰ membership ¹⁰⁴⁴²	South-Holland → Hollandsche IJssel ⁴⁸
lekstroom.nl	Lekstroom Transport BV	The website of Lekstroom Transport BV showcases the history, fleet, and current news updates of the shipping company.	Museums & Collections → Corporate History ²² Marine & Watercraft → Water Transportation ⁴⁴⁶	terms and conditions ¹¹⁸ fleet ¹³⁵¹ transportation ²⁸⁵¹ photo ⁷⁷⁷⁸ news ¹⁵²⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
veerpas.nl	Veerpas.nl	The Veerpas website provides information about the new electronic boarding pass for the ferries in the region.	Water Transportation → Ferries ¹²⁹ Online & Digital → Online Services ²³⁶⁹	ferry service ¹³ cross ⁸⁸ balance ⁴⁵⁸²	Krimpenerwaard → Bergambacht ³⁰³
begrafenisverzorgingkina.nl	Begrafenisverzorging Kina	Begrafenisverzorging Kina offers complete funeral services, focusing on personalized and responsible farewell arrangements.	Death → Funerals ⁵⁵² Social Services → Grief Support ⁵⁸⁷	grief ¹⁵⁷⁷ funeral ²⁴⁷⁷ finance ⁵³⁴¹ foundation ⁶⁶⁷⁸ municipality ⁶⁸³⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
portofinolive.nl	Pizzeria and Grillroom Portofino	The website of Pizzeria and Grillroom Portofino presents the restaurant chain with locations in Spijkenisse and Haastrecht, and offers online ordering for pizzas, pasta dishes, and grill dishes.	Fast Food → Shoarma ⁹⁰ Context ¹⁶¹³⁹⁴	spareribs ²¹³ shoarma ²⁵⁴ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸ app ⁴⁵⁹⁵	Krimpenerwaard → Haastrecht ¹⁹³
kunstelo.nl	Stichting Passend Onderwijs	The KunstELO 2.0 is an online learning environment providing lesson modules and assessments for various subjects (tehatex, kua, ckv, visual arts) for vwo, havo, vmbo, and VSO.	Educational Resources → Online Learning ¹⁶ Technology & IT → Educational Technology ³⁸⁰	subject ²⁰³ module ⁹⁷¹ assessment ¹²⁰⁵ school ⁷⁸⁵⁶	Gulpen-Wittem → Gulpen ²⁶¹
tandarts.nl	Tandarts.nl	This website provides information about all aspects of oral health, including dental anxiety, emergency treatments, and a list of dentists by location.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Health → Medical Care & Services ²⁹⁴⁶¹	oral health ⁶⁸⁶ prevention ¹⁷⁶³ dentist ²⁵¹⁴ treatment ²¹²⁰³	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
uitslagensoftware.nl	Uitslagen.nl	The website provides a list of various events, including running races, duathlons, swimming, and gravel rides, that are organized in the Netherlands, Belgium, and Germany.	Running → Running Events ⁶⁸⁴ Nature & Outdoors → Outdoor ⁴⁰³¹	duathlon ¹² swimming ⁸⁵⁰ race ¹⁰⁴³ region ⁵⁴¹² event ⁴⁵¹⁹⁹	Heumen → Nederasselt ⁵⁶
cjgcursus.nl	Centrum Jeugd en Gezin	The Centrum Jeugd en Gezin (CJG) provides courses, gatherings, and lectures for parents of children of all ages to support them with their parenting questions.	Family → Parenting ¹³¹⁶ Social Services → Family Support ³⁸⁰	parenting ⁹⁷² municipality ⁶⁸³⁷ child ¹¹⁵⁶⁶ course ¹⁴⁷²⁸	South-Holland → Kaag en Braassem ⁹⁶⁰
nvwk.nl	Natuur- en Vogelwerkgroep Krimpenerwaard	The website of the NVWK Krimpenerwaard provides information about nature and bird conservation, projects, and activities in the Krimpenerwaard.	Ornithology → Bird Conservation ¹⁷⁰ Ornithology → Birdwatching ²⁷¹	working groups ¹⁷¹ bird ⁹²² landscape ²⁶⁰⁹ nature ⁹⁰⁹⁴
handwerkenzondergrenzen.nl	Handwerken Zonder Grenzen	Handwerken Zonder Grenzen is a magazine focusing on various handcraft techniques and materials from around the world.	Textile Arts → Crafts ⁹¹¹⁷	handcrafts ¹⁰ edition ¹⁵⁷ textile ¹⁴²¹ technique ²¹⁵⁷ article ⁶⁰⁰⁰ shop ⁶⁴⁸³	Krimpenerwaard → Bergambacht ³⁰³
casteleijnbakker.nl	Casteleijn Brood B.V.	The website of Bakkerij Casteleijn presents a traditional bakery with stores in various locations and an online shop offering delivery service.	Bakery & Food Production → Artisan Bakeries ⁷⁷	family business ⁷⁹³ pastries ⁹⁴⁶ online shop ¹³¹⁰ bread ¹⁶²² store ³⁹⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
groot-rotterdam.nl	HSV Groot Rotterdam	The website of HSV Groot Rotterdam is a platform for members and potential members, providing information and updates about the association, activities, departments, events and administrative matters.	Water → Lakes ²³² Fishing → Fishing Clubs ¹⁹⁰	department ²⁶⁹ water ²⁵⁰¹ competition ⁴⁷⁵⁹ association ⁸⁵⁶² membership ¹⁰⁴⁴² news ¹⁵²⁹³	Lansingerland → Bleiswijk ⁵⁷⁹
smitsauto.nl	Autobedrijf Smits Auto	The website of Autobedrijf Smits Auto offers a wide range of car maintenance services, used car sales, and financing options.	Automotive Maintenance → Vehicle Inspection ¹¹⁰²	used car ⁸²⁵ apk ¹³³³ lease ¹⁵⁹⁵ car ¹⁰⁸⁶⁵ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
hethoutblad.nl	The Houtblad	The Houtblad is an online publication providing information about wood architecture, constructive and building physics aspects of timber construction, developments in sustainability, and the timber market.	Business & Industry → Trade Publications ¹⁷ Legal & Permits → Building Technology ³⁸⁵	timber ³⁵³ market ²⁷⁷² concept ³³³⁸ knowledge ³⁵²⁸ news ¹⁵²⁹³	Krimpenerwaard → Stolwijk ²³²
r365.nl	R365 Christie’s International Real Estate	The website of R365 Christie’s International Real Estate showcases a premium selection of properties and new construction projects, offering real estate brokerage services through an international network.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Real Estate → Real Estate Service Providers ²⁰	brokerage ⁴³³ new construction ²⁶⁷² region ⁵⁴¹² property ⁷⁴⁰⁶ network ¹¹¹²³	Ridderkerk → Rijsoord ⁴²
webahats.nl	Weba Hats	The website of Weba Hats presents a collection of handmade women’s hats produced in the Netherlands, available for purchase in various boutiques and online. The purpose is to inform consumers about the availability of these hats and the traditional manufacturing process.	Accessories → Hats ¹⁷⁷	straw ¹⁰⁷ felt ²⁰⁸ hat ³⁴⁹ store ³⁹⁰¹ production ⁴⁵⁸²	Zwartewaterland → Genemuiden ⁴⁰⁵
vaarmeerheenenweer.nl	Vaarmeer en Weer	The Vaarmeer en Weer website provides information about the ferry between Ouderkerk aan den IJssel and Nieuwerkerk aan den IJssel, including schedules, fares, and information about walking and cycling in the region.	Water → Rivers ¹⁸⁰ Water Transportation → Ferries ¹²⁹	fare ⁸⁶ ferry ¹⁷⁹ hiking ⁸⁴¹ cycle ¹⁹⁰⁶ schedule ²⁶²⁴ ship ⁵¹⁰³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
veerdienstlekkerkerk.nl	Veerdienst Schoonhoven BV	The Veerdienst Lekkerkerk website provides information about the ferry services in Lekkerkerk, including the schedule, fares, and relevant supplementary details.	Public Transportation → Regional Transportation ⁹² Water Transportation → Ferries ¹²⁹	fare ⁸⁶ ferry ¹⁷⁹ facebook ⁸⁵⁰ instagram ¹²¹⁶ schedule ²⁶²⁴	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
zuyderleven.nl	Zuyderleven Groep	Zuyderleven is a financial service provider offering various financial services, including insurance, mortgages, and pension advice.	Insurance → Damage Insurance ¹⁸⁴ Insurance → Brokerage Agencies ¹⁶	brokerage ⁴³³ advisor ¹⁰⁵⁵ pension ¹⁶⁸² mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
rizbouw.nl	Rizbouw	The Rizbouw website showcases the services of a construction company specializing in various building projects, from residential construction to renovation, and emphasizes a focus on sustainability and international collaboration.	Social Organization → NGOs ³⁹ Specialized Works → Agricultural Construction ¹¹⁰	commercial construction ¹⁰⁰ residential construction ²⁵⁰ apartment ⁵⁰⁸⁸ renovation ¹³⁸⁴⁹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
markermeerdijken.nl	Municipality of Uitdam	This website informs residents and stakeholders about the progress of the reinforcement of the Markermeerdijken dikes.	Nature Conservation → Water Management ¹¹³⁸	dike ¹⁴⁸ resident ³²⁴⁵ partner ⁴²⁷² news ¹⁵²⁹³	Waterland → Marken ¹⁵⁷
englishjobsearch.nl	English Job Search Netherlands	The website provides a search engine for English speakers looking for jobs in the Netherlands, and local professionals seeking opportunities in a purely international environment.	Jobs → Vacancies ¹⁰⁹⁹ Online Services → Job Boards ¹⁰³⁶	search engine ⁵³⁶ professionals ¹⁹⁶⁶ job ²⁷⁹⁵ environment ⁴⁸⁷³ vacancy ⁶⁵⁹⁸	Schagen → Tuitjenhorn ³⁸²
yellowbellies.nl	YellowBellies	The website of YellowBellies is an outdoor-focused childcare provider operating in several locations in the Netherlands.	Childcare → Daycare Centers ⁹⁸⁷ Children’s Activities → Outdoor Play ³²	slogan ⁸⁰ childcare ³⁵¹²	Montfoort → Linschoten ¹⁶⁹
cirya.nl	Cirya GGZ	Cirya GGZ is a mental health care provider located in Southwest Netherlands offering a range of treatments.	Pediatric & Child Health → Community Care ¹⁴¹ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	referral ³⁷⁷ help ⁸⁶⁴ participation ¹⁴³⁰ therapy ⁷⁴⁴⁸ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
streekmuseumkrimpenerwaard.nl	Stichting Streekmuseum Krimpenerwaard	The Streekmuseum Krimpenerwaard offers an exhibition and educational programs related to the history and culture of the Krimpenerwaard.	Museums → Regional Museums ³⁹⁰ Family Fun → Children’s Activities ¹⁹⁰⁶	vintage ⁶⁸⁹ museum ²⁰⁰² exhibition ⁵³³² history ⁷²⁸⁶ child ¹¹⁵⁶⁶
veerpoort.nl	Cafetaria Brasserie De Veerpoort	Cafetaria & Brasserie De Veerpoort is a restaurant and cafe located in Schoonhoven, Netherlands, established in 1985. The website offers a menu and information about catering services.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Catering & Ready Meals → Outdoor Dining ⁵⁶	croquettes ¹⁰⁸ lunch ¹⁵³⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bandlev.nl	LEV	The website LEV presents Dutch-language music with a positive and encouraging message, aimed at offering hope and inspiration to visitors.	Lyrics & Poetry → Songwriters ⁷¹ Music → Dutch Language Music ⁷⁴	lev ¹³ hope ¹¹³ song ¹²⁸⁵ concert ⁴⁴⁰⁹ music ¹³¹⁷⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
indekrimpenerwaard.nl	In de Krimpenerwaard	The website In de Krimpenerwaard provides information on popular hotspots, accommodation options, activities, and events in the Krimpenerwaard and surrounding region.	Local Events → Markets ¹⁰⁹⁷ Quick Bites → Food Trucks ⁶²³	hotspot ¹¹⁸ regional products ³⁹¹ arrangement ³¹⁰⁴ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Molenlanden → Kinderdijk ¹⁵⁸
autobedrijfdspek.nl	Autobedrijf D. Spek	The website of Autobedrijf D. Spek presents the services and facilities of the car dealership, including repair, maintenance, inspection, damage repair, and car rental.	Automotive Maintenance → Vehicle Inspection ¹¹⁰² Rental Services → Car Rental ¹⁰⁴⁷	car rental ⁴⁸² apk ¹³³³ damage ¹⁵⁶² repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵ maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
kikkersprong.nl	Zwemschool Kikkersprong	Zwemschool Kikkersprong is a training institute that offers swimming lessons to children from 3 years and 9 months old, focusing on safety, fun, and progress.	Swimming → Swimming Lessons ²⁷⁶	student tracking system ²¹ diploma ⁷⁹⁵	Krimpenerwaard → Bergambacht ³⁰³
schoonhovenscollege.nl	The Schoonhovens College	This website serves as an information portal for students, parents, and other stakeholders, offering details about education, school activities, contact information, and the school leadership.	Secondary Education → VMBO ³³² Career & Guidance → Educational Pathways ⁶⁶	vmbo ¹⁹⁸ parent ⁴³¹⁸ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
schoonhovensuites.nl	Schoonhoven Suites	Schoonhoven Suites is a Bed & Breakfast hotel room with suites located in Drenthe, offering guests a luxurious and relaxing stay.	Hotels → Boutique Hotels ⁹¹⁴ Nature → Landscape ¹¹²⁹	recreation area ³⁵ suite ²¹⁵ forest ¹⁴¹⁸ hotel ³⁵⁴³ nature ⁹⁰⁹⁴ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
degroeiling.nl	The Groeiling	The Groeiling is a school governing body focused on elementary education in the Gouda region, aiming to support children's personal and collective growth.	Primary & Secondary Schooling → School Organizations ¹⁵⁸ Higher Learning → Educational Institutions ¹⁰⁴⁹	governing body ¹⁴ job postings ⁶⁷⁶ mission ¹⁰⁰⁰ teacher ²⁸⁹⁰ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Alphen aan den Rijn → Boskoop ⁶⁵²
camping-streefland.nl	Camping Streefland	Camping Streefland is a family-friendly campsite in the Krimpenerwaard region offering cabin rentals, camping pitches, and various activities.	Hiking → Routes ²⁷⁹ Camping → Campsites Netherlands ⁷⁹²	cabin ³⁵¹ polder ⁴⁷⁶ campsite ²⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hollandsebodem.nl	Van Hollandse Bodem	Van Hollandse Bodem is a specialist in self-leveling floors and wall finishes, offering free color advice and showcasing various projects.	Flooring → Self-Leveling Floors ⁵¹	self-leveling floor ⁷⁰ wall ¹³⁷⁸ color ⁴¹⁵⁹ showroom ⁴⁸⁸³	Altena → Woudrichem ¹⁹⁶
jandros.nl	Jan Dros	The Jan Dros website offers a meal service with fresh, healthy and ready-to-eat meals that can be delivered or picked up in Schoonhoven and the surrounding area.	Catering & Ready Meals → Ready-To-Eat Meals ³⁵⁹	vegetables ¹⁴¹⁶ meal ¹⁶³⁸ buffet ¹⁷⁴⁷ webshop ⁸⁶⁴⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gabrielselektro.nl	Gabriëls Elektro	Gabriëls Elektro is an electrical company offering various services, including installation and maintenance of electrical systems and home automation.	Security → Security Systems ⁹⁷¹ Technology → Smart Home & Automation ¹¹⁴⁶	knx ⁴² alarm system ⁴⁹⁵ electrical ¹⁴¹⁴ light ⁵¹⁴⁸ data ⁵⁸⁷²	Flevoland → Almere ⁷⁷⁶⁵
autobedrijfblok.nl	Autobedrijf Blok	Autobedrijf Blok is an auto dealership that sells cars, provides maintenance and repair services, and offers various other services.	Repair → Garage ¹⁷⁷⁹ Automotive → Car Dealerships ¹⁶⁴⁷	mot ⁸⁰⁶ occasion ²⁰³⁶ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
zilverkraamcadeau.nl	Rikkoert	The website Zilver Kraamcadeau offers a range of personalized baby and gift items, with a focus on silver products, and provides a shopping experience both online and in physical stores in Schoonhoven and Lekkerkerk.	Jewelry → Silver Jewelry ¹²¹ Gifts → Baby Gifts ⁴⁷³	cutlery ¹²⁸ baby gift ²⁵² personalization ⁴⁵⁵ silver ⁴⁷⁹ jewelry ⁴⁵⁹⁹ gift ⁶⁴⁴²	Krimpenerwaard → Lekkerkerk ²⁴⁴
vlisterbaden.nl	Natuurlijk De Loete and Ons Polderbad	The website of Natuurlijk De Loete and Ons Polderbad presents two sustainable outdoor swimming pools in the Krimpenerwaard, aimed at providing swimming enjoyment for all ages.	Swimming → Outdoor Pools ⁹⁴ Lifestyle → Recreation ³⁴²⁴⁹	swimming ⁸⁵⁰ pool ¹⁵³² opening hours ²⁹⁵³ newsletter ⁶⁵⁰⁴ volunteer ⁸³⁶⁷ sustainability ¹⁸⁴⁵¹	Molenlanden → Kinderdijk ¹⁵⁸
vinkwitgoed.nl	Vink Witgoed	Vink Witgoed is a household appliance dealer that provides advice, delivery, installation, and repair services for various appliances.	Kitchen → Kitchen Appliances ⁷²⁴	range hood ²⁰ oven ³²⁴ dishwasher ³²⁴ refrigerator ⁴⁷⁵ washing machine ⁴⁸⁷	De Bilt → Westbroek ⁷⁰
hetkwartierstolwijk.nl	Het Kwartier Stolwijk	Het Kwartier Stolwijk is a meeting center that offers social and cultural activities for the residents of Stolwijk and the surrounding area.	Historical Sites → Monasteries ⁶⁵ Conferences & Meetings → Meeting Places ¹⁹²	center ¹¹¹⁵ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Stolwijk ²³²
fysiofitness-bergambacht.nl	Fysio-Fitness Bergambacht	Fysio-Fitness Bergambacht is a company offering physiotherapy and fitness services catering to various needs.	Medicine → Physiotherapy ²³⁷² Sports → Group Class ²⁰⁵¹	rehabilitation ¹⁵¹² fitness ²²⁵¹ schedule ²⁶²⁴ sport ⁴²²⁸ physiotherapy ⁴⁶⁸⁸	Krimpenerwaard → Bergambacht ³⁰³
oudstolwijck.nl	Historical Association Oud Stolwijck	The website of the Historical Association Oud Stolwijck aims to promote and share the local history of Stolwijk.	Local History → Dutch History ¹⁰⁶⁷ Institutions → Historical Associations ⁴²¹	history ⁷²⁸⁶ photo ⁷⁷⁷⁸ association ⁸⁵⁶²	Krimpenerwaard → Stolwijk ²³²
dnlonline.nl	DNL Machines & Equipment	The website of DNL Machines & Equipment presents a wide range of construction and agricultural machines, including import and sales of various brands such as SANY, DEUTZ-FAHR, PÖTTINGER and DEZEURE.	Building & Materials → Construction Machinery ⁷³⁰ Agriculture → Agricultural Machinery & Equipment ⁶³¹	construction machine ²² track & trace ³⁴ agricultural machinery ¹⁶⁹ rental ⁷²⁵⁷ brand ¹⁷⁷³⁷	Krimpenerwaard → Haastrecht ¹⁹³
theaterconcordia.nl	Stichting Cultureel Centrum Concordia/Theater Concordia	Theater Concordia in Haastrecht is a cultural center offering a wide range of activities, including a cultural program, hall rentals, a grand café, and the sale of tickets and gift vouchers.	Film → Cinema ¹¹²	cafe ¹⁶²² hall ¹⁷⁸⁶ theater ²⁵⁴⁴ ticket ²⁷⁸⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
112hm.nl	112HM	The website 112HM provides up-to-date news from the region of Hollands Midden, focusing on reports and incidents received by the emergency services via the 112 number.	Crime → Criminality ¹¹ Government & Administration → Police ²¹⁵	accident ³³⁰ incident ³³⁵ emergency service ³⁷² police ⁴⁸⁰ report ⁴⁵⁵¹ news ¹⁵²⁹³	Zuidplas → Moordrecht ³³²
dubbelop.nl	Dubbelop	The website of Dubbelop showcases modern jewelry and objects, handcrafted in their atelier in Schoonhoven, using special materials such as Tantalum.	Renovation & Restoration → Art Restoration ⁴⁶	objects ⁴²⁶ atelier ¹⁴¹⁷ jewelry ⁴⁵⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
artotheater.nl	Arto Theater	The website provides information about the Arto Theater, including its program, exhibitions, and contact details.	Tourism → Cultural Attractions ⁶⁹⁸	theater ²⁵⁴⁴ ticket ²⁷⁸⁵ art ³⁸⁵⁶ exhibition ⁵³³² performance ⁷⁵⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
zijderlaan.nl	Zijderlaan	The website of Zijderlaan presents itself as a professional transport and logistics company, focused on safety, quality, and sustainability.	Trade → Trading Companies ¹⁷⁹ Building & Materials → Construction Machinery ⁷³⁰	inventory management ¹³⁸ logistics ³²⁵⁷ transport ⁶¹⁰⁵ sustainability ¹⁸⁴⁵¹	Steenbergen → Dinteloord ¹⁶⁷
nijverij.nl	Nijverij Schoonhoven	The website of Nijverij Schoonhoven describes a new construction project on the Lek in Schoonhoven, offering residential buildings and a link to the historic city center, referencing the city's rich history, particularly the silverware craft.	Jewelry → Silver Jewelry ¹²¹ Business → Industry ³⁶⁹⁷⁷	residential buildings ¹⁸ silverware ²⁴ new construction ²⁶⁷² history ⁷²⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
financieelcomfort.nl	Financieel Comfort	Financieel Comfort is a website that connects consumers with independent advisors for mortgages and insurance.	Insurance → Comparison ³⁶⁷ Comparison → Comparison Tools ¹²⁰	comparison ⁵⁴¹ advisor ¹⁰⁵⁵ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
t2groep.nl	T2	The website of T2 presents the services of a company specializing in advice, development, design and construction of residential and commercial buildings, for both private and business clients.	Masonry & Plastering → Masonry ⁵⁷⁶ Legal & Permits → Building Technology ³⁸⁵	utility construction ⁴⁷ building project ¹¹⁹ new construction ²⁶⁷² renovation ¹³⁸⁴⁹ design ²⁷²⁰²	Oude IJsselstreek → Gendringen ¹²²
cultuurhuiskrimpenaandelek.nl	Cultuurhuis Krimpen Aan de Lek	The Cultuurhuis Krimpen Aan de Lek is a cultural center offering a wide range of activities and events to the local community.	Village Focus → Village Halls ²⁶⁴ Institutions → Cultural Centers ⁶¹⁰	theater hall ⁴⁰ agenda ⁴³⁷⁴ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
andrevanvliet.nl	André van Vliet	The website of André van Vliet presents a passionate musician who performs as an organist, pianist, or conductor and offers his music products, such as CDs and hymnals.	Organ Music → Organists ³⁹ Performance → Performing Music ¹⁰	cd ⁵⁷⁴ organ ⁶³³ piano ⁸²⁰ conductor ¹²¹⁷ church ³⁴³⁹	Zwartewaterland → Hasselt ⁴⁹⁰
hhgouderkerkeo.nl	Hersteld Hervormde Gemeente van Ouderkerk aan den IJssel e.o.	The website of the Hersteld Hervormde Gemeente of Ouderkerk aan den IJssel provides information about the community, church services, activities, and contact options.	Social Organization → Religious Organizations ¹⁰⁶⁹ Religion → Religious Organization ¹⁴	church ³⁴³⁹ donation ⁵¹¹⁰ community ⁷⁹³¹ association ⁸⁵⁶²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
bijblue.nl	Bij Blue	The website of Bij Blue is an online presentation of a modern foodbar in Lekkerkerk, offering hospitality, coziness, and a diverse menu.	Bars → Foodbars ²²	bar ¹²¹⁶ reservation ³³⁷³ terrace ⁴⁸⁴⁷ dish ⁵⁹³⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
wonen-in-schutterskwartier.nl	Municipality of Schoonhoven	The website describes the Schutterskwartier in Schoonhoven, a new district with age-friendly homes located between the Lek River and the historic city center.	New Construction → Neighborhood Development ⁹³³ Commerce → Shopping Centers ¹⁰⁰¹	age-friendly ¹¹ district ³⁷¹ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wonenaandespoorsingel.nl	Wonen aan de Spoorsingel	The website of Wonen aan de Spoorsingel in Schoonhoven presents a new construction project with townhouses, townhouses, and apartments, located on the Spoorsingel in Schoonhoven, targeting potential buyers and interested parties.	Houses → Townhouses ⁶³² Local Government → Municipalities ³⁰²⁶	townhouse ⁷⁰ registration ⁴³⁶⁶ apartment ⁵⁰⁸⁸ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hethuisvannoord.nl	Stichting ‘t Huis van Noord	Wijkcentrum ‘t Huis van Noord organizes activities to bring people together in Schoonhoven Noord and improve living and co-existence in the neighborhood.	Neighborhood Focus → Neighborhood Centers ¹⁸⁷ Curriculum & Resources → Educational Content ⁷²	neighborhood ²⁴²⁴ room ³⁴¹¹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dwmmakelaardij.nl	DWM Makelaardij	DWM Makelaardij is a real estate agency specializing in the sale, purchase, and rental of properties in the Rotterdam, Capelle aan den IJssel, and Krimpenerwaard regions.	Real Estate → Regional Agencies ²¹⁵	purchase ²²¹² market ²⁷⁷² sale ⁵⁹³⁰ rental ⁷²⁵⁷ property ⁷⁴⁰⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
podoxpert.nl	PodoXpert	The PodoXpert website offers podiatric care at various locations in the Utrecht region. The site aims to provide quality care and expert advice on foot problems and foot health, including orthopaedic shoes and insoles.	Specialized Medical Services → Specialized Care ³⁸⁴ Orthopedics → Foot Problems ⁹⁷⁷	foot complaints ³⁴ shoe advice ⁴⁴ shockwave therapy ⁶² podotherapy ¹⁶⁸ insole ³⁵¹	Leidsche Rijn → Terwijde ²⁰
ichthushoorn.nl	Stichting Leergeld	The website of Ichthus Hoorn elementary school provides information about the school, its approach, and services.	Personal Development → Talent Development ¹⁵¹ Neighborhood Focus → Neighborhoods ¹⁰²⁸	movement ²³⁰⁴ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Gouderak ¹⁰³
makeyourownring.nl	Sophia Zobel	The website offers a kit allowing customers to design and have a custom sterling silver ring cast and polished by a professional goldsmith.	Accessories → Jewelry ³⁵¹⁷ Building & Construction → DIY ¹⁰⁰⁷	sterling silver ¹² goldsmith ²²⁴ wax ⁷¹¹ ring ⁸⁰⁰ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
degierbv.nl	Loon- and Grondverzetbedrijf De Gier BV	Loon- and Grondverzetbedrijf De Gier BV’s website provides information about their services and projects in the areas of rental work, civil and cultural techniques, and waterworks.	Agriculture → Agricultural Services & Contracting ⁷⁰⁸ Exterior Works → Excavation ³¹⁶	rental work ¹⁶ hydraulic engineering ²³ civil engineering ⁹² excavation ³⁸² construction ⁷⁴²¹	Krimpenerwaard → Bergambacht ³⁰³
kantorice.nl	Schep Groep BV	The website of Kantorice offers a wide range of services and products related to office furnishing, office furniture and stationery, catering to both small businesses and larger organizations.	Furniture → Office Furniture ⁵⁷¹	office furnishing ⁸⁹ office furniture ²⁰⁰ work environment ²⁹⁵ acoustics ³⁵² office supplies ⁴³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
huidstudiozuiver.nl	Huidstudio Zuiver Schoonhoven	Huidstudio Zuiver is a beauty salon located in Schoonhoven that offers professional skincare treatments for both men and women.	Websites → Business Profiles ¹⁷ Salon & Treatment Centers → Beauty Centers ⁶³¹	skincare ¹⁹⁷² salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
waterlandchiropractie.nl	Waterland Chiropractic	Waterland Chiropractic offers expert chiropractic care at multiple locations in the Netherlands, focused on pain relief, functional restoration, and revitalization of patient health.	Pain Therapy → Pain Relief ⁴⁴⁰ Physical Therapy → Chiropractic ⁴²⁰	pain ¹⁹¹⁹ patient ⁴⁰⁸² health ⁶³⁶⁶ care ¹²³³⁸ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	West-Betuwe → Stationswijk ⁶⁴⁹
bcouderkerk.nl	Badminton Club Ouderkerk	The website of Badminton Club Ouderkerk presents information about the club, its activities, membership options, and contact details.	Combat → Badminton ⁷⁰²	badminton ⁴⁵³ recreation ⁷⁹⁹ youth ³¹²⁶ club ⁴²²⁵ competition ⁴⁷⁵⁹ member ¹⁰¹⁵⁴	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
alblasinfra.nl	Alblas Infra BV	Alblas Infra BV's website provides information about their infrastructure services, including groundwork, drainage, paving, and project portfolio.	Projects → Water ⁹⁰ Civil & Infrastructure → & Waterways ⁹⁶	drainage ¹³²² groundwork ¹³⁴⁸ paving ¹⁹⁴²	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
rietdekkersbedrijfblom.nl	Rietdekkersbedrijf L. Blom	This website of Rietdekkersbedrijf L. Blom presents the company and the services it offers, primarily thatched roofing, renovation advice, and maintenance.	Roofing → Thatch Roofing ²²¹	thatched roofing ¹⁶ thatch ³³ timberwork ⁴⁰² roof ³⁶⁶² renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Haastrecht ¹⁹³
hoogtijadvies.nl	Hoogtij Advies	The website of Hoogtij Advies offers recruitment and selection services for both job seekers and employers, with a focus on temporary and permanent staffing.	HR Services → Specialized Recruitment ²⁰⁹	candidate ¹⁸⁹⁶ recruitment ²⁰¹⁵ staff ³⁴⁰⁵ vacancy ⁶⁵⁹⁸ network ¹¹¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jeroenstruik.nl	Jeroen Struik	The website of Jeroen Struik showcases his work as a writer and speaker, with a focus on Christian themes and providing inspiration, particularly for children. It also promotes an online book and a schedule of events.	Christianity → Evangelism ¹³⁰ Books → Children’s Books ¹⁰⁴²	jesus ⁴¹¹ speaker ¹⁴⁸¹ story ⁸²⁸⁵ book ¹¹³⁹⁶ event ⁴⁵¹⁹⁹	De Ronde Venen → Mijdrecht ⁷⁰⁰
noorderkoor.nl	Goudse Noorderkoor	The website of the Goudse Noorderkoor provides information about the choir, including background, repertoire, rehearsal schedule, and upcoming events.	Choral → Choir ¹⁸⁴² Social Organization → Religious Organizations ¹⁰⁶⁹	faith community ⁴⁹ rehearsal ¹⁶³⁹ repertoire ²⁴⁹⁷ choir ³¹²³ member ¹⁰¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mijnmkbapp.nl	Mijn MKB App	Mijn MKB App is a platform that enables entrepreneurs to create and manage affordable mobile apps and websites.	Enterprise Solutions → Business Software ⁶¹⁵⁶	cms ⁶¹³ app ⁴⁵⁹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wolcafe.nl	Wolcafé	Wolcafé is a webshop and store that sells yarn, wool, and accessories for knitting and crocheting, as well as workshops.	Home → Textiles & Fabrics ⁹²	crochet kit ³² yarn ⁴⁰⁷ wool ⁴⁸⁹ brand ¹⁷⁷³⁷ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
veerdienst-schoonhoven.nl	Veerdienst Schoonhoven B.V.	The Veerdienst Schoonhoven B.V. website provides information about the ferry service that connects the Alblasserwaard with the Krimpenerwaard across the Lek river, including schedules, fares, and the transition to the Veerpas.	Public Transportation → Regional Transportation ⁹² Water Transportation → Ferries ¹²⁹	fare ⁸⁶ ferry ¹⁷⁹ river ³¹² schedule ²⁶²⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vandenheuvel-orgelbouw.nl	Van den Heuvel Organ Construction B.V.	The website of Van den Heuvel Organ Construction presents its services in the area of new construction and restoration of organs, as well as their projects and portfolio.	Instrument → Organs ¹⁷⁷ Instrument → Organ Building ⁴⁵	organ ⁶³³ instrument ¹²⁹⁵ restoration ³⁴¹⁷ construction ⁷⁴²¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
gemaalhaastrecht.nl	Stichting Museum Gemaal De Hooge Boezem	The Gemaal De Hooge Boezem museum behind Haastrecht provides information about the history of the mill, the polder, and water management practices.	Museums → Historical Museums ³⁴¹ Museums → Regional Museums ³⁹⁰	polder ⁴⁷⁶ mill ⁴⁸⁷ visitors ¹⁰⁴⁸ museum ²⁰⁰² water ²⁵⁰¹ volunteer ⁸³⁶⁷	Krimpenerwaard → Haastrecht ¹⁹³
stoottroepers.nl	Bond van Oud-Stoottroepers en Stoottroepers (BOSS)	The website of the Association of Former Stoottroopers and Stoottroopers (BOSS) aims to maintain friendships formed during service in the Stoottroepen Regiment, maintain contact with the regiment, honor and commemorate fallen soldiers, and represent the interests of its members and ex-members.	Specialized History → World War II ¹¹³⁴ Military Affairs → Military Organizations ¹⁶	regiment ³⁷ tombstone ⁸⁰ memorial ¹⁹⁶ loss ⁷⁴⁰ association ⁸⁵⁶² member ¹⁰¹⁵⁴	The Hague → Haagse Hout ³⁴⁷
jeoudekazernenu.nl	Stichting Je oude kazerne nu	The website 'Je oude kazerne nu' provides information on former Dutch military and air force barracks, with a focus on their history, current state, and potential redevelopment.	Rural Development → Rural Housing ¹⁴ Specialized History → Military History ⁵⁰⁷	barracks ¹¹ redevelopment ⁹³ photo gallery ²⁰⁶ architecture ³²²³ history ⁷²⁸⁶	Gooise Meren → Naarden ¹¹⁵⁴
joodserfgoedrotterdam.nl	Montefiore Rotterdam Foundation	This website provides information about the Jewish history and heritage in Rotterdam and the surrounding area, focusing on historical traces, cultural aspects, and the development of the Jewish community.	Local History → Dutch History ¹⁰⁶⁷	jews ⁴⁰ synagogue ⁶⁹ history ⁷²⁸⁶ community ⁷⁹³¹	Voorne aan Zee → Brielle ⁶¹³
bisdomvanvliet.nl	Museum Paulina Bisdom van Vliet	Museum Paulina Bisdom van Vliet is a historic residential museum that offers visitors a glimpse into the life of a wealthy patrician family in the 19th and 20th centuries.	Dutch History → 19th Century ⁷⁷ Visual Arts → Museums ²⁰⁴⁹	period ⁹⁴ museum ²⁰⁰² life ²⁶⁷³ family ⁶⁴⁶² collection ⁷⁵⁶⁶ house ⁸¹²¹	Krimpenerwaard → Haastrecht ¹⁹³
digiwaard.nl	DigiWaard	DigiWaard is a computer specialist offering IT support and services at home and business.	Computer → Computer Repair ⁸⁹⁸	virus ¹⁹⁵ wifi ¹³⁷² computer ¹⁹⁶⁹ data ⁵⁸⁷²	South-Holland → Gouda ³⁵²¹
kanoroutes.nl	Johans Kayak Site	The website provides information about tourist kayaking routes in the Netherlands and abroad.	Water Sports → Kayaking ⁵¹ Planning → Tours ⁸⁷⁰	kayak ¹⁰⁴ netherlands ¹³⁷⁶ trip ²⁰³²	Altena → Werkendam ³⁹⁹
historischeverenigingschoonhoven.nl	Historical Association Schoonhoven	The website of the Historical Association Schoonhoven (HVS) provides information about the association, its activities, the history of Schoonhoven, and the preservation of local heritage.	Local History → Provincial History ¹²² Monuments → Heritage ⁵²⁶	heritage ⁸¹⁸ history ⁷²⁸⁶ story ⁸²⁸⁵ association ⁸⁵⁶² research ⁸⁹⁶⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
nederlandsefierljepbond.nl	Dutch Fierljepping Association (NFB)	The website serves as a central information source about fierce jumping (fierljeppen) in the Netherlands, including records, rankings, tournament overviews, and regulations. It also aims to support the Dutch Fierljepping Association (NFB).	Extreme Activity → Extreme Sports ⁶⁰	rankings ⁴⁴ record ¹⁰⁹⁸ tournament ²⁴⁷⁶ association ⁸⁵⁶²	Southwest-Friesland → IJlst ¹⁵⁷
overheidinzuidholland.nl	OverheidInNederland	The website provides information about the province of South Holland, including municipalities, water authorities, and officials.	Municipalities → Governance ¹⁰⁴³ Government & Administration → Regional Government ³⁶⁷	official ⁴⁸ water authority ⁵⁸ political party ⁷⁵ statistics ³⁹² province ⁵¹⁸ municipality ⁶⁸³⁷	South-Holland → Molenlanden ¹³⁴⁹
historischeuitgavenschoonhoven.nl	Historische Uitgaven Schoonhoven	The website of Historische Uitgaven Schoonhoven offers an online shop with historical books and magazines, with a focus on the history of Schoonhoven, particularly the Fonteynkoek.	Books → Historical Books ¹⁶	baker ⁹⁰ magazine ²¹⁸² history ⁷²⁸⁶ book ¹¹³⁹⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dezuidlanden.nl	Projectbureau De Zuidlanden	The website of De Zuidlanden provides information about the development of a residential area with multiple villages in Friesland, focusing on new construction projects, facilities, and the area's history.	Local Communities → Villages ¹⁰⁰⁵ Social Sciences → Genealogy & Family History ¹⁴⁰³	village ⁸⁰⁸ facility ²⁶¹⁶ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vvdrechtstreek.nl	vv Drechtstreek	The website of vv Drechtstreek provides information about the club, its teams, events, news, and general club information.	Clubs → Dutch Clubs ²⁰⁰	youth ³¹²⁶ match ³⁴⁷¹ club ⁴²²⁵ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
stadsavonturen.nl	Stadsavonturen	Stadsavonturen offers company outings in various cities of the Netherlands, with a focus on historical city walks and story trails.	Conferences & Meetings → Corporate Events ²⁴⁷² Tourism → City Tours ⁴⁶⁸	city walk ¹³⁰ company outing ¹⁶⁶	Bronckhorst → Vorden ⁴¹⁶
vvlekkerkerk.nl	vv Lekkerkerk	The website of vv Lekkerkerk provides information about the football club, including match data, training schedules, team information, news, membership information, and contact details.	Football → Amateur Football ⁷⁵⁷ Sports & Entertainment → Sponsorship ¹⁵¹	sponsorship ²⁶⁸⁶ youth ³¹²⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² training ²⁸¹³³	Krimpenerwaard → Lekkerkerk ²⁴⁴
vvschoonhoven.nl	vv Schoonhoven	The website of vv Schoonhoven provides information about the football club, its teams, events, news and history.	Local History → Dutch History ¹⁰⁶⁷ Team Sports → Volleyball ⁸⁴²	club ⁴²²⁵ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
spv81.nl	SPV '81	The website of SPV '81 serves as an information platform for members, volunteers, supporters, and the general public. It provides information about the association, its history, teams, events, organization, and policies.	Associations → Sports Associations ¹⁰⁸²	football ¹³⁴⁷ history ⁷²⁸⁶ volunteer ⁸³⁶⁷ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Krimpenerwaard → Gouderak ¹⁰³
vvgouderak.nl	Voetbalvereniging Gouderak	The website of Voetbalvereniging Gouderak provides information about the association, its teams, activities, history, and contact details.	Winter Sports → Skating ⁸⁴¹ Sports Activities → Football ⁴¹⁴⁴	dike ¹⁴⁸ football ¹³⁴⁷ club ⁴²²⁵ association ⁸⁵⁶²	Garmerwolde → Lageweg ¹²
voedselbankijsselenlek.nl	Voedselbank IJssel en Lek	The website of the Voedselbank IJssel en Lek provides information about the food assistance offered by the organization in the Krimpenerwaard municipality, specifically targeting people experiencing poverty. It offers information on applications, donations, and volunteer work.	Social Issues → Poverty Prevention ⁵⁵	food bank ²¹⁶ donation ⁵¹¹⁰ municipality ⁶⁸³⁷ volunteer ⁸³⁶⁷	Krimpenerwaard → Bergambacht ³⁰³
beiaardier-jaapvanderende.nl	MCM Websites	This website is dedicated to the life and work of beiaardier (bell ringer) Jaap van der Ende, who passed away on September 13, 2018, at the age of 90. It provides information about his life, philosophy, and contributions to the art of bell ringing.	Instrument → Instrumental Music ¹⁹⁷	carillon ⁵⁴ craft ⁵³⁸ audience ⁹⁰¹ instrument ¹²⁹⁵ repertoire ²⁴⁹⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hetcommissarishuys.nl	Municipality of Gouda	The website describes the history and activities of the Commissarishuys, the Gouds Wagenveer, and the IJsselsteentjes Koetsrit – three historical locations in Gouda.	Local History → Dutch History ¹⁰⁶⁷ Historical & Tourism → Historical Transportation ¹⁸		South-Holland → Hollandsche IJssel ⁴⁸
boerderijverbouwen.nl	Bureau Boerderij Verbouwen	Bureau Boerderij Verbouwen provides specialized advice and guidance on the purchase and renovation of residential farmhouses, with a focus on mapping out renovation possibilities and preparing cost estimates.	Rural Development → Rural Housing ¹⁴ Legal & Permits → Construction Advice ²⁸⁹	cost estimate ⁴⁶ farmhouse ⁸⁷⁸ purchase ²²¹² renovation ¹³⁸⁴⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
anetinterieurs.nl	Anet Interieurs	Anet Interieurs is an interior design firm specializing in creating inspiring and functional work and living spaces for businesses and individuals.	Office Space → Rental Space ⁵³⁷	space ³⁸⁴⁶ atmosphere ⁵⁵⁹¹ interior ⁸⁰⁹³ design ²⁷²⁰²	Eindhoven → Strijp ⁵²⁷
dewerkbankvansandra.nl	De Werkbank van Sandra	The Werkbank van Sandra's website offers workshops and retreats focused on embroidery, with a focus on creative vacations and online courses.	Crafts → Embroidery ⁶²⁴ Crafts → Knitting ⁵³⁷	diy ⁴⁴³ embroidery ⁶¹⁴ retreat ¹⁶³⁸ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
devriesverburg.nl	De Vries en Verburg	De Vries en Verburg is a construction company specializing in developing, building, and maintaining real estate.	Renovation & Restoration → Construction Industry ⁴⁹⁹	building ³²⁰⁴	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
bregje.nl	Bregje	Bregje is a restaurant chain with locations throughout the Netherlands, offering delicious food and drinks in a cozy atmosphere, featuring various menus and reservation options.	Cafes → Dutch Restaurants ¹⁰³¹	gift card ⁵⁸² reservation ³³⁷³ newsletter ⁶⁵⁰⁴ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Amsterdam → North ⁶⁵⁷
museumjeugduniversiteit.nl	MuseumJeugdUniversiteit	The website provides information about children’s lectures organized by various museums in the Netherlands, aimed at children aged 8 to 12 and focusing on history, culture, and technology.	Visual Arts → Museums ²⁰⁴⁹ Early Years → Early Childhood Education ¹³⁴⁵	lecture ¹⁶²⁴ museum ²⁰⁰² newsletter ⁶⁵⁰⁴ collection ⁷⁵⁶⁶ child ¹¹⁵⁶⁶	Haarlem → Spaarne ²⁷
kwintes.nl	Kwintes	The Kwintes website provides support and guidance to individuals seeking assistance with various needs, including supported housing, sheltered housing, accommodation, and family coaching, aiming to help them regain independence and take responsibility for their lives.	Coaching → Family Coaching ¹⁷⁰ Social Services → Family Support ³⁸⁰	family coaching ²⁷ recovery ⁸⁶⁸ housing ⁴³⁷⁸ accommodation ⁴⁹²¹	Utrecht Hill Ridge → Doorn ⁶¹⁵
bunchofbastards.nl	BoB	The website serves as an online presence for the folk band ‘Bunch of Bastards – Full Force Folk’, showcasing their performances, releases, and upcoming events.	Genres → Blues ²⁷⁵ Traditional → Folk Music ²⁹⁹	gig ⁵⁶ merchandise ¹⁰⁶¹ band ²⁹⁷⁷ festival ³⁸⁰⁴ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
lernert.nl	N/A	The website provides an overview of various articles and blog posts focusing on local events, places, and topics in the Gelderland region, covering themes ranging from renovation projects (latex spraying, PVC flooring) to local history and landscape.	Sustainable Living → New Developments ²⁰⁰ Municipalities → Dutch Municipalities ⁵¹⁶	latex spraying ⁷⁵ pvc flooring ¹⁹⁹ region ⁵⁴¹² article ⁶⁰⁰⁰	Mook en Middelaar → Mook ¹⁸⁰
poldersmetwaarden.nl	Polders met Waarden	The website 'Polders met Waarden' provides information about the LEADER subsidy program and associated projects focused on the economic development of the rural areas of Alblasserwaard, Gouwe-Wiericke, and Krimpenerwaard.	International Cooperation Projects → European Union ¹¹⁷ Business → Economy ³⁶⁶⁶⁶	economic development ¹⁴ rural ¹⁸ leader ²⁶⁶ subsidy ²⁶⁴⁹ sustainability ¹⁸⁴⁵¹	South-Holland → Alblasserwaard ²⁸¹
fietsenvoormijneten.nl	Fietsen voor m'n eten	The website aims to create a national platform with regional strength that helps consumers find their daily food along the way via cycling routes.	Agricultural Technology & Innovation → Sustainable Agriculture ²⁷⁸ Nature → Biodiversity ³⁸²	sales point ³⁹ map ⁸⁰¹ cycle ¹⁹⁰⁶ tips ²⁷⁸⁹ food ³⁸⁷² region ⁵⁴¹²	Raalte → Luttenberg ⁵³²
dehaay.nl	De Haay Bouwwerken	De Haay Bouwwerken is a construction company specializing in the production and installation of frames and the execution of various building projects.	Building & Materials → Carpentry & Joinery ⁸³⁰	carpenter ²²⁰ frames ²⁵⁵⁶ house ⁸¹²¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
denfit.nl	Denfit	Denfit Outdoor Fitness Equipment is a global leader specializing in high-quality and innovative outdoor fitness equipment, offering both standardized and custom-made solutions.	Fitness → Outdoor Fitness ¹⁰⁹ Fitness → Fitness Equipment ³⁶⁸	fitness equipment ²³⁰ customization ¹⁷²³ equipment ⁴¹⁴³ innovation ⁴⁶⁵⁹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
stichtingnatuurrijk.nl	Stichting Natuurrijk	The Stichting Natuurrijk is an organization dedicated to preserving and expanding the Natuurrijk nature reserve in the Krimpenerwaard, with the goal of restoring and managing a diverse ecosystem without the use of harmful substances.	Nature → Nature Reserves ¹⁰³² Environment → Conservation ³²⁸	fauna ¹⁴³ flora ¹⁷¹ nature reserve ³³⁹ biodiversity ⁷²⁰ foundation ⁶⁶⁷⁸
taxi-krimpenerwaard.nl	Taxi Krimpenerwaard	The website Taxi Krimpenerwaard online provides an online platform for booking taxi and taxibus services, including city taxi, airport taxi, medical transport, wheelchair transport, and harbor transport in the Krimpenerwaard region and surrounding areas.	Air Travel → Airport Transfers ³³¹ Public Transportation → Regional Transportation ⁹²	taxibus ⁷¹ fare ⁸⁶ taxi ²⁰⁹⁰ transport ⁶¹⁰⁵ book ¹¹³⁹⁶	Eindhoven → Strijp ⁵²⁷
kunstwaard.nl	KrimpenerKunstWaard	The KrimpenerKunstWaard website showcases artists and activities in and around the Krimpenerwaard region, including exhibitions, workshops, lectures, and association activities.	Galleries & Exhibitions → Exhibitions ¹⁰⁸³	work ³¹²² exhibition ⁵³³² artist ⁵⁷⁴⁵ association ⁸⁵⁶²
charlesvermeer.nl	Charles Vermeer Zanginstituut	The Charles Vermeer Zanginstituut offers singing lessons and choirs for various levels and ages, and organizes workshops and events.	Education & Training → Singing ⁸⁷⁸	singing lessons ²⁴³ teacher ²⁸⁹⁰ choir ³¹²³ workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
streekfondskrimpenerwaard.nl	StreekFonds Krimpenerwaard	The StreekFonds Krimpenerwaard is a foundation dedicated to the sustainable development and preservation of the Krimpenerwaard landscape and its attractiveness to residents, businesses, and visitors.	Local Economy & Development → Regional Development ²⁹⁶ Nature Conservation → Landscape Conservation ¹¹⁴	landscape ²⁶⁰⁹ donation ⁵¹¹⁰
deappelgaard-gouderak.nl	Gastenboerderij De Appelgaard	Gastenboerderij De Appelgaard is a Bed & Breakfast and meeting location situated in the Krimpenerwaard, along the Hollandse IJssel.	Conferences & Meetings → Meeting Locations ¹⁷¹	nature area ⁴⁹⁷ meeting room ⁶⁸⁵ farm ²⁶²² accommodation ⁴⁹²¹ apartment ⁵⁰⁸⁸	Krimpenerwaard → Gouderak ¹⁰³
locallio.nl	Locallio B.V.	Locallio is a website and app that helps users find local businesses and services in their area.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷	flyer ²⁷⁴ promotion ²⁰⁶² shop ⁶⁴⁸³ restaurant ¹¹²¹⁵	Vijfheerenlanden → Ameide ⁹⁷
brons-industrie.nl	Stichting tot Instandhouding van Brons en Industrie Motoren	This website informs and invites visitors to participate in the preservation of Bronze and Industrial Engines.	Sports & Auto → Automotive Events ⁷⁵ Business → Industry ³⁶⁹⁷⁷	bronze ²²⁵ engine ⁷⁵⁸ industry ¹⁷⁸⁰ book ¹¹³⁹⁶ brand ¹⁷⁷³⁷ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
haastrechtloop.nl	Haastrechtloop	The Haastrechtloop website serves as an information hub for the annual performance run event held in Haastrecht, providing details on registration, sponsorship opportunities, and photos from previous years.	Football → Competitions ¹⁰⁷² Running → Marathons ⁶⁰	run ⁸⁰⁰ sponsorship ²⁶⁸⁶ route ³⁴²⁵ registration ⁴³⁶⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
labelle-epoque.nl	La Belle Epoque	La Belle Epoque is a location in Lekkerkerk, Krimpenerwaard, offering wedding couples the opportunity to celebrate their marriage in a rustic-chic setting.	Accommodation → Country Estates ⁷³⁸ Celebratory Occasions → Wedding Celebrations ¹⁹	meadow ⁷⁵ wedding ⁴²⁵⁸ catering ⁶⁴⁵⁶ child ¹¹⁵⁶⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
atelier925.nl	Atelier925	Atelier925 is a goldsmith based in Meeuwen, Altena, specializing in the design and creation of unique jewelry, particularly wedding and engagement rings, and offers repairs and modifications.	Repair → Jewelry Repair ²⁹ Crafts → Goldsmithing ¹⁶⁸	wedding rings ²⁸¹ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gkalmkerk.nl	Gereformeerde Kerk Almkerk	The Gereformeerde Kerk Almkerk website provides information about upcoming church services, events, and activities.	Protestant Churches → Evangelical ⁵⁵² Protestantism → Churches ¹⁰⁰⁹	gathering ³⁹⁴ meetings ¹⁰¹¹ schedule ²⁶²⁴ collection ⁷⁵⁶⁶	Altena → Almkerk ¹⁵⁹
hetslotverzamelingen.nl	HetSlotVerzamelingen.nl	HetSlotVerzamelingen.nl is a webshop selling old postcards and books.	Books → History ²⁷ Home → Antiques & Collectibles ¹⁵²³	postcard ²⁷⁸ condition ⁴²⁵ publisher ⁷⁵⁷ book ¹¹³⁹⁶	Southwest-Friesland → Workum ³⁶³
sbtm.nl	Sonisch Boorbedrijf SBTM	The website of Sonisch Boorbedrijf SBTM presents their services in the field of sonic drilling and fieldwork, with a focus on soil research, archaeology, and soil injection.	Environmental Services → Soil Investigation ⁶³ Technology & Innovation → Construction Technology ⁷⁹⁰	borehole ¹⁰ archaeological research ¹⁶ soil investigation ⁸⁰ injection ¹¹¹	Dalfsen → Nieuwleusen ³¹⁸
zipfestival.nl	Stichting Zing !n de Polder	Z!Pfestival is a neighborhood association that organizes weekly and monthly gatherings focused on prayer, worship, and social meetings.	Village Focus → Village Life ²⁶² Community & Social → Social Events ⁴¹⁶	responsibility ³²⁹ friend ⁶³⁹ meal ¹⁶³⁸ meeting ²³⁸¹ newsletter ⁶⁵⁰⁴	Lopik → Polsbroek ⁴⁹
jan-vink.nl	Jan Vink Afscheid & Uitvaart	The website Jan Vink Afscheid & Uitvaart provides personalized guidance in planning a funeral and arranges a customized funeral, including aftercare.	Social Services → Grief Support ⁵⁸⁷ Family → Funeral Services ²⁰⁸⁴	wish book ³⁴ coffin ¹⁸⁵ aftercare ²²⁴ funeral ²⁴⁷⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
hondenbrokkenmakers.nl	HondenBrokkenMakers	HondenBrokkenMakers is an organization focused on the adoption, fostering, and support of dogs.	Social Organization → Child Welfare ¹¹⁴⁷ Dogs → Adoption ⁹⁷	foster ²⁴ annual reports ³¹¹ adoption ³⁵⁹ partner ⁴²⁷² dog ⁵⁴⁸³ foundation ⁶⁶⁷⁸	Krimpenerwaard → Bergambacht ³⁰³
deelautovergelijker.nl	Deelauto Vergelijker B.V.	The website compares the prices of various car-sharing providers to help users find the most affordable option.	Mobility → Car Sharing ²⁵ Websites → Comparison Sites ⁸⁶⁹	car sharing ⁵⁵ filters ⁴²⁴ map ⁸⁰¹ provider ¹¹¹¹ route ³⁴²⁵ price ⁸³²⁸	Haarlemmermeer → Badhoevedorp ⁶⁰⁴
royalkidshome.nl	Royal Kids Home	The Royal Kids Home website provides childcare and after-school care for children aged 0 to 13 years, with 15 locations in the region.	Childcare → After-School Care ⁷⁶⁵	toddler group ²³ after school care ²⁰² policy ²¹⁴⁹ childcare ³⁵¹² parent ⁴³¹⁸	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vonkdiervoeders.nl	Vonk Diervoeders	Vonk Diervoeders is a pet store offering a wide range of animal feed and supplies, and where customers can receive expert advice.	Animals → Pet Stores ⁴⁷⁸	feed ⁶⁷² supply ⁹⁶¹ store ³⁹⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vlraccountants.nl	VLR accountants	VLR accountants is an accounting firm that provides clients with administrative services, audit, and advice, focused on a long-term partnership.	Business Services → Finance & Accounting ⁶⁶¹³	tax services ¹³² audit ⁶²² account ⁵⁷⁸¹ administration ⁶⁵⁸⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
orie-advies.nl	ORIE Advies	The website of ORIE Advies presents services and expertise in the management of public spaces, with a focus on achieving balance between the environment, organizations, and professionals.	Urban Planning → Public Space ¹⁸⁸ Environment → Climate Change ⁴⁷⁹	public space ¹³⁷ team coaching ²⁷⁵ cooperation ⁴³³ measurement ⁷³¹ balance ⁴⁵⁸²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
flyingeagle.nl	Flying Eagle	The Flying Eagle website provides advisory and organizational support to companies and organizations, with a focus on events, marketing, and sales.	Personal Services → Home ¹² Business Support & Advisory → Advisory ⁴¹³	organize ¹⁶⁷ promotion ²⁰⁶² concert ⁴⁴⁰⁹ marketing ⁷¹⁰⁷ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
opgroeigids.nl	OpgroeiGids	The website OpgroeiGids provides information and resources for parents, teachers, and professionals regarding children aged 0 to 12 years.	Family → Parenting ¹³¹⁶	knowledge base ⁵⁶⁹ childcare ³⁵¹² recipe ⁵¹⁴² school ⁷⁸⁵⁶	Haarlem → Spaarne ²⁷
stadsarrangement.nl	Stadsarrangement	The website Stadsarrangement offers a wide range of fully organized corporate outings and staff outings in the Netherlands, Belgium, and Germany.	Corporate Events → Team Building ¹⁰⁰⁵	staff outing ¹⁷ corporate outing ³⁸⁸ team building ⁷²⁰ outing ⁹⁸² city ¹⁸⁷⁵	The Hague → Scheveningen ¹⁶²⁵
golfbaancrimpenerhout.nl	Golfbaan Crimpenerhout	Golfbaan Crimpenerhout is a golf course providing facilities and activities for golfers of all levels.	Networking → Business Clubs ¹⁶² Sport Facility → Golf ¹⁴⁴¹	golf course ⁵⁰⁷ hall ¹⁷⁸⁶ competition ⁴⁷⁵⁹ lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴² course ¹⁴⁷²⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
devriesschoenen.nl	De Vries Schoenen	De Vries Schoenen is a shoe store in Lekkerkerk, Krimpenerwaard, with a long tradition of offering quality shoes and personalized advice.	Fashion → Footwear ³⁵ Clothing & Accessories → Shoe Stores ⁴⁴¹	comfort ¹⁴⁷³ shoes ²⁶⁹⁹ collection ⁷⁵⁶⁶ brand ¹⁷⁷³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
amelandportal.nl	Amelandportal.nl	The Amelandportal.nl website provides a comprehensive source of information about the Wadden Island of Ameland.	Vacations → Island Vacations ²⁴³ Travel → Tourism ³⁷⁵⁴	wadden sea ¹⁷⁰ dune ⁶¹¹ village ⁸⁰⁸ museum ²⁰⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vanderheidenkaas.nl	Van der Heiden Kaas	The website of Van der Heiden Kaas presents the history, cheese production, brands, and quality guarantee of this cheese farm and cheese shop, located in the vicinity of Stolwijk.	Dairy → Cheese ⁵³⁰ Environment → Agriculture ¹¹¹⁶⁰	tradition ⁷³⁶ agriculture ⁷⁷⁸ cheese ¹²⁰⁵ brand ¹⁷⁷³⁷	Krimpenerwaard → Stolwijk ²³²
petsworldtropika.nl	Petsworld Tropika	Petsworld Tropika is a pet store in Bergambacht that sells everything for pets, horses, and other animals.	Animals → Pet Food ⁵⁸⁴	habitat ⁷⁵ pass ⁹² grooming ⁸⁹⁶ pet ¹⁶¹⁷ food ³⁸⁷² store ³⁹⁰¹	Krimpenerwaard → Bergambacht ³⁰³
artfeelings.nl	Artfeelings Kunst en Fotografie	The Artfeelings website is an online platform where artist Joke Rietveld offers paintings and photographic services, including photo shoots and reports. The site also features an online shop and a blog with photography tips.	Painting → Contemporary Painting ⁴⁵²	online shop ¹³¹⁰ paintings ³⁹⁰⁷ photo ⁷⁷⁷⁸ photography ⁹⁵⁰³ blog ¹³³⁹² event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
stoppelenburguitvaart.nl	Stoppelenburg Uitvaartverzorging	Stoppelenburg Uitvaartverzorging provides funeral services that focus on reflecting the life story of the deceased and offering personal guidance during the grieving period.	Death → Funerals ⁵⁵²	farewell ¹¹⁰⁹ grief ¹⁵⁷⁷ funeral ²⁴⁷⁷ life ²⁶⁷³ wishes ²⁷¹⁷ story ⁸²⁸⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
klusbedrijfpieterdegroot.nl	Klusbedrijf Pieter de Groot	The website of Klusbedrijf Pieter de Groot is an online platform offering various handyman services for and around the home, including landscaping, interior design, and painting.	Home Improvement → Home Repair ²⁰ Household & Cleaning → Home Services ¹³²¹	handyman ⁸³⁶ landscaping ¹⁵²⁹ paint ⁸⁷⁴⁷ quote ¹²⁸⁶³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
goldenriver-lekkerkerk.nl	Golden River	Golden River Restaurant in Lekkerkerk offers Cantonese and authentic Chinese dishes and organizes events such as weddings and parties.	Catering & Ready Meals → Chinese Restaurants ³⁰³	restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
visbagger.nl	Vis Groep	The Vis Groep website presents the company as a specialist in small-scale dredging and water construction projects, with a long tradition in polder construction.	Civil & Infrastructure → Water Construction ¹²⁰ Civil & Infrastructure → Infrastructure ¹⁰³³	dredging ⁹⁸ float ¹⁵⁹ pump ⁶²⁵ transport ⁶¹⁰⁵ maintenance ²⁰⁰⁹³
antobeeldengeluid.nl	Anto Beeld en Geluid	Anto Beeld en Geluid is a store in Bergambacht that has been active for over 25 years and focuses on televisions and sound systems from top brands.	Audio → Sound Systems ³⁶ Electronics & Components → Television ²⁶²	return policy ⁷² sound system ¹⁶⁶ television ⁷⁰⁹ assortment ⁷⁷⁹⁹ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
toegankelijkheidscertificaat.nl	Toegankelijkheidsrapporten 200 OK	Toegankelijkheidsrapporten 200 OK provides research reports on the digital accessibility of websites, apps, and PDFs.	Web Development → Accessibility ²⁰⁴ Government & Administration → Digital Government ⁸⁶	audit ⁶²² report ⁴⁵⁵¹	The Hague → Haagse Hout ³⁴⁷
brouwerij-ijssel.nl	Brouwerij IJssel	Brouwerij IJssel is a brewery located in the Dutch IJssel region, offering an online shop with various beers and merchandise.	Beer → Breweries ³³⁷	brewery ⁴⁹⁸ tours ¹⁰⁴⁸ beer ²⁸⁸⁷ festival ³⁸⁰⁴ shop ⁶⁴⁸³	Oude IJsselstreek → Megchelen ³¹
leerlingzakenmh.nl	Bureau Leerlingzaken Midden-Holland	Bureau Leerlingzaken Midden-Holland is a government agency dedicated to preventing and reducing school absenteeism among young people aged 12 to 18+, as well as supporting their parents and professionals. The aim is to promote participation in education and support the students' educational pathway.	Educational Policy & Systems → Compulsory Education ¹⁵ Special Needs & Support → Educational Support ²¹⁹⁵	young people ¹⁰⁴⁵ municipality ⁶⁸³⁷ education ¹³⁴⁷¹	Krimpenerwaard → Bergambacht ³⁰³
av.nl	AV	The website of AV presents recruitment services, job vacancies, and company information, with a focus on finding, selecting, and developing commercial professionals.	Online Services → Job Boards ¹⁰³⁶	account manager ⁹¹ professionals ¹⁹⁶⁶ recruitment ²⁰¹⁵ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
davevandamsport.nl	Dave van Dam Sport	Dave van Dam Sport is a skate and inline skate shop providing advice and service to customers.	Skating → Inline Skating ⁵⁸ Apparel → Sporting Goods ¹³⁷⁴	skates ¹⁴⁸ helmet ²³⁶ frame ⁸⁸³ shoes ²⁶⁹⁹ accessories ¹²⁹⁷⁵	Krimpenerwaard → Haastrecht ¹⁹³
ibkw.nl	Ingenieursbureau Krimpenerwaard	Ingenieursbureau Krimpenerwaard (IBKW) provides technical consulting and engineering services to the municipalities of Krimpenerwaard and Krimpen aan den IJssel.	Planning & Development → Spatial Planning ⁸⁸⁹ Manufacturing & Industrial → Engineering ³⁹¹⁹	civil engineering ⁹² spatial planning ¹⁹⁰ consulting ³⁶³⁹ municipality ⁶⁸³⁷	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
poldergym.nl	Poldergym	Poldergym is a sports club in Krimpenerwaard offering fitness facilities, group classes, and personal training to help members achieve their fitness goals.	Group Class → Fitness Centers ¹⁰¹⁰ Personal & Household → Fitness Services ¹⁶²	personal training ¹²⁷¹ group classes ¹³⁰⁶ fitness ²²⁵¹ facility ²⁶¹⁶ membership ¹⁰⁴⁴² training ²⁸¹³³
bominterieurs.nl	Bom Interieurs	Bom Interieurs is a furniture maker based in Schoonhoven that specializes in custom-made furniture for private individuals, businesses, and institutions.	Interior → Furniture ⁷⁴⁵⁴	interior ⁸⁰⁹³ software ⁸²⁹¹ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
cjghm.nl	Centrum voor Jeugd en Gezin Regio HM	The website of the Centrum voor Jeugd en Gezin (CJG) provides information and support for young people, professionals, and parents with questions about raising and growing up. The website also allows users to select their local CJG.	Family → Parenting ¹³¹⁶ Living → Municipal Services ¹⁸	cjg ¹⁰ parenting ⁹⁷² agenda ⁴³⁷⁴ blog ¹³³⁹² course ¹⁴⁷²⁸	South-Holland → Kaag en Braassem ⁹⁶⁰
speearchitecten.nl	Spee Architecten	The website of Spee Architecten showcases architectural and design projects and visions.	Urban Planning → Urban Development ³⁷⁸ Construction Companies → Residential Construction ¹⁰¹³	housing construction ¹²⁵ office ²⁸⁹⁸ interior ⁸⁰⁹³ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	Lansingerland → Bergschenhoek ⁵⁶⁸
hervormdpolsbroekenvlist.nl	Hervormde gemeente Polsbroek en Vlist	The website of the Hervormde gemeente Polsbroek en Vlist provides information about the church, its services, activities, and contact details.	Protestantism → Churches ¹⁰⁰⁹	diaconate ¹⁸² church service ⁸⁷⁹ youth ³¹²⁶ church ³⁴³⁹ member ¹⁰¹⁵⁴	Lopik → Polsbroek ⁴⁹
pietersrestaurant.nl	Pieters Restaurant	Pieters Restaurant is a restaurant in Bergambacht with a Michelin star offering culinary arrangements, particularly in the summer.	Outdoor → Terraces ¹⁸⁸ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	bakery ⁷¹⁸ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
vanherk.nl	Van Herk Makelaars	Van Herk Makelaars is a real estate agency specializing in the sale, purchase, and valuation of houses and commercial properties.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷	commercial property ⁴⁶⁹ listings ⁵²⁵ award ⁶⁴² netherlands ¹³⁷⁶ appraisal ¹⁴⁸⁸ house ⁸¹²¹	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
slotenmakerdrs.nl	DRS Lock Specialist	The website is an online advertisement for DRS Lock Specialist, a locksmith service provider operating in various regions of the Netherlands.	Repair → Lock Repair ²⁶⁶ Security & Surveillance → Security ³²⁵¹	locksmith ⁹¹⁹ locks ⁹⁵³ reviews ³¹⁷² security ⁶⁶⁵⁵ repair ¹⁴⁵⁷⁶	Leeuwarden → Bears ¹⁶
wsvdelek.nl	WSV De Lek	The website of WSV ‘De Lek’ provides information about the watersport association and its marina on the Lek River in Krimpen aan de Lek, Krimpenerwaard municipality, including information about membership, berths, and activities.	Boating → Marinas ⁸²⁵	watersport association ¹⁵ river ³¹² berth ³⁴¹ marina ⁴⁸⁷ association ⁸⁵⁶² membership ¹⁰⁴⁴²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hethuurteam.nl	The Huurteam	The Huurteam provides free assistance and advice to tenants regarding their rental agreements, service costs, and other rental issues.	Law → Rental Law ⁴⁰⁷ Rights → Tenant Rights ⁵⁷	service costs ⁴³ rental agreement ⁶⁷ landlord ²⁶⁷ right ³⁷⁹ rent ⁹⁸¹	Rotterdam → Feijenoord ⁴⁷⁷
villanuts.nl	Niet vermeld	This website publishes news and articles about various locations and topics in the Netherlands.	Investing → Cryptocurrency ⁷⁷⁶ Transportation → Driving & Lessons ¹¹⁶³	town ¹²⁶ license ¹²⁸⁸ region ⁵⁴¹² car ¹⁰⁸⁶⁵ news ¹⁵²⁹³	Land van Cuijk → Boxmeer ⁸⁶¹
smaraopleidingen.nl	Smara Opleidingen	Smara Opleidingen is an education center offering diverse courses and workshops focusing on NLP, coaching, and personal/business development.	Coaching → Systemic Coaching ¹⁷⁵ Systemic Approaches → Systemic Work ²⁸⁹	setup ³³⁰ nlp ⁴⁸⁷ course ¹⁴⁷²⁸ coach ²⁵⁸¹⁰ training ²⁸¹³³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
postroute.nl	postroute.nl	The website describes the Sociëteitsrit, a postal service organization established in 1725 to improve mail delivery between Alphen aan den Rijn and Hamont, and outlines the organization’s history and development.	Time Periods → 18th Century ²¹ Freight & Logistics → Courier Services ⁸³⁹	postal service ¹⁶ courier ⁴⁷³ city ¹⁸⁷⁵ contract ²⁴¹⁵	Waterland → Ilpendam ⁷⁸
clubstores.nl	Clubstores	The website is an online sports shop specializing in Mizuno sports shoes and Errea team clothing.	Team Sports → Volleyball ⁸⁴² Fashion → Shoes ¹²⁷⁴	team clothing ¹⁸ shoes ²⁶⁹⁹ clothing ⁹⁴⁴³	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
blauwebagger.nl	Blauwe Bagger	The website Circulaire Baggeroplossingen \| Blauwe Bagger aims to promote the reuse of dredged material as a sustainable and circular solution for raw materials, highlighting the problems with current extraction practices.	Civil & Infrastructure → Roads ²⁵² Sustainable Building → Dredging ⁴²	circular ³⁶⁹ raw materials ⁴⁴⁶ clay ⁴⁹⁵ sand ⁶³⁰	Krimpenerwaard → Bergambacht ³⁰³
vonkgouda.nl	Installatiebedrijf Vonk	Installatiebedrijf Vonk is an installation company based in Gouda offering a range of installation services.	Heating → CV Boilers ¹⁶⁷ Home Improvement → HVAC Systems ⁷⁷³	central heating boiler ⁸⁰ ventilation ¹¹¹⁰ roof ³⁶⁶² solar panels ⁴⁷⁰¹ installation ¹³⁷⁴² renovation ¹³⁸⁴⁹	Krimpenerwaard → Haastrecht ¹⁹³
moniqueshairfashion.nl	Moniques Hairfashion	The website of Moniques Hairfashion presents a salon for haircuts and treatments, focused on satisfying customers through professional service, a relaxed atmosphere, and high-quality products.	Dermatology → Scalp Care ⁴⁰²	bridal hairstyle ¹³³ haircut ¹¹⁵⁸ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
aimerdesign.nl	Aimerdesign	Aimerdesign is an interior design consultancy that helps clients style their homes and create a cohesive interior.	Interior Design → Interior Styling ⁶⁷⁶ Interior Design → Interior Consulting ⁶¹⁵	interior design ¹⁸⁰² print ⁵⁵¹¹ shop ⁶⁴⁸³ portfolio ⁶⁸⁵⁴ home ⁷⁹⁷⁶ interior ⁸⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
chiropractievanuithethart.nl	Chiropractie vanuit het hart	The website 'Chiropractie vanuit het hart' offers chiropractic treatments for both children and adults, with a focus on a holistic approach to health and vitality.	Physical Therapy → Chiropractic ⁴²⁰	spinal column ¹⁵ chiropractic ¹⁸⁴ baby ¹⁸⁹⁵ health ⁶³⁶⁶ complaint ⁶⁴⁷⁹	Krimpenerwaard → Bergambacht ³⁰³
vangurpjuweliers.nl	Van Gurp Juweliers	Van Gurp Juweliers is a jeweler located in Breda that sells watches and jewelry and offers repair and customization services.	Accessories → Jewelry ³⁵¹⁷	trade ⁵⁵³ ring ⁸⁰⁰ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ shop ⁶⁴⁸³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autocentrumkrimpenerwaard.nl	Autocentrum Krimpenerwaard	Autocentrum Krimpenerwaard is an automotive dealership located in Krimpenerwaard, specializing in the sale of used cars and offering various automotive services.	Automotive Maintenance → Workshops ³⁰⁷	finance ⁵³⁴¹ car ¹⁰⁸⁶⁵ network ¹¹¹²³ workshop ¹⁹³²⁵
renobilia.nl	Renobilia	The Renobilia website is a platform dedicated to the love of classic Renault cars, specifically the Renault Museum and related activities.	Cars → Classic Cars ¹¹⁴⁵ Visual Arts → Museums ²⁰⁴⁹	renault ⁶⁹ rent ⁹⁸¹ museum ²⁰⁰² collection ⁷⁵⁶⁶ car ¹⁰⁸⁶⁵	Krimpenerwaard → Bergambacht ³⁰³
kerkaandelek.nl	Reformed Congregation of Krimpen aan de Lek	The website of the Reformed Congregation of Krimpen aan de Lek provides information about the church, its services, activities, and contact details.	Reformed → Dutch Reformed Church ²¹⁹ Protestantism → Churches ¹⁰⁰⁹	consistory ⁷⁵ fair ⁵⁸³ church ³⁴³⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
pkn-lekkerkerk.nl	Protestant Church of Lekkerkerk	The website of the Protestant Church of Lekkerkerk serves as an information center for members and visitors, with news, schedules, services, and contact details.	Protestantism → Protestant Church in The Netherlands (PKN) ³⁰¹ Government & Administration → Local Municipalities ²¹⁹	consistory ⁷⁵ announcement ¹¹⁵ youth ³¹²⁶ church ³⁴³⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
gereformeerdekerkhaastrecht.nl	Gereformeerde Kerk Haastrecht	The Gereformeerde Kerk Haastrecht website provides information about their services, including church services, diaconal work, youth activities, and other events, as well as access to online services and news.	Christianity → Protestant Churches ¹²⁵⁷ Government & Administration → Local Municipalities ²¹⁹	sermon ¹¹³ diaconate ¹⁸² church service ⁸⁷⁹ youth ³¹²⁶ building ³²⁰⁴	Krimpenerwaard → Haastrecht ¹⁹³
nasgo.nl	nas grafisch ontwerp	The website ‘nas grafisch ontwerp’ provides graphic design services to various clients.	Online Services → Design Services ⁸⁴ Marketing & Advertising → Marketing ²¹⁹³⁷	branding ⁴⁶¹⁴ logo ⁴⁶⁶⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kappetein.nl	Jan Kappetein	This website provides a genealogical overview of the Kappetein, Kaptein, and Kapteijn families, particularly from the Hoeksche Waard and other regions of the Netherlands.	Genealogy & Family History → Dutch Genealogy ⁷⁰	genealogy ⁵⁴³ name ⁶⁸³ date ¹¹¹² family ⁶⁴⁶² photo ⁷⁷⁷⁸	Krimpenerwaard → Bergambacht ³⁰³
joep-i.nl	Joep Vermaat	The website of Joep Vermaat is a portfolio and contact page for a freelance PHP, JavaScript and web framework programmer who specializes in supporting businesses, artists, and scientists with diverse web projects.	Software Development & Engineering → Freelance Developers ¹⁴⁴ Personal & Household → Other Services ¹²⁰	javascript ²³⁸ php ²⁸² web development ⁹⁶⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
haralddesign.nl	HaraldDesign	The website of HaraldDesign is an online portfolio and contact point for a personal goldsmith and jeweler who designs and creates unique, custom jewelry.	Jewelry → Goldsmiths ³¹⁹ Crafts → Goldsmithing ¹⁶⁸	memorial jewelry ⁶⁶ wedding rings ²⁸¹ jewelry ⁴⁵⁹⁹ studio ⁵⁴⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
e-chopperadventures.nl	E-Chopper Adventures	The website offers the rental of E-Choppers and E-Fatbikes in the Green Heart region, with various routes and packages.	Cycling → Electric Bikes ⁴⁴⁵ Activities → Excursions ²⁵⁷	green heart ³⁹ e-chopper ¹²² polder ⁴⁷⁶ route ³⁴²⁵ package ⁶¹¹²	Lansingerland → Bleiswijk ⁵⁷⁹
juweliershuisaalbers.nl	Juweliershuis Aalbers	Juweliershuis Aalbers is a jeweler and goldsmith with an online shop and physical store in Velp, offering watches, jewelry, and exclusive wedding rings, as well as repairs, goldsmithing services, and a unique wedding ring service.	Jewelry → Wedding Rings ¹⁰⁹ Watches → Watchmakers ¹⁶³	goldsmith ²²⁴ wedding rings ²⁸¹ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bureaumensengroen.nl	Bureau Mens & Groen	Bureau Mens & Groen is an organization dedicated to connecting people with their green environment through project development, support, and execution, primarily serving semi-governmental bodies, nature organizations, and agricultural nature associations.	New Construction → Neighborhood Development ⁹³³ Living → Sustainable Living ⁸¹⁷	green environment ²⁵ walking tours ⁵⁷ knowledge sharing ¹⁶²	Krimpenerwaard → Haastrecht ¹⁹³
carolusbewind.nl	Carolus Bewind	Carolus Bewind is a guardianship and budget management company offering services to individuals in the Krimpenerwaard region and surrounding areas.	Legal → Guardianship ⁸⁷⁹	budget management ²⁸⁰ debt ⁷¹⁷ guardianship ⁷⁶⁷ financial ⁸⁵⁵	Krimpenerwaard → Bergambacht ³⁰³
keesvanderspek.nl	Kees van der Spek	The website provides advice, sales, and service related to gardening machines and accessories, with a long tradition (since 1978) and high customer satisfaction.	Garden Maintenance → Lawn Mowers ¹¹¹	lawnmower ¹⁴⁴ machine ³⁷²⁷ part ⁵⁰⁴⁴ accessories ¹²⁹⁷⁵	Krimpenerwaard → Stolwijk ²³²
cardia.nl	Cardia	Cardia is an elderly care organization in the Haaglanden region that provides modern and personalized care in residential care facilities and home care.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Social Issues → Social Organization ¹³³¹⁵	home care ⁸²⁷ package ⁶¹¹² care ¹²³³⁸	Rijswijk → RijswijkBuiten ²⁰
gardia.nl	Gardia	Gardia.nl is a website offering a wide range of awnings, sheds, outdoor living spaces, and garages to create enjoyable outdoor areas.	Garden → Awnings ¹³⁶	outdoor space ²⁴⁶ awning ⁵⁴⁶ shed ⁶³⁰ garage ¹²¹⁰	Krimpenerwaard → Gouderak ¹⁰³
highwine.nl	HighWine B.V.	HighWine.nl helps users find and book online at the best High Wine locations near them. The website focuses on the concept of pairing delicious snacks with various types of wine for special occasions and gatherings.	Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	high wine ²¹ reviews ³¹⁷² reservation ³³⁷³ wine ⁴⁴⁷⁶ recipe ⁵¹⁴²	Steenwijkerland → Giethoorn ⁵⁶⁵
ovn2.nl	Scouting Olivier van Noort II	This website serves as an information center for the scouting group 'Scouting Olivier van Noort II' in Schoonhoven.	Youth Organizations → Scouting ¹⁰⁰⁴	troop ⁷⁷ scouting ⁸⁶⁰ member ¹⁰¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
paviljoenschoonhoven.nl	Paviljoen Schoonhoven	Paviljoen Schoonhoven is a party centre located in Drenthe offering event spaces, catering, and a restaurant for both private and corporate clients.	Bars → Pubs ⁵⁴⁶ Family Activities → Outings ⁷⁶³	cozy ²²⁷ outing ⁹⁸² wedding ⁴²⁵⁸ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hotelbelvedere.nl	Hotel Restaurant Belvédère	Hotel Restaurant Belvédère is a hotel and restaurant located in Schoonhoven, with a long tradition of providing a unique experience and creating memories.	Accommodation → Resorts ²²⁹ Fundraising & Charity → Reunions ⁷⁷	memory ¹⁶⁴¹ hosting ³¹²⁵ room ³⁴¹¹ hotel ³⁵⁴³ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
consolonl.nl	ConsoloNL	The ConsoloNL website is an organization that organizes (organ) concerts across the Netherlands, primarily concert series in Kampen, Hasselt, and Raalte.	Church & Religious → Organ Music ²¹² Music & Performance → Music Events ⁷⁵⁸	concert series ¹⁵ concert ⁴⁴⁰⁹	Zwartewaterland → Hasselt ⁴⁹⁰
riveroschoonhoven.nl	Rivero Schoonhoven	Rivero Schoonhoven is a restaurant on the Lek River offering lunch, dinner, coffee, pastries, bites, and cocktails.	Bars → Cocktail Bars ²³⁶	cocktail ⁹²⁵ dinner ¹⁵³³ arrangement ³¹⁰⁴ wine ⁴⁴⁷⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ijsselstreekradio.nl	IJsselstreekradio	IJsselstreekradio is a local radio station broadcasting to the municipalities of Capelle, Krimpen, Krimpenerwaard, and Zuidplas.	Radio → Regional Radio ¹¹⁵ News & Journalism → Regional News ⁹⁴⁸	radio ¹²⁰⁰ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Capelle aan den IJssel → Schollevaar ³⁷
123broodje.nl	123broodje	The website 123broodje.nl provides an online platform where users can easily order and have bread and sandwich selections delivered, as well as catering for lunches and meetings.	Lunch → Sandwiches ⁴⁶⁶	bakery ⁷¹⁸ lunch ¹⁵³⁴ sandwich ⁴⁰⁹⁸ catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Krimpenerwaard → Berkenwoude ⁶²
bsgouda.nl	Brede School Gouda	The website of Brede School Gouda presents the activities, projects and information of the broad school, focused on wellbeing, culture, sports, and education in Gouda.	Initiatives & Projects → Local Initiatives ¹⁰⁰¹ Early Years → Early Childhood Education ¹³⁴⁵	vve ⁷⁴⁸	Amsterdam → North ⁶⁵⁷
cafedevlist.nl	Cafe de Vlist	The website of Café de Vlist presents the restaurant and café, located in Vlist, with a focus on a relaxed atmosphere, diverse dishes and drinks, and the beautiful surroundings.	Water → Rivers ¹⁸⁰ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	river ³¹² mill ⁴⁸⁷ reservation ³³⁷³ coffee ³⁸³⁸ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
derotterdammert.nl	CRMWebdesign.nl	De Rotterdammert is a news website that covers various news, including sports news, particularly football, and current events in the region.	Sports Activities → Football ⁴¹⁴⁴ Context ¹⁶¹³⁹⁴	feyenoord ⁵⁷ transfer ⁴²² football ¹³⁴⁷ sport ⁴²²⁸ region ⁵⁴¹² news ¹⁵²⁹³	Eindhoven → Strijp ⁵²⁷
woordendaadwinkels.nl	Woord en Daad Winkels	The website of Woord en Daad Winkels provides an overview of the locations of numerous charity shops (kringloopwinkels) throughout the Netherlands, encouraging visitors to support good causes with their purchases and contribute to reusing items.	Waste Management → Reuse ¹⁴⁶ Commerce → Charity Shops ³³	charity shop ⁴⁵ annual report ⁸⁷⁷ volunteer ⁸³⁶⁷ collaboration ¹⁶⁰³⁶	Veere → Oostkapelle ²⁰⁵
zondervan.nl	Zondervan	The Zondervan website presents itself as a total partner in the installation technology sector, specializing in service, maintenance, renovation, and sustainable upgrades of W-installations. They offer comprehensive solutions for businesses and individuals.	Home Improvement → HVAC Systems ⁷⁷³ Installation & Mounting → Installation Management ⁶³	installation ¹³⁷⁴² renovation ¹³⁸⁴⁹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
adviescommissiedetailhandel.nl	Detail Retail Commission South Holland	The Detail Retail Commission South Holland provides advice on retail projects to municipalities in the region.	Planning & Development → Spatial Planning ⁸⁸⁹	zoning plan ¹⁸⁶ retail ⁵⁸⁶ municipality ⁶⁸³⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
uitindewaard.nl	Uit in de Waard	The website 'Uit in de Waard.nl' provides information about the Krimpenerwaard, a peat meadow area in South Holland, focusing on its history, location, and the municipalities that comprise the area.	Landscape → Dunes ²⁴⁵ Nature → National Parks ⁸⁹⁸	delta ⁴¹ river ³¹² municipality ⁶⁸³⁷	Krimpenerwaard → Vlist ³⁷
brasseriespringer.nl	Stichting Dagbesteding Krimpenerwaard	Brasserie Springer is a restaurant, diner, and event venue located in Schoonhoven, Netherlands, offering a pleasurable culinary experience with extensive dishes, special wines, and various arrangements.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Venues → Wedding Venues ²³²	event venue ⁸⁶ brasserie ⁷⁵² buffet ¹⁷⁴⁷ wine ⁴⁴⁷⁶ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
novaform.nl	KlokGroep	The website of Novaform provides information about the collaboration with KlokGroep and the international activities of the various locations.	Commerce → Wholesale ¹⁸⁵⁵		Krimpenerwaard → Bergambacht ³⁰³
hervormdegemeenteschoonhoven.nl	Reformed Congregation of Schoonhoven	The website of the Reformed Congregation of Schoonhoven provides information about the church, services, activities, and contact details.	Christianity → Protestant Churches ¹²⁵⁷ Protestantism → Reformed ¹³²³	church ³⁴³⁹ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
projectkoorrevive.nl	Projectkoor ‘Revive’	Project Choir ‘Revive’ is an association that organizes choir projects twice a year with classical and contemporary choir music.	Choir → Amateur Choir ¹⁶⁰ Choir → Men’s Choir ²¹²	conductor ¹²¹⁷ choir ³¹²³ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
waddinxveenkrant.nl	Municipality of Waddinxveen	The website Waddinxveenkrant.nl provides news and information about the municipality of Waddinxveen.	Government & Administration → Local Municipalities ²¹⁹ News & Journalism → Regional News ⁹⁴⁸	incident ³³⁵ housing ⁴³⁷⁸ vacancy ⁶⁵⁹⁸ municipality ⁶⁸³⁷ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Haarlemmermeer → Zwanenburg ²⁹⁵
prachtlint.nl	Prachtlint	Prachtlint is an initiative focused on creating a continuous flower strip in the Krimpenerwaard by connecting dikes, banks, and meadows with flowers and plants.	Green Spaces → Landscape Management ³⁸¹ Local Government → Municipal Organizations ⁴¹⁶	strip ¹³³ dike ¹⁴⁸ bank ³⁷⁴ biodiversity ⁷²⁰ flowers ³²⁴⁸ partner ⁴²⁷²	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
dynaguide.nl	DYNAGUIDE.NL	DYNAGUIDE.NL provides instructions and resources for installing a string tree device designed to reduce friction on guitar strings.	Guitar → Guitar Accessories ¹³ Risk & Safety → Tools ⁶²	friction ¹⁹ device ⁶⁹⁸ installation ¹³⁷⁴²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
denhoed.nl	Den Hoed Aannemers BV	The website of Den Hoed Aannemers BV describes the company and its services related to the restoration, maintenance, and renovation of historical buildings and monuments in the Netherlands.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Monuments → Preservation ³⁷	buildings ⁸⁹⁸ monument ¹¹⁶⁸ restoration ³⁴¹⁷ sustainability ¹⁸⁴⁵¹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
weidehofkrimpenerwaard.nl	Weidehof Krimpenerwaard	The website of Weidehof Krimpenerwaard presents agricultural nature and landscape management projects and the biodiversity of the Krimpenerwaard.	Green Spaces → Landscape Management ³⁸¹ Nature → Environmental Management ⁵²⁹	wetland bird ²⁷ flora ¹⁷¹ polder ⁴⁷⁶ agriculture ⁷⁷⁸ landscape ²⁶⁰⁹	Krimpenerwaard → Bergambacht ³⁰³
regressietherapeute.nl	Twinkels Hypnotherapie Schoonhoven	The website of Twinkels Hypnotherapie Schoonhoven offers hypnotherapy services, aimed at addressing various psychological and physical complaints and promoting self-confidence, joy of life, and balance.	Child & Adolescent Development → Child Psychology ¹⁰⁷⁷ Family → Parenting ¹³¹⁶	child therapy ⁸⁰ depression ⁴⁰⁸ weight loss ⁶⁷⁸ hypnotherapy ⁷⁸⁰ anxiety ¹⁵⁹⁶ burnout ¹⁶¹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rijleszonderstress.nl	Rijles Zonder Stress	Rijles Zonder Stress provides driving lessons for all ages and skill levels, focusing on overcoming driving anxiety and offering a stress-free learning environment.	Driver & Vehicle → Driver’s License ¹⁶²⁵	driving anxiety ³³ driving course ³⁹ driving instructor ²⁵² driver’s license ⁴³⁸ theory ⁹⁵⁶ driving lessons ²⁴⁵³	Krimpenerwaard → Bergambacht ³⁰³
avstart.nl	Atletiekvereniging START Lekkerkerk	The website of Atletiekvereniging START Lekkerkerk provides news, contact details, membership information, and historical data about the association.	Running → Running Events ⁶⁸⁴ Activity → Athletics ²⁶⁶	athletics ¹¹⁶ board ³⁴³⁸ competition ⁴⁷⁵⁹ member ¹⁰¹⁵⁴ training ²⁸¹³³	Krimpenerwaard → Lekkerkerk ²⁴⁴
debibliotheekkrimpenerwaard.nl	Library	The website of the library serves as a portal to its collection, activities, online services, and local branches, with a particular focus on summer activities and the BiebBoys Summer Challenge.	Libraries → Local Libraries ⁷⁵ Family Fun → Youth Activities ²⁷³	library ⁹⁸⁸ collection ⁷⁵⁶⁶	Krimpenerwaard → Bergambacht ³⁰³
asbest-sanering.nl	AMF Asbestsanering	The website Asbest-sanering.nl provides asbestos removal and roofing renovation services, focusing on private and business clients, and manages the entire process from application to clearance.	Environmental Technology → Asbestos Remediation ¹⁹¹ Building & Materials → Asbestos ¹²²	shingle ⁴³ asbestos removal ¹³⁴ roof renovation ²⁰⁵ permit ⁷⁴⁴	Krimpenerwaard → Bergambacht ³⁰³
berkbedding.nl	Berk Bedding	Berk Bedding is a website that sells boxsprings, mattresses, and related accessories.	Beds → Boxsprings ²²⁹ Bedroom → Accessories ⁵⁶	topper ⁹² boxspring ²⁸² mattress ⁸⁹⁹ bedroom ²⁰⁵¹ accessories ¹²⁹⁷⁵	Krimpenerwaard → Bergambacht ³⁰³
graanmaalderij.nl	Graanmaalderij Gouderak	The Graanmaalderij Gouderak offers a unique venue for meetings and workshops in a charming, historic setting.	Conferences & Meetings → Meeting Venues ⁷²⁹ Knowledge → Culture ⁸²⁶⁵⁹	venue ⁸⁷⁹ building ³²⁰⁴ space ³⁸⁴⁶ atmosphere ⁵⁵⁹¹ workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Gouderak ¹⁰³
slingerland-fietsen.nl	Slingerland Fietsen	Slingerland Fietsen is a bicycle shop in Haastrecht with a long tradition in the cycling industry.	Cycling → Racing Bikes ⁹⁶ Cycling → Bicycle Rental ⁶⁴³	racing bike ²⁴ gravel bike ⁴⁹ mountain bike ²⁶² e-bike ⁹⁰⁸ bike ¹⁵⁴¹ workshop ¹⁹³²⁵	Krimpenerwaard → Haastrecht ¹⁹³
vaneijkinstallatietechniek.nl	Van Eijk Installatietechniek Bergambacht	Van Eijk Installatietechniek Bergambacht is a recognized installer and plumber offering a variety of installation services to private and business customers.	Home Improvement → HVAC Systems ⁷⁷³ Home Improvement → Plumbing ²⁷³³	climate system ⁷⁸ sustainable ⁷³⁹ boiler ¹²⁴⁰ plumbing ¹⁷⁶¹ air conditioning ²¹⁷⁸	Krimpenerwaard → Bergambacht ³⁰³
ghvgroenehart.nl	GHV Groene Hart	GHV Groene Hart is a fishing association focused on promoting safe fishing, fish welfare, and the protection of fishing waters.	Fishing → Angling ¹⁵⁹ Context → Environment ⁵⁴⁴³⁷	fish stock ¹⁵ fishing water ⁸⁷ permits ⁶⁴³ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
natuurcollectieven.nl	Natuurcollectieven Nederland	Natuurcollectieven Nederland facilitates the application for subsidies for nature management and supports local Nature Collectives.	Nature → Nature Management ⁴⁶ Government & Administration → Government Organizations ¹⁰⁰²	nature management ⁸¹ province ⁵¹⁸ subsidy ²⁶⁴⁹ certification ³³⁸⁰ nature ⁹⁰⁹⁴	Almelo → Wierdensehoek ¹²
kijkopogen.nl	Kijk op Ogen	The website of Kijk op Ogen is an online platform for an optician based in Moordrecht, offering eyeglasses, contact lenses, and hearing aids, along with various eye care services.	Specialty Medicine → Optometry ⁵³⁹ Services → Opticians ⁵⁵¹	hearing care ²² job posting ⁸⁷ eye care ²³³ eyeglasses ⁴³⁷ contact lenses ⁵³⁸	Zuidplas → Moordrecht ³³²
tclekkerkerk.nl	Tennisclub Lekkerkerk	The website of Tennisclub Lekkerkerk in the Krimpenerwaard provides information about the club, its facilities, events, members, and the possibility to become a member.	Tennis → Tennis Clubs ⁷²⁰ Tennis → Padel ⁸⁸⁰	court ⁹⁹⁹ tournament ²⁴⁷⁶ club ⁴²²⁵ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
heuvelman-hout.nl	Timber and Building Supplies Holland N.V.	The website of Heuvelman Hout is an information source about a Dutch wood supplier that offers solutions with wood, with a long history dating back to 1876. It presents the company form, assortment, and contact information.	Wood & Timber → Timber ³³⁵ Building Materials → Wood Suppliers ¹⁴⁷	supplier ¹⁷²⁵ wood ⁴¹⁵³ video ⁶⁷¹⁴ history ⁷²⁸⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
hansbeen.nl	Hans Been Architecten BNA	Hans Been Architecten is an architecture firm specializing in designing atmospheric and sustainable environments.	Urban Planning → Urban Development ³⁷⁸ Real Estate → Project Development ⁶³³	architecture ³²²³ environment ⁴⁸⁷³ portfolio ⁶⁸⁵⁴ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Gouderak ¹⁰³
grzplus.nl	GRZPLUS	GRZPLUS is an initiative that collaborates to improve the rehabilitation and recovery of elderly individuals by sharing knowledge and working together.	Specific Institutions → Hogeschool Van Amsterdam ¹⁸ Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹	healthcare professionals ²³⁵ symposium ³³⁹ rehabilitation ¹⁵¹² patient ⁴⁰⁸² research ⁸⁹⁶⁷ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
avantri.nl	Atletiek- en Trimvereniging Avantri	The website of Atletiek- en Trimvereniging Avantri in Schoonhoven provides information about the association, its activities, news, results, and membership.	Activity → Athletics ²⁶⁶	sponsors ²⁶⁴² match ³⁴⁷¹ association ⁸⁵⁶² membership ¹⁰⁴⁴² news ¹⁵²⁹³ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jachthavenbalkengat.nl	Jachthaven ‘t Balkengat	Jachthaven ‘t Balkengat is a marina located in Krimpen aan de Lek, offering passing boaters a welcoming and convenient stay in a waterside setting near other notable attractions.	Boating → Marinas ⁸²⁵ Nature → Water Bodies ¹⁷	marina ⁴⁸⁷	Molenlanden → Kinderdijk ¹⁵⁸
willemseverhuizingen.nl	Willemse Verhuizingen	The website of Willemse Verhuizingen offers a wide range of moving and assembly services, both nationally and internationally, with a focus on the Krimpenerwaard region and surrounding areas, as well as Rotterdam. The goal is to provide individuals and businesses with a stress-free moving experience.	Moving → Moving Companies ⁸³⁵ Construction & Building → Assembly Services ²⁰	mover ⁴⁶⁷ move ¹⁴⁴¹ assembly ¹⁷³³ storage ²⁴⁴⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
uwstadwerkt.nl	Uw Stad Werkt	Uw Stad Werkt is a platform that collects and presents local job vacancies and businesses from various cities in the Netherlands.	Software → Online Services & Platforms ⁷³⁵ Initiatives & Projects → Local Initiatives ¹⁰⁰¹	participation ¹⁴³⁰ city ¹⁸⁷⁵ vacancy ⁶⁵⁹⁸	Woerden → Leidsche Rijn ⁴³⁰
hooftman.nl	Hooftman Volvo	The website of Hooftman Volvo is an online platform that informs customers about the availability of used and new Volvo cars, as well as the various services and activities of the company.	Car Selling & Valuation → Passenger Cars ⁹⁹² Transportation → Automotive Care ¹⁸⁵	new car ¹⁴ volvo ²⁰⁵ branch ²⁶⁸ used cars ⁸⁹⁴ car ¹⁰⁸⁶⁵	Alphen aan den Rijn → AWZI Alphen a/d Rijn ³⁵⁸
rmtmiddenholland.nl	Regional Mobility Team (RMT) Midden-Holland	The Regional Mobility Team (RMT) Midden-Holland provides free guidance and support to employees, job seekers, entrepreneurs, starters, and employers in Midden-Holland.	Work → Unemployment ⁶² Employment & Labor → Labor Market ⁵⁸⁰	navigator ¹⁸ jobseeker ³⁰⁰ employer ²³⁸³ work ³¹²²	South-Holland → Waddinxveen ¹⁰⁴⁶
speksnijder.nl	Speksnijder Mode	Speksnijder Mode is a clothing store with shops in Bergambacht and Veenendaal, which also sells clothing online and specializes in festive fashion for men and women.	Fashion & Lifestyle → Television Programs ⁵⁶ Fashion → Men’s Fashion ⁶⁹⁰	fashion ²²¹² shop ⁶⁴⁸³ collection ⁷⁵⁶⁶ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
ultimabedden.nl	ultimabedden.nl	The website offers handcrafted mattresses, boxsprings, and headboards, with a focus on ergonomic advice and personalized customization.	Bedding → Mattresses ⁴⁰²	headboard ²⁵ boxsprings ¹⁵⁵ mattress ⁸⁹⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
euromastautos.nl	Euromast Auto's	Euromast Auto's is a car dealership located in Lekkerkerk that sells used cars, offers lease and financing options, and provides related services.	Automotive → Car Dealerships ¹⁶⁴⁷	inventory ¹⁶¹³ model ³⁵⁴⁶ finance ⁵³⁴¹ price ⁸³²⁸ car ¹⁰⁸⁶⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
partytentverhuur-groenehart.nl	Partytentverhuur Groene Hart	The website Partytentverhuur Groene Hart offers party tents, easy-up tents, and other event rental products in the region of the Groene Hart, providing delivery and setup services and expert advice.	Event Rental → Tent Rental ⁴³⁷	lighting and sound ²⁰ party package ³⁶ heater ¹⁸⁴ party tent ²⁵⁶ table ¹⁷⁷⁸	Krimpenerwaard → Bergambacht ³⁰³
lopiknatuurlek.nl	Stichting De Utrechtse Waarden	The website Lopik NatuurLek aims to promote the natural beauty and diverse activities available in the Lopik region, with a particular focus on hiking, cycling and boating routes.	Cycling → Cycling Routes ¹⁰⁰² Regions → Regional Guides ⁵²	local products ⁷¹ village ⁸⁰⁸ route ³⁴²⁵ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Lopik → Cabauw ¹⁸
crimpenerwaert.nl	Crimpenerwaert Dierenartsen	Crimpenerwaert Dierenartsen is a veterinary practice providing animal care in the Krimpenerwaard region and surrounding areas.	Primary Care → Veterinary Medicine ⁷⁰⁴ Veterinarians → Veterinary Clinics ⁴¹⁹	veterinarian ⁸⁶⁴ animal ²⁹⁰⁸ practice ⁹⁰⁸⁹ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
slibbank.nl	Slibbank	The Slibbank website offers services in the area of soil flows, soil research, waste management and logistics, with a focus on the reuse and sustainability of raw materials and waste streams. The organization facilitates project management and provides specialized advice, including PFAS advice and Japanese knotweed research.	Civil & Infrastructure → Earthworks ³⁷⁰ Environment → Waste Management ²⁶⁸⁰	soil research ⁴⁹ waste stream ¹¹⁰ soil ⁹³⁰ logistics ³²⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
debruintegels.nl	De Bruin Tegelwerken	De Bruin Tegelwerken is a tile specialist providing installation and supply of tiles, both indoor and outdoor.	Kitchen → Floor Tiles ¹³⁰ Stone & Tiles → Tiles ⁸⁹⁵	underfloor heating ⁷⁵⁷ craftsmanship ¹⁸⁵⁸ tile ²⁸⁶⁹ showroom ⁴⁸⁸³	Krimpenerwaard → Stolwijk ²³²
lekkerkerkkrant.nl	Lekkerkerkkrant	The website Lekkerkerkkrant.nl provides local news reports, housing information, and 112 alerts from the municipality of Lekkerkerk.	Property Sales → For Sale Properties ⁹⁵ Municipalities → Dutch Municipalities ⁵¹⁶	alert ⁷⁸ housing ⁴³⁷⁸ vacancy ⁶⁵⁹⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
fickelconsultancy.nl	Fickel Consultancy	Fickel Consultancy is a consultancy firm specializing in business consultancy, project and program management, and agile methodologies.	Management → Agile Management ⁹⁰	agile ⁴¹⁷ consultancy ²⁵⁹⁶ data ⁵⁸⁷²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
floor-you.nl	Floor-You	The website of Floor-You presents itself as a specialist in laying PVC flooring in the IJsselstein and Gouda region, offering a wide range of brands and services such as underfloor heating and stair renovation.	Flooring → PVC Flooring ²⁴⁵	stair renovation ¹⁹⁰ pvc flooring ¹⁹⁹ underfloor heating ⁷⁵⁷ collection ⁷⁵⁶⁶ quote ¹²⁸⁶³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
studio925.nl	STUDIO 925	Studio925 Home is a workshop and gallery specializing in silverwork, founded by Jan van Nouhuys in 1976.	Jewelry → Handmade Jewelry ⁸⁶² Artists & Studios → Galleries ¹³⁹⁸	art fair ²² silver ⁴⁷⁹ gallery ¹⁹⁸³ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
alblasserwaard-genealogie.nl	Genealogisch Platform Alblasserwaard Genealogie	The website provides a genealogical platform for the Alblasserwaard, allowing users to access an extensive database of information about their ancestors.	Social Sciences → Genealogy & Family History ¹⁴⁰³	source ²⁴⁶ family tree ⁴⁴⁸ genealogy ⁵⁴³ database ¹¹⁵³ photo ⁷⁷⁷⁸ research ⁸⁹⁶⁷	Molenlanden → Wijngaarden ³⁴
chickfriend.nl	chickfriend.nl	This website publishes local news articles and blog posts about various municipalities and villages in Drenthe and South Holland, with a focus on developments, events, and local happenings.	Local Politics → Municipal Council ⁴⁸⁴ AccommodationTypes → Accommodation ¹²¹³⁰	business activity ¹⁸ village ⁸⁰⁸ climate ⁹³⁴ community ⁷⁹³¹ news ¹⁵²⁹³	Emmen → Klazienaveen ²⁹⁷
bezemerbouw.nl	Bezemer Bouw B.V.	The website of Bezemer Bouw presents the company as a reputable construction firm with over a century of experience, specializing in new construction, renovation, and redevelopment of buildings, emphasizing quality, speed, and sustainability.	Real Estate → Project Development ⁶³³ Industry → Industrial ¹⁹⁸⁷	redevelopment ⁹³ construction project ⁷⁰¹ new construction ²⁶⁷² home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
mooimekkerland.nl	MooiMekkerland	The website of MooiMekkerland, a dairy goat farm in Stolwijk, presents a farm that produces and sells goat milk and goat cheese, with a focus on diverse flavors and regional products.	Livestock → Dairy Farming ⁶⁷¹ Dairy & Cheese → Dairy ⁷⁶³	goat milk ¹⁵ goat cheese ²⁴ childrens parties ⁸² farm shop ²⁰⁴ honey ⁴³² excursion ⁶⁶²	Krimpenerwaard → Stolwijk ²³²
fietstrips.nl	Fietstrips B.V.	The website Fietstrips.nl offers an overview of beautiful cycling routes in the Netherlands, with various arrangements and destinations.	Accommodation → Guesthouses ⁷²⁶ Cycling → Cycling Holidays ²⁹⁵	extra ²⁰ culinary ¹⁹⁹ cycling route ⁴⁵¹ destination ²⁵⁸⁰ hotel ³⁵⁴³	Drimmelen → Made ³³⁵
restaurantnoosa.nl	Noosa Waterfront Bar & Kitchen	Noosa Waterfront Bar & Kitchen is a new, modern restaurant located in the Krimpenerwaard, offering a welcoming dining experience with views of the water and a spacious terrace.	Weather → Weather Forecasts ¹⁵ Nature → Cycling ⁴⁷²	breakfast ¹⁸²² reservation ³³⁷³ terrace ⁴⁸⁴⁷ drink ⁵¹⁹¹ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶
bijonsaandehem.nl	Bij ons aan de Hem	The website presents a unique bed and breakfast, 'Bij ons aan de Hem', located in the polder of Bergambacht, offering accommodation and relaxation to visitors.	Accommodation → Beds ²²⁸ Food → Local & Regional Products ⁹³⁰	farm shop ²⁰⁴ polder ⁴⁷⁶ b&b ¹⁰⁶⁰ wellness ¹⁵⁶¹ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹	Krimpenerwaard → Bergambacht ³⁰³
techhandel.nl	Techhandel Mudde	Techhandel Mudde is a DIY and wholesale store offering a wide range of building materials and tools for both homeowners and professionals.	Textiles → Fabrics ³⁷¹ Computing → Hardware ²⁷²	ironmongery ⁷⁰ blinds ⁴⁴⁶ window coverings ¹²¹³ tool ³⁹⁰⁷ paint ⁸⁷⁴⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
randstadadvocaten.nl	Randstadadvocaten.nl	The website offers legal assistance to people who have suffered injuries.	Criminal Law → Personal Injury ⁷⁷¹ Legal → Lawyers ⁷⁰⁸	personal injury ⁴²⁸ legal assistance ⁵³⁷ case ¹¹⁵³ lawyer ²⁶⁸³	Bunschoten → Bunschoten-Spakenburg ³⁸²
veerdienst-bergstoep.nl	B.V. Veerdienst Bergstoep	The website of B.V. Veerdienst-Bergstoep provides information about the ferry service between Bergambacht and Groot-Ammers/Streefkerk, including details about fares, schedules, and vehicle options.	Water Transportation → Ferries ¹²⁹ Bus Services → Public Transportation ⁷⁸²	fare ⁸⁶ ferry ¹⁷⁹ traffic ⁹¹⁶ schedule ²⁶²⁴ vehicle ³⁷⁴³	Krimpenerwaard → Bergambacht ³⁰³
deloet.nl	Restaurant De Loet	The website of Restaurant De Loet is an online presentation of a restaurant located in the Krimpenerwaard, focusing on a cozy atmosphere, traditional dishes, and various offerings such as dinner, lunch, buffet and ice cream.	Cafes & Lunch → Lunchroom ⁴⁴⁶ Fine Dining & Gastronomy → Dining ⁶⁷⁷	wedding venue ⁹¹ cozy ²²⁷ buffet ¹⁷⁴⁷ coffee ³⁸³⁸ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶
acadejong.nl	A.C.A. de Jong	Mechanisatiebedrijf A.C.A. de Jong offers sales, maintenance, and repair services for tractors and agricultural machinery for livestock and contracting businesses.	Machinery & Repair → Machinery ¹⁰⁴⁵ Machinery & Repair → Tractors ²⁶⁶	agricultural machinery ¹⁶⁹ mechanic ²⁸² tractor ⁷⁸⁹ machine ³⁷²⁷	Krimpenerwaard → Stolwijk ²³²
vlamousse.nl	Vlamousse	The website of Vlamousse presents information about the performances of the cabaret duo, including a schedule, contact details, and information about ticket sales.	Theater → Cabaret ³⁵⁸ Music & Performance → Shows ¹⁵⁴	ticket sales ¹¹² cabaret ²²² duo ³²⁸ theater ²⁵⁴⁴ performance ⁷⁵⁸⁶	Bernheze → Heesch ³⁹²
jongenhoeve.nl	Kaasboerderij Jongenhoeve	Kaasboerderij Jongenhoeve is a farm producing and selling traditional Gouda cheese.	Farms & Farm Businesses → Cheese Farms ³⁶ Tourism → Rural Tourism ⁵⁹	milk ⁴²¹ taste ⁹³³ cheese ¹²⁰⁵ farm ²⁶²² shop ⁶⁴⁸³ history ⁷²⁸⁶	Krimpenerwaard → Bergambacht ³⁰³
verdoold.nl	Verdoold Makelaars	Verdoold Makelaars is an NVM-recognized real estate agency that provides services related to buying, selling, valuing, and financing homes, as well as advice in the area of insurance and mortgages.	Property Sales → Buying a House ⁸⁷² Property Agents & Brokers → Realtors ³⁴¹	buy ¹⁶⁹ sell ²³⁰ financial ⁸⁵⁵ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹ property ⁷⁴⁰⁶	Lopik → Polsbroek ⁴⁹
weslybronkhorst.nl	Wesly Bronkhorst	The website of Wesly Bronkhorst presents his music, schedule, press materials and webshop, and offers booking and news update opportunities.	Rock → Hard Rock ⁴⁹	presskit ¹⁶ schedule ²⁶²⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶ webshop ⁸⁶⁴⁸ music ¹³¹⁷⁰	Waterland → Marken ¹⁵⁷
frieslandcampinafoqusbedrijven.nl	Foqus companies	The website presents and promotes ‘Foqus companies’, dairy farmers who share their experience with greenhouse gas reduction.	Livestock → Dairy Farming ⁶⁷¹ Ecology & Environment → Climate ¹⁶³	dairy farming ⁷⁶ sustainability ¹⁸⁴⁵¹ workshop ¹⁹³²⁵	Leeuwarden → Wytgaard ¹⁶
zorgvoordier.nl	ZorgvoorDier	ZorgvoorDier is a company offering professional pet care services at home, including cat sitting, pet sitting, and grooming.	Animals → Animal Care ¹⁸⁴⁹	cat sitting ²¹ pet sitting ³⁶ grooming ⁸⁹⁶ pet ¹⁶¹⁷	Krimpenerwaard → Bergambacht ³⁰³
shd-bouwmarkt.nl	Stolwijkse Hout-En Doe Het Zelfhandel	The website Stolwijkse Hout-En Doe Het Zelfhandel (SHD) is a hardware store that offers a wide assortment of wood, panel materials, tools, and garden materials, aimed at both private DIY enthusiasts and professional contractors and gardeners.	Wood & Timber → Timber ³³⁵ Wood & Timber → Wood ¹⁰³⁵	panel material ⁴⁶ contractor ¹⁰³⁹ tool ³⁹⁰⁷ wood ⁴¹⁵³ garden ¹³¹²⁹	Krimpenerwaard → Stolwijk ²³²
hkhaastrecht.nl	Reformed Church of Haastrecht	The website of the Reformed Church of Haastrecht provides information about the church, its services, events, and church services.	Social Organization → Religious Churches ⁵¹	pastor ²⁰⁸ organ ⁶³³ schedule ²⁶²⁴ church ³⁴³⁹	Krimpenerwaard → Haastrecht ¹⁹³
epicyouth.nl	Stichting Epic Youth	The website of Epic Youth is focused on supporting young people in the digital world through online activities and offering merchandise.	Earning → Online Activities ¹⁴ Social Services → Youth Work ³⁵³	points ⁶¹² merchandise ¹⁰⁶¹ podcast ³³²⁸ shop ⁶⁴⁸³	North-Holland → Waterland ⁷⁹⁶
hetcultuurstation.nl	The Cultuur Station	The Cultuur Station in Schoonhoven offers a diverse range of lessons in theater, singing, and music, as well as projects and workshops.	Theater → Theater Lessons ²⁶ Arts & Culture → Arts Education ³²³	theater ²⁵⁴⁴ agenda ⁴³⁷⁴ lesson ⁵¹⁵⁴ newsletter ⁶⁵⁰⁴ music ¹³¹⁷⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
decoratieschilderwerk.nl	KIFA Moments	KIFA Moments is a decoration company specializing in restoration, imitation techniques, and exclusive painting techniques, with a focus on quality and sustainability.	Protestantism → Churches ¹⁰⁰⁹ Monuments → Preservation ³⁷	imitation ¹⁷ plasterwork ²⁴⁷ mural ³³⁸ restoration ³⁴¹⁷ decoration ⁴⁰⁸⁵	Krimpenerwaard → Haastrecht ¹⁹³
krimpenerwaardkrant.nl	Krimpenerwaardkrant.nl	The website Krimpenerwaardkrant.nl provides news and information about the municipality of Krimpenerwaard and the surrounding region. The platform offers updates on local events, housing, 112 reports, job vacancies and events.	Jobs → Vacancies ¹⁰⁹⁹ Municipalities → Dutch Municipalities ⁵¹⁶	112 reports ²⁷ job vacancies ¹²⁴¹ region ⁵⁴¹² house ⁸¹²¹ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
campingwilgenwei.nl	Camping Wilgenwei	This website is the online presence of Camping Wilgenwei, a mini-farm camping located in the Green Heart of the Netherlands, offering guests the opportunity to enjoy nature and the surrounding area.	Camping → Farm Camping ³⁸⁶ Camping → Campsites Netherlands ⁷⁹²	rest ⁴³⁵ polder ⁴⁷⁶ cycle ¹⁹⁰⁶ camp ²⁴⁶⁶ nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
homeopathiebergambacht.nl	Visie Homeopathie	The website of Marije Rappoldt-Smits is an online practice for classical homeopathy in Bergambacht, offering homeopathic treatments for the whole family.	Alternative Medicine → Homeopathy ⁶²⁷	homeopathy ⁵²⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
nederlandgolft.nl	Nederland Golft	The website offers golf lessons, events, and travel options for golfers of all levels in the Netherlands and abroad.	Sport Facility → Golf ¹⁴⁴¹	golf lesson ¹³⁸ chip ¹³⁸ travel ⁷²¹⁰ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
garagewestland.nl	Garage Westland	Garage Westland is an auto dealership located in Wateringen that offers a wide range of automotive maintenance and repair services, including vehicle inspections, tire sales, and used car sales, and is known for its customer-friendliness and fixed prices.	Tires → Tire Service ⁹³¹ Maintenance & Services → MOT ⁵⁹	mot ⁸⁰⁶ used cars ⁸⁹⁴ tire ¹⁹⁷⁵ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
drukkerijendrukwerk.nl	drukkerijendrukwerk.nl	The website provides an overview of printing companies and print shops in the Netherlands.	Directories → Websites ³⁴⁷³ Design & Creative → Graphic Services ¹⁰⁰³	printing companies ¹⁴ town ¹²⁶ province ⁵¹⁸ address ⁹⁰¹ print ⁵⁵¹¹	Westerwolde → Blijham ⁶²
notarisvonk.nl	Mr. W.K. Vonk	Mr. W.K. Vonk notaris & mediator in Schoonhoven offers legal services, including wills, property transfers, and mediation, emphasizing personal service and expertise.	Legal → Notaries ⁸⁴⁸	will ⁵¹⁰ notary ⁷⁹¹ legal ⁹³⁷ mediation ²⁷⁸⁷ property ⁷⁴⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
uitagendakrimpen.nl	Uitagenda Krimpen aan den IJssel	Uitagenda Krimpen aan den IJssel offers a local events calendar listing activities such as theater, music, and cultural events.	Knowledge → Culture ⁸²⁶⁵⁹	theater ²⁵⁴⁴ culture ³⁹²² sport ⁴²²⁸ child ¹¹⁵⁶⁶ event ⁴⁵¹⁹⁹	Overijssel → Zwolle ⁷³⁹⁵
gouda-loodgieter.nl	Folstra B.V.	Folstra B.V. is a plumber and installation company serving Gouda and the surrounding area.	Home Improvement → Plumbing ²⁷³³	pipework ⁸⁴ sanitary ⁷⁵⁰ leak ¹²⁰⁴ drainage ¹³²² heat ²¹⁸⁸ installation ¹³⁷⁴²	Krimpenerwaard → Bergambacht ³⁰³
vedeha-aannemer.nl	VeDeHa timmer- en aannemersbedrijf	The website of VeDeHa is an online presentation of a timber and construction company that provides services in the field of building, extensions, and foundation work.	Construction Companies → Timber Companies ¹⁷⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	construction work ¹²⁸ extension ¹⁹⁴¹ carpentry ²²¹⁸ foundation ⁶⁶⁷⁸ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
baggerpomp.nl	BLONK MACHINE SERVICES	The website of BMS Baggerpomp presents a rental and supplier of pumps, construction machinery and accessories, with a focus on powerdredging pumps.	Machinery → Pumps ¹²⁹ Land Development & Earthworks → Earthmoving ⁶⁴³	construction machinery ¹⁰⁵ earthmoving ²³³ pump ⁶²⁵	Krimpenerwaard → Stolwijk ²³²
inekeweevers.nl	Ineke Weevers	The website of Ineke Weevers showcases her artwork, exhibition locations, and membership of the Kunstenaars Collectief Breekijzer.	Galleries → Individual Galleries ⁵¹ Painting → Acrylic Painting ⁵⁴⁷	paintings ³⁹⁰⁷ exhibition ⁵³³² artist ⁵⁷⁴⁵ photography ⁹⁵⁰³	Oude IJsselstreek → Ulft ³⁹²
qqc.nl	Qu’est-ce Que C’est	Qu’est-ce Que C’est is a venue in Stolwijk, serving the Krimpenerwaard region, that organizes parties and activities, including special events for children and regular opening hours.	Cafes → Beer ⁵⁹ Entertainment → Leisure Activities ³³⁸	soos ⁴⁰ drink ⁵¹⁹¹ party ⁵⁹²⁸	Krimpenerwaard → Stolwijk ²³²
silverenschip.nl	't Silveren Schip	't Silveren Schip is a jeweler specializing in unique silver jewelry, with a tradition of four generations of goldsmiths and silversmiths from Schoonhoven.	Jewelry → Silver Jewelry ¹²¹	objects ⁴²⁶ silver ⁴⁷⁹ tradition ⁷³⁶ jewelry ⁴⁵⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
uitgeverijmooimedia.nl	RSA	The website appears to be a collection of news articles and information covering various topics, including traffic, cryptocurrency, financial investments, and local communities.	Economy & Finance → Economics ¹¹¹⁵	cryptocurrency ³⁶⁷ investing ⁹¹¹ traffic ⁹¹⁶ plumber ¹²¹⁰ parking ¹⁹²⁸ exam ²¹²⁰	Tynaarlo → Eelde ³⁸³
ldostolwijk.nl	Gymvereniging L.D.O.	Gymvereniging L.D.O. is a sports club in Stolwijk offering various activities for people of all ages.	Martial Art → Judo ³⁸⁹ Career & Guidance → Educational Pathways ⁶⁶	gymnasium ⁵⁶ class ²⁰⁷⁶ instructor ³¹²⁶ sport ⁴²²⁸	Krimpenerwaard → Stolwijk ²³²
pophop.nl	PopHop Dutch Craft Beer	The website of POPHOP Dutch Craft Beer presents a selection of craft beers in combination with music, emphasizing the pairing of beer and music.	Music → Genres ¹⁷⁵² Beverages → Beer ¹⁰⁹⁵	packs ⁵⁶ playlist ²³¹ beer ²⁸⁸⁷ shop ⁶⁴⁸³ music ¹³¹⁷⁰	Lingewaard → Bemmel ⁵⁰⁹
wandeltrips.nl	Wandeltrips.nl	The website Wandeltrips.nl provides information about hiking in the Netherlands.	AccommodationTypes → Accommodation ¹²¹³⁰	bookings ⁵²³ hiking ⁸⁴¹ netherlands ¹³⁷⁶ destination ²⁵⁸⁰ arrangement ³¹⁰⁴ reviews ³¹⁷²	Drimmelen → Made ³³⁵
schilderswijk-krimpen.nl	Buurtvereniging Schilderswijk Krimpen	The website of Buurtvereniging Schilderswijk Krimpen informs visitors about the activities and goals of the neighborhood association, which is committed to improving the quality of life and strengthening the community in the Schilderswijk.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Festivals → Local Festivals ¹⁷⁰	neighborhood festival ¹⁴ safety ⁵⁸¹⁹ community ⁷⁹³¹ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hof21.nl	Brasserie Hof21	The website of Brasserie Hof21 is an online presence of a brasserie located in Bergambacht, focused on offering food, drinks, and a welcoming atmosphere to visitors.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Food & Dining → Outdoor Seating ²²⁸	brasserie ⁷⁵² reservation ³³⁷³ atmosphere ⁵⁵⁹¹ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
collectievanderkop.nl	Collectie van der Kop	The Collectie van der Kop website showcases the art collection of the Van der Kop family, specifically the drawings and paintings of Han and Ad van der Kop, alongside genealogical information about the family.	Social Sciences → Genealogy & Family History ¹⁴⁰³ Painting → Dutch Art ³²²	family tree ⁴⁴⁸ drawings ¹³²⁹ paintings ³⁹⁰⁷ family ⁶⁴⁶² collection ⁷⁵⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vangrevenstein.nl	Van Grevenstein’s Scheepswerf B.V.	Van Grevenstein’s Scheepswerf B.V. is a shipyard specializing in ship repairs, extensions, and new construction.	Maritime → Shipbuilding ⁵⁶⁸ Maritime → Shipyard ⁵⁹	shipyard ¹³⁰ crane ⁶⁶² ship ⁵¹⁰³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
web-mine.nl	Webmine	Webmine is a web agency specializing in web, app, and API development, aiming to help companies make an impact and truly connect with their target audience.	Life Events → Death ⁶⁸⁷ Software Development & Engineering → Programming ⁵¹⁹	app development ⁵⁰ web development ⁹⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vlisterstee.nl	Party Service Rober	The website of Party Service Rober offers catering services, including barbecues, buffets, and complete party arrangements, both on-site and independently.	Social & Events → Party Services ¹⁸⁷ Conferences & Meetings → Corporate Events ²⁴⁷²	barbecue ¹¹⁷⁵ buffet ¹⁷⁴⁷ reservation ³³⁷³ party ⁵⁹²⁸ catering ⁶⁴⁵⁶	Krimpenerwaard → Vlist ³⁷
roteck.nl	Roteck BV	Roteck Personeelsdiensten is a staffing agency that offers job vacancies and supports both employees and employers.	Staffing & Recruitment → Technical Staffing ³⁹⁵	staffing agency ¹³⁹ personnel ¹⁰⁸⁴ employer ²³⁸³ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸ construction ⁷⁴²¹	South-Holland → Alblasserwaard ²⁸¹
agbbouw.nl	AGB Bouw	The website of AGB Bouw presents the company as an ambitious builder based in Stolwijk, specializing in building functional buildings for diverse clients.	Renovation & Restoration → Construction Industry ⁴⁹⁹	buildings ⁸⁹⁸ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Bergambacht ³⁰³
purus.nl	Purus BV	Purus BV is an organization specializing in the cleaning and disinfection of water installations, technical adjustments and checking of ball valves, with a focus on Legionella prevention.	Water Management → Legionella Prevention ²³ Installation & Repair → Ventilation ⁸⁵⁹	water installation ³⁸ air handling ⁸⁵ webinar ⁸⁷⁰ news ¹⁵²⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
bitterweb.nl	Bitterweb	This website, Bitterweb, contains information about the Spirit football club from Ouderkerk aan den IJssel, including its youth selection, the family tree of the Bitter family, and a photography portfolio of the site's administrator.	Portals → Family Portals ³⁶ Football → Amateur Football ⁷⁵⁷	family tree ⁴⁴⁸ football club ⁶⁰³ family ⁶⁴⁶² photography ⁹⁵⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
gjvandenberghzilverwerken.nl	G.J. van den Bergh Zilverwerken B.V.	G.J. van den Bergh Zilverwerken is a manufacturer of gold and silverwork, specializing in casting, gifts, and souvenirs.	Precious Metals → Gold ¹⁷⁴	foundry ²⁰ silver ⁴⁷⁹ gold ⁸⁰⁵ gift ⁶⁴⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
prokrimpenerwaard.nl	Pro Krimpenerwaard	Pro Krimpenerwaard is a political party dedicated to creating an honest, sustainable, social, and animal-friendly Krimpenerwaard.	Local Politics → Parties ⁶²² Local Politics → Political Parties ⁸⁹⁸	motion ⁹⁴ municipality ⁶⁸³⁷ research ⁸⁹⁶⁷	Krimpenerwaard → Bergambacht ³⁰³
adviesraadgevaarlijkestoffen.nl	N/A	The website appears to be a blog featuring articles on various topics, including floor renovation, pre-workout supplements, oral care, and local traditions in various Dutch municipalities.	Body & Movement → Oral Care ³¹⁸ News & Journalism → Regional News ⁹⁴⁸	pre-workout ⁴⁰ dental care ³¹¹ tradition ⁷³⁶ floor ⁴⁷⁸¹	Venlo → Blerick ⁵⁴⁷
verloskundigenpraktijkgouda.nl	Verloskundigenpraktijk Gouda	Verloskundigenpraktijk Gouda is a midwifery practice offering comprehensive care from conception to contraception, providing personalized and attentive support throughout the entire process.	Medical Care & Services → Pediatric & Child Health ²¹²¹ Pregnancy & Childbirth → Midwifery ⁶¹⁹	postpartum ⁴⁶⁴ ultrasound ⁷⁶⁹ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹ care ¹²³³⁸ coach ²⁵⁸¹⁰	Gouda → Broekhuizen ²⁴
dezorgendehand.nl	Thuiszorg de Zorgende Hand	Thuiszorg de Zorgende Hand is a care organization that provides various forms of care, focused on supporting people to maintain their independence.	Social Services → Youth Support ⁵³⁰ Health → Medical Care & Services ²⁹⁴⁶¹	flexibility ⁹⁹⁶ provider ¹¹¹¹ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
mrloodgieterhoorn.nl	Loodgieter Hoorn	The website of Loodgieter Hoorn provides emergency service and repairs for various plumbing issues in the city of Hoorn and surrounding areas, including CV (central heating) maintenance, unclogging services, and leak repair.	Installation & Repair → Sanitation ²⁸⁹ Maintenance & Repair → Plumbers ⁸⁷⁹	cv system ³⁷ clog ¹⁸⁴ leak ¹²⁰⁴ plumber ¹²¹⁰	Hoorn → Kersenboogerd ³¹
csgwillemdezwijger.nl	CSG Willem de Zwijger	The website of CSG Willem de Zwijger provides information and services for students, parents, and staff.	Higher Learning → Educational Institutions ¹⁰⁴⁹ Career & Guidance → Pre ¹⁵	parent ⁴³¹⁸ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
aptsbv.nl	APTS bv	APTS is a bureau specializing in pile load testing services.	Civil & Infrastructure → Foundation Engineering ³³ Building & Materials → Concrete Structures ²⁶⁸	pile ³⁹ testing ⁴⁵⁶ report ⁴⁵⁵¹	Kaag en Braassem → Roelofarendsveen ³⁴⁸
sdjfinance.nl	SDJ Finance	SDJ Finance is a digital accounting firm specializing in serving freelancers (ZZP'ers) and businesses (BV's) with a personalized approach.	Finance & Accounting → Accounting ³⁰⁹²	bookkeeping ¹³¹⁹ administration ⁶⁵⁸⁷ software ⁸²⁹¹ price ⁸³²⁸	Landsmeer → Den Ilp ⁷¹
natuurwinkeldehaven.nl	Natuurwinkel de Haven	Natuurwinkel de Haven in Schoonhoven is a shop that sells organic products, natural food, and supplements.	Food Stores → Organic Food Stores ¹⁰	dietary advice ³³ organic products ⁸⁷ superfood ¹⁰³ supplement ¹⁹⁶⁸ market ²⁷⁷² shop ⁶⁴⁸³	Voorst → Twello ⁴⁶⁹
amolenaar.nl	A. Molenaar B.V.	The website of A. Molenaar is a company specializing in ground, road, and water construction services, including soil remediation, paving, groundwork, sand and gravel delivery, and the preparation of building sites.	Civil & Infrastructure → Ground ¹²⁰	sewer ²⁴⁶ ground ²⁸⁶ sand ⁶³⁰ groundwork ¹³⁴⁸	Krimpenerwaard → Bergambacht ³⁰³
langedijker-sportunie.nl	Langedijker Sport Unie	Sportorganisatie Langedijker Sport Unie (LSU) offers a wide range of sports activities and training programs for individuals and businesses.	Massage → Sports Massage ⁶⁴¹ Sports & Fitness → Sports Training ⁷¹¹	bootcamp ⁴⁹⁷ sport ⁴²²⁸ massage ⁷⁶⁴⁶ training ²⁸¹³³	Schagen → Tuitjenhorn ³⁸²
idsardi.nl	Froukje Idsardi	The website of Froukje Idsardi showcases a studio-gallery where a jeweler, Froukje Idsardi, designs and sells unique, handcrafted jewelry.	Jewelry → Goldsmiths ³¹⁹	precious metal ⁷⁸ ring ⁸⁰⁰ bracelet ¹⁰⁵³ jewelry ⁴⁵⁹⁹ studio ⁵⁴⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
zorgboerderij-bijdehem.nl	Zorgboerderij ‘Bij de Hem’”	The website of Zorgboerderij ‘Bij de Hem’ provides information about a care farm offering small-scale day care for young people, adults, and seniors, with a focus on meaningful work, social connections, and relaxation in nature.	Farms & Farm Businesses → Care Farms ⁴⁷³ Disability Services → Day Programs ³⁰⁵	social connection ³⁵ care farm ²⁴⁶ staff ³⁴⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
vandeurzen-incasso.nl	Van Deurzen Incasso Bedrijf & Advies	Van Deurzen Incasso Bedrijf & Advies provides business recovery and advisory services focused on improving customer payment behavior and optimizing credit management processes.	Financial Management → Credit Management ⁴⁶ Legal → Debt Collection ⁵⁵⁴	credit management ⁵⁶ invoice ⁷⁹⁵	Berkelland → Borculo ³⁴⁷
autofirst-karsdorpautos.nl	AutoFirst Karsdorp Auto's	AutoFirst Karsdorp Auto's is an auto garage in Stolwijk that offers maintenance, repairs, MOT inspections, and used car sales.	Used Cars → Cars For Sale ⁷⁹ Leasing → Private Lease ²¹⁴	private lease ¹⁹¹ mot ⁸⁰⁶ used car ⁸²⁵ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Stolwijk ²³²
autosloperijdezaag.nl	Autosloperij de Zaag	The website of Autosloperij de Zaag offers used car parts and cars for sale, as well as services such as car intake, scrap car pickup, and assembly advice.	Car Restoration & Salvage → Auto Salvage Yards ⁴⁰ Recycling → Auto Recycling ²⁹	car parts ⁶⁴ gearbox ⁸⁹ scrap car ¹²⁷ air conditioning ²¹⁷⁸ part ⁵⁰⁴⁴ car ¹⁰⁸⁶⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
wsvnooitgedacht.nl	Wandelsport Vereniging Nooit Gedacht	The website of WSV Nooitgedacht describes the activities of a walking club that organizes walking tours and offers memberships.	Walking → Walking Clubs ³⁶	walking tours ⁵⁷ board ³⁴³⁸ membership ¹⁰⁴⁴²	Altena → Hank ¹¹³
schoonhovenservice.nl	Schoonhoven Service	Schoonhoven Service is a company specializing in the sale and repair of agricultural and earthmoving machinery since 1984, offering custom solutions and service.	Industrial Equipment & Services → Machine Building ⁶⁶⁵ Maintenance & Services → Machine Maintenance ²⁶²	mechanic ²⁸² machine ³⁷²⁷ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
historischestadskaartenfullcolour.nl	The Afsetter	The website offers full-color historical city maps.	Historical & African Art → Historical Art ¹⁸	maps ³³¹ archive ²⁰⁶⁷ color ⁴¹⁵⁹	Voorne aan Zee → Brielle ⁶¹³
viawoerden.nl	VIA Woerden	VIA Woerden is a social handyman service providing tailored services and training opportunities for regional partners.	Entrepreneurship → Social Entrepreneurship ³¹¹ Entrepreneurship → Social Enterprises ²⁹⁹	sroi ³⁷ handyman service ¹²⁷ work ³¹²² talent ³⁹⁸⁷ environment ⁴⁸⁷³ collaboration ¹⁶⁰³⁶	Vleuten - De Meern → Vleuten ⁵⁷⁴
uwbegrafenisverzorger.nl	Speksnijder Begrafenisverzorging	Speksnijder Begrafenisverzorging is a funeral home providing support to bereaved families in the Krimpenerwaard & Gouda region, focusing on arranging dignified funerals.	Death → Funerals ⁵⁵² Family → Funeral Services ²⁰⁸⁴	bereaved ²⁹¹ farewell ¹¹⁰⁹ grief ¹⁵⁷⁷ funeral ²⁴⁷⁷	Krimpenerwaard → Bergambacht ³⁰³
cspekbv.nl	C. Spek B.V.	C. Spek B.V. is a construction company with a long tradition specializing in residential construction, extensions, and roof extensions, offering complete project solutions to their clients.	Legal & Permits → Construction Advice ²⁸⁹	roof extension ¹⁶³ permits ⁶⁴³ extension ¹⁹⁴¹ house ⁸¹²¹	Zoetermeer → Oosterheemplein ²⁵
phhaastrecht.nl	PHHaastrecht	PHHaastrecht provides psychological support and treatment pathways, with a focus on safety and assisting people in stepping outside their comfort zones.	Social Services → Psychological Services ¹⁵⁵ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	pathway ⁴⁴⁷ care ¹²³³⁸ treatment ²¹²⁰³	Krimpenerwaard → Haastrecht ¹⁹³
pannenkoekenrestaurantonderdemolen.nl	Scheer Family	Pannenkoekenrestaurant Onder de Molen is a restaurant located in Bergambacht that serves traditional Dutch pancakes and offers catering services.	Family & Themed Dining → Pancakes ⁴⁹ Family & Themed Dining → Pancake Restaurants ¹⁶⁶	pancakes ⁵⁶⁸ drink ⁵¹⁹¹ party ⁵⁹²⁸ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
bergvliet.nl	H.T.P.C. Bergvliet	The website of H.T.P.C. Bergvliet is an online platform for the tennis and padel club H.T.P.C. Bergvliet in Haastrecht, offering membership details, court reservations, events, and general information.	Tennis → Padel ⁸⁸⁰	padel ⁶⁰² tennis ⁸³⁶ court ⁹⁹⁹ tournament ²⁴⁷⁶ membership ¹⁰⁴⁴²	Krimpenerwaard → Haastrecht ¹⁹³
kvij.nl	Kanovereniging De IJsselstreek (KVIJ)	Kanovereniging De IJsselstreek (KVIJ) is a canoeing association focused on providing canoeing trips and activities in the region around IJsselstein and beyond.	Water Sports → Rowing ³⁰³ Water Sports → Canoeing ¹⁷⁶	canoe ²⁶⁹ clubhouse ⁷⁸⁴ trip ²⁰³² association ⁸⁵⁶²	Vijfheerenlanden → Hagestein ⁶⁰
huizebinnendijks.nl	HUIZE BINNENDIJKS	HUIZE BINNENDIJKS is a bed & breakfast offering a peaceful and welcoming accommodation experience in a rural setting.	Camping → Campsites Netherlands ⁷⁹² Accommodation → Beds ²²⁸	rest ⁴³⁵ breakfast ¹⁸²² hosting ³¹²⁵ environment ⁴⁸⁷³ accommodation ⁴⁹²¹ house ⁸¹²¹	Alkmaar → Oudorp ³⁴⁵
rs80.nl	RS80	The website of RS80 describes a walking organization that organizes and promotes walking tours in the Randstad region, with the goal of encouraging people to be active and get to know each other.	Walking → Walking Clubs ³⁶ TravelStyles → Active Travel ⁵⁸	walking tours ⁵⁷ walker ¹⁴⁵ participant ¹⁹³⁴	Voorne aan Zee → Brielle ⁶¹³
wsvkinderdijk.nl	w.s.v. Kinderdijk	The website of w.s.v. Kinderdijk provides information about the hiking club, its events, and contact details.	Cycling → Touring Cycling ⁷⁰ Planning → Tours ⁸⁷⁰	hiking ⁸⁴¹ tours ¹⁰⁴⁸ club ⁴²²⁵	Molenlanden → Kinderdijk ¹⁵⁸
picknickbakfiets.nl	Picknickbakfiets	The website of ‘Picknickbakfiets’ offers a unique picknick experience, providing a convenient bike with picknick supplies for rent.	Cycling → Electric Bikes ⁴⁴⁵ Cycling → Bicycle Rental ⁶⁴³	basket ²⁷⁵ polder ⁴⁷⁶ bike ¹⁵⁴¹ route ³⁴²⁵	Krimpenerwaard → Bergambacht ³⁰³
tess-schoonackers.nl	Schoonheidssalon Tess Schoonackers	The website of Schoonheidssalon Tess Schoonackers presents the salon’s services, including facials, makeup, and massages, and provides information about contact and appointments.	Eyelash Services → Eyebrows ⁷⁷⁷ Makeup → Makeup Artists ⁷³³	bridal makeup ¹³⁰ facials ³⁰² hairstyling ⁴⁸² permanent makeup ⁷⁰² makeup ¹⁴⁷⁷ massage ⁷⁶⁴⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
geertzenphilatelie.nl	Geertzen Philatelie	The website of Geertzen Philatelie offers an online shop and information about collecting systems for stamps and coins, as well as an agenda of bourse attendance.	Collectibles → Stamps ¹⁵⁹	stamps ³³⁴ webshop ⁸⁶⁴⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
serieuze-zaken.nl	Serieuze zaken	The website provides information on various topics including air conditioning, inventory management, tool rental, solar panels, accounting, office furniture, ICT and fireworks.	Information Technology → Data Management ⁸²⁷ Software & Computing → Computing ⁶⁹⁶	air conditioner ⁴⁰⁸ accountant ⁶¹¹ inventory ¹⁶¹³ office ²⁸⁹⁸ tool ³⁹⁰⁷ solar panels ⁴⁷⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vioollessen.nl	Natasja van Doesburg	The website offers violin, alto violin, and keyboard lessons taught by Natasja van Doesburg in Gouda and Krimpen a/d Lek, focusing on inspiring and results-oriented lessons for all levels.	Music Education → Violin Lessons ⁶⁶ Music Education → Private Lessons ¹⁵⁶	keyboard lessons ²¹ violin lessons ²⁷ teaching method ³⁰ private lesson ¹³⁴ ensemble ⁵⁴⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
silverweb.nl	Silver Web	Silver Web is a full-service web agency offering website development, maintenance, and SEO services.	Online Marketing → SEO ¹¹²³ Web Development → WordPress Development ³³³	wordpress ³⁵⁵¹ seo ³⁷⁰⁷ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
woltersgen.nl	Niet vermeld	The website provides genealogical information and family trees for various families from the region of Overijssel and the Krimpenerwaard.	Social Sciences → Genealogy & Family History ¹⁴⁰³ Events → Places ¹²¹⁹	branch ²⁶⁸ family tree ⁴⁴⁸ genealogy ⁵⁴³ family ⁶⁴⁶²	Twenterand → Vriezenveen ⁴⁸⁷
autoverhuurdspek.nl	Autoverhuur D. Spek	The website of Autoverhuur D. Spek offers a wide range of car rental options, including passenger cars, commercial vehicles, and trailers, with an emphasis on environmentally friendly options and reliability.	Automotive → Commercial Vehicles & Trucks ¹⁹⁸¹	commercial vehicle ³²⁶ bus ⁸⁹⁴ trailer ¹⁶²⁴ rental ⁷²⁵⁷ car ¹⁰⁸⁶⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
denhaesell.nl	Hannie van Haselen	The website of Bed & Breakfast 'den Haesell' presents a country-located bed and breakfast in Bergambacht, featuring two apartments and descriptions of the surrounding area and amenities.	Nature → Cycling ⁴⁷² AccommodationTypes → Other Accommodation ¹⁷²	bed & breakfast ³¹⁹ apartment ⁵⁰⁸⁸	Molenlanden → Kinderdijk ¹⁵⁸
bbzilverstad.nl	B&B Zilverstad	B&B Zilverstad is a Bed and Breakfast located in Schoonhoven, Netherlands, offering accommodation in comfortable cottages.	Accommodation → Cottages ²⁹⁸ Nature → Cycling ⁴⁷²	cottage ²⁹⁹ stay ⁷⁰² accommodation ⁴⁹²¹ atmosphere ⁵⁵⁹¹ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
evsbv.nl	EVS Infrabouw	The website of EVS Infrabouw presents the services and expertise of a family-owned company specializing in infrastructure construction, particularly in sewer work, earthworks, paving, embankment work, and landscape design.	Civil & Infrastructure → & Waterways ⁹⁶ Civil & Infrastructure → Infrastructure Projects ¹³¹	sewer work ²⁴ infrastructure ¹⁴⁶⁰ engineering ¹⁴⁶⁸ paving ¹⁹⁴² sustainability ¹⁸⁴⁵¹	Almere → Almere City ⁹³⁴
spoelhof.nl	Bed & Breakfast Spoelhof	Bed & Breakfast Spoelhof is a boutique hotel in Boskoop that offers hospitality, relaxation, and a historical atmosphere.	Accommodation → Beds ²²⁸ Events → Business Travel ²⁴⁹	breakfast ¹⁸²² room ³⁴¹¹ hospitality ³⁴⁹¹ environment ⁴⁸⁷³ history ⁷²⁸⁶	Alphen aan den Rijn → Boskoop ⁶⁵²
zwembadtantedicky.nl	Zwembad Scharlesooi Tante Dicky	The website of Zwembad Scharlesooi Tante Dicky provides information about the swimming pool, opening hours, rates, events (children’s parties) and options to become a friend or subscriber.	Garden → Swimming Pools ⁶⁰¹ Children’s Activities → Playgrounds ⁷⁰²	children’s party ¹²⁸ friend ⁶³⁹ swimming pool ¹⁶⁶⁴ opening hours ²⁹⁵³ volunteer ⁸³⁶⁷ child ¹¹⁵⁶⁶	Krimpenerwaard → Berkenwoude ⁶²
molendenarend.nl	Molen den Arend	The website of Molen den Arend presents information about the history, management, opening hours, and offerings of the historic windmill, including the mill shop and events.	Historical Sites → Windmills ¹⁰⁰ Cultural Heritage → Historic Landmarks ¹⁹	millshop ²⁰ windmill ²⁴⁹ history ⁷²⁸⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
heatingservice.nl	Heating Service Installatie techniek	Heating Service Installatie techniek provides sustainable solutions for home comfort and energy saving.	Energy → Energy Saving ¹¹⁵¹ Energy & Sustainability → Energy Consulting ⁸⁸³	solar boiler ⁹² sustainable ⁷³⁹ comfort ¹⁴⁷³ heat pump ²⁵⁴¹	Purmerend → Weidevenne ²⁷
hetsuikerhuys.nl	Het Suikerhuys	Het Suikerhuys is a bakery specializing in the design and creation of wedding cakes.	Pastries & Baked Goods → Pastry Shops ²⁰¹ Weddings → Wedding Cakes ⁶⁹	wedding cake ¹⁴⁹ cake ¹⁷³⁰ style ²³⁴⁸ decoration ⁴⁰⁸⁵ wedding ⁴²⁵⁸	Krimpenerwaard → Stolwijk ²³²
ibsweb.nl	Installatie Bedrijf Schoonhoven B.V.	Installatie Bedrijf Schoonhoven is a company specializing in security systems and telematics solutions, offering installation, maintenance, and service.	Safety → Fire Safety ¹⁰⁴⁸ Security → Intrusion Detection ¹³⁷	telematics ³⁶ camera ¹⁷³³ security ⁶⁶⁵⁵ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hervormdberkenwoude.nl	Hervormde Gemeente Berkenwoude	The Hervormde Gemeente Berkenwoude is a faith community focused on communal faith, care for one another, and the well-being of its members.	Christianity → Catholic ⁹⁶² Protestantism → Churches ¹⁰⁰⁹	district ³⁷¹ tradition ⁷³⁶ faith ¹⁰⁹³ community ⁷⁹³¹	Krimpenerwaard → Berkenwoude ⁶²
rozenlaankerk.nl	Rozenlaankerk	The Rozenlaankerk is a Christian church that aims to equip visitors to believe in a contemporary way and provides space for visitors and potential members.	Reformed → Church Organization ¹⁵⁵ Context → Community ⁵⁷⁴¹⁰	love ¹²⁴⁰ church ³⁴³⁹ community ⁷⁹³¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
hulstkampgroep.nl	Hulstkamp Makelaars	Hulstkamp Makelaars is a real estate agency specializing in the sale and rental of homes and commercial properties, collaborating with international real estate firms.	Real Estate & Investment → Real Estate ²¹⁴⁷¹ Real Estate & Housing → Housing Market ²⁰⁴	developer ⁴⁰⁶ commercial property ⁴⁶⁹ listings ⁵²⁵ transaction ⁶¹³ real estate ⁴⁹⁸¹ property ⁷⁴⁰⁶	Krimpenerwaard → Haastrecht ¹⁹³
tco-tennis.nl	Tennis Club Ouderkerk	The website of Tennis Club Ouderkerk provides information about the club, its activities, membership, and events, with a focus on tennis, petanque, and youth activities.	Sport Facility → Tennis ²⁰⁷⁸ Outdoor Activity → Outdoor Sports ⁸³	petanque ⁵⁷ tennis ⁸³⁶ tournament ²⁴⁷⁶ club ⁴²²⁵ membership ¹⁰⁴⁴²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
heijmanswoningontruiming.nl	Heijmans Woningontruiming	The website of Heijmans Woningontruiming offers professional services for residential and commercial property clearance throughout the Netherlands, including specialized services such as estate clearance, post-mortem clearance and the purchase of household goods.	Home Services → Clearance ²⁸⁰ Moving & Storage → Moving ¹²⁸⁹	household goods ¹⁴¹ clearance ³⁴⁹ move ¹⁴⁴¹ transport ⁶¹⁰⁵ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
scooterreparatiebodegraven.nl	J VAN VLIET SCOOTER EN BROMMER	J. van Vliet Scooters is a company in Bodegraven that sells, maintains, and repairs scooters, as well as supplies accessories and parts.	Motorcycles → Scooters ⁹⁰³	scooter ¹²³⁶ accessories ¹²⁹⁷⁵ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷ maintenance ²⁰⁰⁹³	Krimpenerwaard → Haastrecht ¹⁹³
debrongouderak.nl	De Bron Gouderak	The website of De Bron Gouderak presents information about the school, its activities, and news.	Primary & Secondary Schooling → Primary Education ⁵⁰⁹⁴	calendar ¹⁵⁵⁶ school ⁷⁸⁵⁶ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Gouderak ¹⁰³
slappendelfamilierecht.nl	Slappendel Familierecht	The website of Advocaat Gouda – Slappendel Familierecht presents the services of lawyer Eline Slappendel, specializing in family law, divorce, inheritance, and mediation, with the aim of informing potential clients and scheduling an appointment.	Family Law → Divorce ⁸⁹⁴ Legal → Law Practice ¹⁶¹	inheritance ³⁵⁴ divorce ⁹⁰² lawyer ²⁶⁸³ mediation ²⁷⁸⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
salasinterieur.nl	Salasinterieur	The website of Salasinterieur showcases interior design and services, including styling, design, and complete projects, targeting both private and business clients.	Interior Design → Interior Advice ³³¹	interior design ¹⁸⁰² styling ²³³¹ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Lekkerkerk ²⁴⁴
kwschool.nl	Koningin Wilhelminaschool	The website of Koningin Wilhelminaschool in Ouderkerk aan den IJssel provides information about the school, its vision, organization, and services.	Primary Education → Montessori Education ¹⁶⁷ Higher Learning → Educational Institutions ¹⁰⁴⁹	parent portal ⁷⁴ vision ¹⁸⁸² registration ⁴³⁶⁶ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
edelsmid-groningen.nl	Edelsmid Sandra Ruis	The website of Edelsmith Sandra Ruis presents her workshop in Groningen and her artisanal design and production of jewelry.	Jewelry → Handmade Jewelry ⁸⁶²	silversmith ¹¹ goldsmith ²²⁴ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jvgabriel.nl	Jeugdvereniging Gabriël	The website of Jeugdvereniging Gabriël (JVG) provides information about the activities of the association, with a focus on summer camps, club evenings, and participation in the Jantje Beton collection and the Grote Club Actie. The aim is to recruit members and promote the association's activities.	Youth Organizations → Youth Clubs ²⁰	club evening ⁶⁴ summer camp ¹³⁹ association ⁸⁵⁶²	Krimpenerwaard → Haastrecht ¹⁹³
kooronomatopee.nl	Vocal Ensemble Onomatopee	The Vocal Ensemble Onomatopee website showcases the repertoire, upcoming performances, and contact information of an enthusiastic singing ensemble.	Film → Production Companies ⁴⁰⁶	footage ⁴⁸ ensemble ⁵⁴⁶ repertoire ²⁴⁹⁷ arrangement ³¹⁰⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶	Krimpenerwaard → Bergambacht ³⁰³
mfvanderwaal.nl	Machinefabriek Van der Waal	The website of Machinefabriek Van der Waal presents the services of a machine factory specializing in machining operations and provides information about projects, vacancies, and contact options.	Manufacturing → Machine Shops & Welding ²¹⁶	turn ²²⁶ machining ²⁷² milling ²⁷⁵ welding ¹⁰⁵¹
highstreetdiervoeders.nl	Highstreet Diervoeders en Fourage	Highstreet Diervoeders en Fourage is a company specializing in the sale of animal feed, forage, and firewood, with a particular focus on horses, dogs, cats, and other animals, and delivers products in the provinces of South Holland and Utrecht.	Wholesale → Animal Supplies ¹⁵ Animal Feed → Horse Feed ⁵²	horse feed ⁸³ silo ⁹⁶ animal feed ¹⁵¹ firewood ²²⁵ delivery service ²³⁶ online shop ¹³¹⁰	Krimpenerwaard → Haastrecht ¹⁹³
vanegmondmakelaardij.nl	Van Egmond Makelaardij B.V.	Van Egmond Makelaardij B.V. is a real estate agency specializing in the purchase and sale of homes and commercial properties in the Krimpenerwaard region. The website aims to help clients find their ideal home or successfully sell their current property through tailored solutions.	Property Finance → Purchase ⁴⁹³ Property Agents & Brokers → Brokers ³⁵⁶	stock ¹¹⁵⁴ value ¹³⁵² appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ house ⁸¹²¹	Krimpenerwaard → Bergambacht ³⁰³
bunkerbeheer.nl	Functional Bunker Management Foundation	The website of the Functional Bunker Management Foundation (FBB) presents knowledge about the IJssellinie, defensive works, and bunkers from the period 1950-1968, with the aim of sharing and protecting this knowledge from destruction.	Specialized History → World War II ¹¹³⁴ Museums → Historical Museums ³⁴¹	bunker ⁹² foundation ⁶⁶⁷⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
willemopjeradio.nl	Willem op je radio	Willem op je radio is a radio program that informs listeners about where they can listen to it and offers opportunities to participate.	Radio → Online Radio ⁵⁰⁹	saturday ³⁹ format ³⁶² radio ¹²⁰⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
jeanitavaneijsden.nl	Jeanita van Eijsden	The website of Jeanita van Eijsden presents her profile as a conductor, music and singing teacher, and cantor, providing information about her choir projects and singing lessons.	Education & Training → Singing ⁸⁷⁸ Music Education → Vocal Lessons ⁵²³	singing ¹⁰⁵⁶ conductor ¹²¹⁷ teacher ²⁸⁹⁰ choir ³¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dehostee.nl	De Hostee	De Hostee is a bed and breakfast located in the Krimpenerwaard, offering guests a relaxing stay in a rural environment.	Accommodation → Beds ²²⁸	guest room ¹¹² bed and breakfast ³⁰⁵ bike ¹⁵⁴¹ breakfast ¹⁸²² farm ²⁶²² bathroom ³⁷⁸⁴	Krimpenerwaard → Stolwijk ²³²
familiehotel.nl	Familiehotel.nl	The website provides a platform to find and book family hotels in the Netherlands, with a focus on various outings and destinations.	Hotels → Family Hotels ⁹³ Vacations → Family Vacations ⁴⁷³	zoo ¹²² weekend ³⁸³ outing ⁹⁸² hotel ³⁵⁴³ family ⁶⁴⁶² nature ⁹⁰⁹⁴	The Hague → Scheveningen ¹⁶²⁵
lopiknieuwsvandaag.nl	Lopiknieuwsvandaag	Lopiknieuwsvandaag.nl is a local news website providing updates on events, job vacancies, real estate listings, and weather information for the town of Lopik and its surrounding area.	Government & Administration → Local Municipalities ²¹⁹	incident ³³⁵ weather ⁸¹⁷ job vacancies ¹²⁴¹ house ⁸¹²¹ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Woerden → Harmelen ³³⁵
a3roest.nl	A3 Roest	The website of A3 Roest is a company specializing in the sale, repair, and trade-in of scooters and mopeds, with a long history (since 1971) and a focus on service and quality.	Motorcycles → Scooters ⁹⁰³ Electric Vehicles → Electric Scooters ¹⁰⁸	mopeds ³⁹ scooter ¹²³⁶ showroom ⁴⁸⁸³ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
devrijwilligersbank.nl	Vrijwilligersbank	The Vrijwilligersbank connects volunteers with organizations in the Krimpenerwaard region.	Social Services → Seniors ⁸²² Training → Digital Skills ⁹¹	target group ⁵⁷⁸ resident ³²⁴⁵ vacancy ⁶⁵⁹⁸ volunteer ⁸³⁶⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hwmakelaars.nl	H&W Makelaars	The website of H&W Makelaars provides an overview of real estate transactions and services, primarily focused on residential properties and commercial real estate (BOG), and is centrally located in The Hague and Rotterdam.	Property Advice & Guidance → Property Transactions ¹⁸⁴ Real Estate & Investment → Intangible Assets ¹²³	commercial property ⁴⁶⁹ broker ⁹⁰² appraisal ¹⁴⁸⁸ inventory ¹⁶¹³ rental ⁷²⁵⁷ house ⁸¹²¹	Katwijk → Katwijk aan Zee ⁶¹⁶
verdo.nl	Verdo Staal	The Verdo Staal website showcases the company and its services related to steel construction and buildings.	Building & Materials → Steel & Metal ⁷⁷⁹ Fabrication & Production → Fabrication ⁹³	detail ⁶³⁸ buildings ⁸⁹⁸ steel ¹¹⁷⁷ truck ¹⁴¹²	Krimpenerwaard → Bergambacht ³⁰³
waardsekids.nl	Waardse Kids Kinderopvang	Waardse Kids Kinderopvang provides childcare services, including kindergarten, before- and after-school care, and early childhood education, in the Krimpenerwaard and Lopik regions.	Childcare → BSO ¹⁰¹	pedagogical ¹⁵⁹ bso ³³⁵ preschool ⁴⁹⁵ childcare ³⁵¹² parent ⁴³¹⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
benbdedonk.nl	B&B De Donk	The website of B&B De Donk presents the accommodation, rooms, and surrounding area, and offers the possibility to book online.	Accommodation → Breakfast ³⁶⁴ Landscape → Polders ²¹²	polder ⁴⁷⁶ breakfast ¹⁸²² water ²⁵⁰¹ bicycle ²⁸³⁸ room ³⁴¹¹ terrace ⁴⁸⁴⁷	Molenlanden → Kinderdijk ¹⁵⁸
bijmargo.nl	Margo SLAPEN EN ONTBYTEN	Margo Slapen en Ontbijten is a bed & breakfast located in Bergambacht, operating from a renovated farmhouse.	Accommodation → Guesthouses ⁷²⁶ Accommodation → Lodging ³¹⁷	bed and breakfast ³⁰⁵ sleep ⁷⁴⁶ farmhouse ⁸⁷⁸ guest ¹³³⁴ walk ²¹⁶¹ nature ⁹⁰⁹⁴	Krimpenerwaard → Bergambacht ³⁰³
molenschot-industriebouw.nl	Molenschot Industriebouw	Industriebouw Molenschot is a company specializing in the construction of industrial buildings in Belgium and the Netherlands.	Renovation & Restoration → Construction Industry ⁴⁹⁹ Real Estate & Investment → Real Estate ²¹⁴⁷¹	business space ¹³⁰ steel construction ¹⁴² construction company ⁸²⁴ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
vandijkhaastrecht.nl	Van Dijk Installatietechniek B.V.	Van Dijk Installatietechniek B.V. is an installation company that offers a wide range of installation services, including central heating, plumbing, and ventilation.	Installation & Repair → General Installation ⁷²⁷	ventilation ¹¹¹⁰ plumbing ¹⁷⁶¹ heat ²¹⁸⁸ vacancy ⁶⁵⁹⁸ installation ¹³⁷⁴²
delekruiters.nl	LR&PC de Lekruiters	The Lekruiters is a horse sports association offering various activities and disciplines for members and recreational riders.	Sports Clubs → Table Tennis ⁴⁹⁵ Equestrian → Riding Clubs ²⁴⁵	arena ¹²⁴ competition ⁴⁷⁵⁹ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Krimpenerwaard → Lekkerkerk ²⁴⁴
gertjandeechtebakker.nl	Gertjan de Echte Bakker	The website of Gertjan de Echte Bakker presents two bakeries in Schoonhoven and Lekkerkerk that offer a wide range of bread, pastries, and ice cream, with an emphasis on artisanal production and innovation.	Bakery & Food Production → Specialty Bakeries ⁴⁴ Commerce → Shopping Centers ¹⁰⁰¹	bakery ⁷¹⁸ pastries ⁹⁴⁶ ice cream ¹⁰⁰⁰ bread ¹⁶²²	Krimpenerwaard → Lekkerkerk ²⁴⁴
steunpunt-middenholland-rijnstreek.nl	Parent and Youth Support Point Midden Holland and Rijnstreek	The Parent and Youth Support Point for Midden Holland and Rijnstreek provides information and answers to questions about appropriate education (passend onderwijs) for primary and secondary education in the Gouda region, including Alphen a/d Rijn, Krimpenerwaard, and Waddinxveen.	Primary & Secondary Schooling → Secondary Education ¹⁶³⁹ Curriculum & Resources → Educational Resources ⁴⁰¹	chat ⁵⁴⁴ question ²²⁶¹ education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Bergambacht ³⁰³
madedigital.nl	MADE Digital	The website MADE Digital presents itself as a modern marketing agency helping ambitious organizations with their digital strategy and offers various marketing services and partnership opportunities.	Web Design → Website Builders ⁸⁸⁸ Resources → Databases ³⁴⁸	yearbook ⁹⁸ reference ³³² marketing ⁷¹⁰⁷ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
schouls.nl	Schouls Project- and Risk Management b.v.	Schouls Project- and Risk Management b.v. is a company specializing in project development and management, focusing on complex restructurings.	Planning & Development → Spatial Planning ⁸⁸⁹ Real Estate → Project Development ⁶³³	redevelopment ⁹³ housing construction ¹²⁵ project development ²¹⁵ risk management ⁵⁴³ initiative ¹²⁹⁷ project management ³⁴²³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
ammerstolsesv.nl	Ammerstolse SV	The website of Ammerstolse SV provides information about the sports club, its teams, events, news, and contact details.	Sports Clubs → Dutch Sports Clubs ³³⁷	sponsors ²⁶⁴² club ⁴²²⁵ agenda ⁴³⁷⁴ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Ammerstol ⁴⁹
sophiazobel.nl	The Pool Jewelry Collective	The website showcases the highlight exhibition of Sophia Zobel’s ‘Object & Jewellery’ collection, focusing on her unique approach to transforming historical Rummer glass into contemporary jewelry.	Local History → Dutch History ¹⁰⁶⁷ Specialized History → Colonial History ¹¹⁹	time ⁹³² landscape ²⁶⁰⁹ glass ²⁹¹⁹ jewelry ⁴⁵⁹⁹ exhibition ⁵³³² story ⁸²⁸⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
boekweitolie.nl	Boekweit Olie	Boekweit Olie is a real estate agency located in Hoorn and surrounding areas that sells, rents, and appraises property.	Houses → Semi-Detached Houses ⁷⁵¹ Context ¹⁶¹³⁹⁴	agency ⁹⁴⁴ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶ network ¹¹¹²³	Vlissingen → City Center ¹⁷
dietz.nl	Dietz	Dietz is an advisory firm specializing in spatial issues and citizen participation in decision-making.	Architecture → Urban Planning ¹⁴⁶⁵ Community → Government & Administration ¹⁰⁵⁶⁷	spatial issues ¹⁰ decision making ⁴⁰ participation ¹⁴³⁰ strategy ⁹³⁷⁹ communication ¹⁰¹⁶²	Krimpenerwaard → Bergambacht ³⁰³
totalharmony.nl	Total Harmony	The website Total Harmony is a practice offering naturopathic therapies, nutritional advice, massage and health coaching, aiming to help people become fitter and more vital, and to treat and prevent chronic ailments.	Alternative Medicine → Complementary Therapies ⁸⁵⁸	wellness ¹⁵⁶¹ vitality ¹⁷²⁶ nutrition ⁴⁹³⁵ complaint ⁶⁴⁷⁹ therapy ⁷⁴⁴⁸ massage ⁷⁶⁴⁶	Krimpenerwaard → Bergambacht ³⁰³
my-lex.nl	MY-LEX	MY-LEX provides a comprehensive content integration search engine and solutions for managing the entire document lifecycle.	Business Software → Document Management ³²⁸ IT → Software Services ⁵⁹	search engine ⁵³⁶ integration ¹⁴⁵¹ document ¹⁶⁷⁸ archive ²⁰⁶⁷	Krimpenerwaard → Bergambacht ³⁰³
vanrhijnmakelaars.nl	Van Rhijn Makelaars	Van Rhijn Makelaars is a real estate agency operating in the Gouda and Reeuwijk region, specializing in facilitating property sales, purchase assistance, and rentals.	Real Estate → Property Agents & Brokers ¹³⁶⁶	purchase ²²¹² rate ²⁶⁰⁶ sale ⁵⁹³⁰ technology ⁶⁸¹⁶ property ⁷⁴⁰⁶	Alphen aan den Rijn → Boskoop ⁶⁵²
kleinmakelaardij.nl	Klein Makelaardij	Klein Makelaardij is a real estate agency based in Gouda specializing in the sale, purchase, and valuation of properties.	Real Estate → Property Valuation & Appraisal ²¹²³ Real Estate → Valuation Services ⁷⁶	nvm ⁴³ valuation ²⁶⁹⁷ region ⁵⁴¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Zuidplas → Moordrecht ³³²
lindenburgmakelaardij.nl	Lindenburg Makelaardij	Lindenburg Makelaardij is a real estate agency specializing in the sale and purchase of properties, as well as appraisals and related services.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Property Agents & Brokers → Regional Agents ³⁵²	dream home ⁵⁹ agent ¹²⁵³ appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Zuidplas → Moordrecht ³³²
hansdenhartogjager.nl	hansdenhartogjager.nl	The website hansdenhartogjager.nl is a blog covering various topics, including watersports, healthcare, sustainability, and local events in the Netherlands.	Water Sports → SUP ⁵⁸ Social → Personal Blog ²⁷¹⁸	sup board ⁷⁷ solar energy ³⁷³	Voorst → Twello ⁴⁶⁹
oostendorpwijnen.nl	Oostendorp Wijnen	The website oostendorpwijnen.nl offers online wine sales with free home delivery and various wine promotions.	Gifts & Souvenirs → Wine Shops ⁷⁹⁶	grape ²²² country ⁵³⁰ wine ⁴⁴⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
boutiquecafelien.nl	Boutique Café Lien	Boutique Café Lien is a café in Schoonhoven offering lunch, coffee, high tea, and catering services, emphasizing a cozy atmosphere and quality.	Tea → High Tea ⁹⁰ Ice Cream → Ice Cream Parlors ⁵²¹	high tea ⁵⁸⁵ lunch ¹⁵³⁴ reservation ³³⁷³ coffee ³⁸³⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stadscampingschoonhoven.nl	Stadscamping Schoonhoven	Stadscamping Schoonhoven is a campsite in Schoonhoven, Netherlands, offering campers a variety of facilities including a marina, restaurant, and space for cyclists, families, and pets.	Boating → Marinas ⁸²⁵	marina ⁴⁸⁷ pet ¹⁶¹⁷ cycle ¹⁹⁰⁶ campsite ²⁰⁹³ facility ²⁶¹⁶ restaurant ¹¹²¹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
versluisaccountancy.nl	Versluis Accountancy	The website of Versluis Accountancy is an accounting firm based in Schoonhoven that offers various services, including accounting, advice, administration, and outsourcing, with a focus on a personal and customer-oriented approach.	Accounting → Auditing ¹⁷⁶	audit ⁶²² account ⁵⁷⁸¹ administration ⁶⁵⁸⁷ software ⁸²⁹¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
fattiger.nl	Fat Tiger Spiritz	The website of Fat Tiger Spiritz offers a handcrafted limoncello made with organic ingredients and available in a personalized version. The company sells the limoncello online, in restaurants and shops, and also offers the option to order and collect it at partner locations.	Beverages → Limoncello ²⁸ Chocolate & Sweets → Confectionery ¹¹⁹	limoncello ⁶² personalize ²⁹¹ bottle ³⁰⁰ order ⁶⁹¹² blog ¹³³⁹²	Krimpenerwaard → Haastrecht ¹⁹³
mannacharter.nl	Mannacharter	The website of Mannacharter offers sailing vacations and group accommodation aboard the two-masted clipper 'de Manna', focusing on active relaxation and unique experiences, including yoga retreats.	Hotels → Boutique Hotels ⁹¹⁴ Sailing → Sailing Vacations ²²	sailing trip ⁹¹ waddenzee ¹⁴² group outing ¹⁴⁹ yoga ³⁷⁰⁴ catering ⁶⁴⁵⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
hbcplanontwikkeling.nl	HBC Planontwikkeling	HBC Planontwikkeling is a project developer based in Schoonhoven focused on the development of real estate, including residential complexes, business parks, and housing for migrant workers.	Commercial Property → Business Parks ³²⁴	business park ³⁷² housing ⁴³⁷⁸ real estate ⁴⁹⁸¹ community ⁷⁹³¹	Houten → Tull and 't Waal ⁴¹
loeloes.nl	Loeloes	Loeloes is a restaurant and event location on the Water in Vlist offering a pleasant atmosphere for dining, drinking, events, and relaxation.	Bars → Sports Bars ⁶⁰ Sport Facility → Pools ⁹⁵	pool table ⁶⁰ cafe ¹⁶²² beer ²⁸⁸⁷ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Vlist ³⁷
eethuisdewaag.nl	Eethuis de Waag	Eethuis de Waag is a restaurant in Schoonhoven that offers delicious meals and a cozy atmosphere.	Cafes & Lunch → Local Restaurants ²⁹	meal ¹⁶³⁸ atmosphere ⁵⁵⁹¹ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
loeviera.nl	Loeviera	Loeviera is an art design and education company specializing in paintings, sculptures, jewelry, graphic design, illustrations, and design concepts. They also offer educational programs, events, and customized solutions utilizing art as a tool, and create design concepts for marketing campaigns.	Visual Arts → Fine Art ³²² Arts & Culture → Art Education ⁵⁹⁴	sculpture ¹⁴⁴⁰ paintings ³⁹⁰⁷ course ¹⁴⁷²⁸ design ²⁷²⁰² event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
tvdvlist.nl	T. v.d. Vlist B.V.	The website of T. v.d. Vlist B.V. is an online platform focused on the purchase, sale, rental, and repair of earthmoving machines, with a tradition of over 50 years in the industry.	Property Rentals → Rental ¹¹⁶⁹	excavator ³⁰⁴ machine ³⁷²⁷ transport ⁶¹⁰⁵ rental ⁷²⁵⁷ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Gouderak ¹⁰³
toegepastekunstleiden.nl	Stichting Toegepaste Kunst Leiden	The Stichting Toegepaste Kunst Leiden researches and presents applied art, with a focus on silver from Leiden and its surrounding area.	Foundations → Cultural Foundations ¹⁰¹ Painting → Dutch Art ³²²	silver ⁴⁷⁹ publication ²⁰¹⁸ exhibition ⁵³³² research ⁸⁹⁶⁷ network ¹¹¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
naaimachinesuperstore.nl	NaaimachineSuperstore	The website NaaimachineSuperstore offers an online shop selling sewing machines, supplies, accessories, and related materials for handmade fashion.	Crafts → Sewing ⁵⁹¹	sewing machine ²⁴⁵ supply ⁹⁶¹ accessories ¹²⁹⁷⁵ workshop ¹⁹³²⁵	Alphen aan den Rijn → AWZI Alphen a/d Rijn ³⁵⁸
zwembadschuagt.nl	Zwembad Schuagt	Zwembad Schuagt is an outdoor swimming pool located in the Krimpenerwaard that offers recreational swimming and lane swimming, with facilities for various ages.	Garden → Swimming Pools ⁶⁰¹ Swimming → Outdoor Pools ⁹⁴	bar ¹²¹⁶ pool ¹⁵³² facility ²⁶¹⁶ safety ⁵⁸¹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
zwembaddebaan.nl	Zwembad de Baan	The website of Zwembad de Baan in Gouderak provides information about the swimming pool, including opening hours, rates, swimming lessons, and contact details.	Garden → Swimming Pools ⁶⁰¹	locker ¹³⁴ swimming lesson ³⁹³ swimming pool ¹⁶⁶⁴ opening hours ²⁹⁵³ board ³⁴³⁸	Krimpenerwaard → Gouderak ¹⁰³
demengelmoestuin.nl	MengelmoesTuin	The website of the MengelmoesTuin presents the activities, products, and location of a natural fruit and herb garden that is present at various markets and events.	Plants → Nurseries ¹⁰¹²	harvest ²⁷⁵ herbs ⁹²⁴ market ²⁷⁷² newsletter ⁶⁵⁰⁴ garden ¹³¹²⁹	Krimpenerwaard → Bergambacht ³⁰³
wetland-cats.nl	Stichting Wetland Cats	The Stichting Wetland Cats is a foundation that rescues cats who have nowhere else to go, providing them with a safe and happy life.	Animal Shelters → Cat Shelters ¹² Animal Welfare → Animal Protection ¹⁷³	adoption ³⁵⁹ shelter ³⁸⁵ cat ¹⁵⁷⁸ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷	Krimpenerwaard → Gouderak ¹⁰³
elannotarissen.nl	Elan Notarissen	Elan Notarissen is a notary office providing expert legal advice and services to individuals and businesses, including wills, estate planning, and the drafting of purchase agreements.	Inheritance Law → Wills ²⁰⁰ Law → Business Law ¹³⁶¹	llc ¹³ purchase agreement ⁵⁶ estate planning ⁹³ will ⁵¹⁰ notary ⁷⁹¹ mortgage ⁴⁵⁶⁴	Krimpenerwaard → Bergambacht ³⁰³
broodje-kadootje.nl	Broodje Kadootje	The website of ‘Broodje Kadootje’ describes a lunchroom and catering business in Lekkerkerk that specializes in regional products, company lunches, and special occasions.	Cafes & Lunch → Lunch Spots ²³⁷ Tea & Coffee → Tea Rooms ²²⁹	lunchroom ³¹² regional products ³⁹¹ high tea ⁵⁸⁵ sandwich ⁴⁰⁹⁸ gift ⁶⁴⁴² catering ⁶⁴⁵⁶	Molenlanden → Kinderdijk ¹⁵⁸
deveerstalhoeve.nl	De Veerstalhoeve	De Veerstalhoeve is a farm in the Krimpenerwaard region that houses horses and cows and sells their products directly from the farm.	Animals → Horses ¹⁴⁵⁵ Tourism → Farm Visits ⁷⁶	pasture ¹⁹¹ farm shop ²⁰⁴ cow ⁵⁹⁶ cheese ¹²⁰⁵ meat ²⁰⁵⁵ horse ⁴³³⁷	Krimpenerwaard → Gouderak ¹⁰³
kanocentrum-haastrecht.nl	Kanocentrum Haastrecht	The website of Kanocentrum Haastrecht offers canoe and bicycle rentals in South Holland, specifically in the area around the Vlist river near Haastrecht.	Water Sports → Canoeing ¹⁷⁶ Cycling → Bicycle Rental ⁶⁴³	canoe ²⁶⁹ bicycle ²⁸³⁸ opening hours ²⁹⁵³ rental ⁷²⁵⁷	Krimpenerwaard → Haastrecht ¹⁹³
delekbongerd.nl	The Lekbongerd	The Lekbongerd is a rest and green experience point in Schoonhoven offering local products and the opportunity to visit the orchard.	Farms & Farm Businesses → Farm Shops ¹⁷² Food → Local & Regional Products ⁹³⁰	rest area ¹¹ local products ⁷¹ orchard ²⁴⁰ barn ²⁸² fruit ¹¹⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
de-kaardebol.nl	Bloembinderij De Kaardebol	Bloembinderij De Kaardebol is a flower shop in Schoonhoven specializing in creative, high-quality floral arrangements, custom solutions, and personalized advice, featuring a changing store environment and a wide selection of flowers, plants, and accessories.	Flowers → Florists ¹⁴¹⁰ Agriculture → Horticulture & Floristry ¹⁴⁰⁴	arrangement ³¹⁰⁴ flowers ³²⁴⁸ shop ⁶⁴⁸³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
thorvolleybal.nl	Volleybalvereniging THOR Bergambacht	The website of Thor Volleybal Vereniging Bergambacht provides information about the volleyball association, including membership, teams, events, and contact details.	Volleyball → Volleyball Associations ⁷²	volleyball association ⁴² youth ³¹²⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴²	Krimpenerwaard → Bergambacht ³⁰³
dosvolleybal.nl	Volleybalvereniging DOS	The website of Volleybalvereniging DOS in Schoonhoven provides information about the association, its teams, events, and membership.	Team Sports → Volleyball ⁸⁴²	volleyball ⁶¹⁷ committee ⁶²⁹ match ³⁴⁷¹ member ¹⁰¹⁵⁴ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
derodemus.nl	De Rode Mus	De Rode Mus is a berry farm that cultivates and sells blueberries, raspberries, and various types of apples in the Krimpenerwaard region.	Fruit → Berries ¹²	berries ⁵⁴ harvest ²⁷⁵	Krimpenerwaard → Berkenwoude ⁶²
debonteweide.nl	De Bonte Weide	The website of De Bonte Weide presents a biological dairy goat farm and farm shop in Stolwijk, selling a variety of products.	Farms & Farm Businesses → Farm Shops ¹⁷²	kefir ¹⁵ goat ¹²⁰ cheese ¹²⁰⁵ vegetables ¹⁴¹⁶ animal ²⁹⁰⁸ shop ⁶⁴⁸³	Krimpenerwaard → Stolwijk ²³²
proost-band.nl	PROOST!	This website showcases the band PROOST! and their event schedule.	Popular → Electronic Music ⁵⁰⁵ Music & Performance → Music Events ⁷⁵⁸	effect ¹⁵⁴ friend ⁶³⁹ show ¹³⁹¹ band ²⁹⁷⁷ drink ⁵¹⁹¹ party ⁵⁹²⁸	Krimpenerwaard → Berkenwoude ⁶²
meulenkampoptiek.nl	Meulenkamp Optiek	Meulenkamp Optiek is an optician in Lekkerkerk with over 35 years of experience, offering eye care solutions including contact lens subscriptions and eyeglasses.	Specialty Medicine → Optometry ⁵³⁹	opticians ⁴⁰ adjustment ¹¹⁴ summer ⁴⁸³ contact lenses ⁵³⁸ glass ²⁹¹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
waardstroom.nl	Energie Samen	The Coöperatie Waardstroom is an initiative by residents of Krimpenerwaard, focused on generating and sharing sustainable solar electricity.	Cooperatives → Energy Cooperatives ³¹⁵	cooperative ⁶⁴⁹ electricity ⁷⁴⁵ energy ⁹⁰⁷⁵ member ¹⁰¹⁵⁴ installation ¹³⁷⁴²	Krimpenerwaard → Haastrecht ¹⁹³
buildingsuits.nl	BuildingSuits B.V.	The website presents building compact panels from BuildingSuits B.V., a decorative facade cladding with protective properties.	Building & Materials → Plastic Materials ¹⁹ Building & Materials → Facades & Cladding ⁸⁰⁹	uv protection ¹⁴ facade cladding ³⁸⁴ color ⁴¹⁵⁹ warranty ⁴⁷⁰¹	Meierijstad → Veghel ¹²⁸⁸
zilverdag.nl	Gemeente Schoonhoven	The Zilverdag.nl website is an information platform for the annual National Silver Day held in Schoonhoven, aimed at promoting the event and the city.	Galleries & Exhibitions → Art Routes ²¹⁵ Local & Regional → Regional Events ⁸²¹	workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
zilverhistograaf.nl	Zilver Histograaf	The Zilver Histograaf Schoonhoven is a free digital magazine providing information about the history of the Zilverstad.	Magazines → Digital Magazines ¹³ Internet → Archives ⁴²²	craftspeople ¹⁹ city ¹⁸⁷⁵ magazine ²¹⁸² history ⁷²⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ijsselbloem.nl	René and Monique Bos	The IJsselbloem Bed & Breakfast website presents the guest accommodation and provides information about the location, facilities, and activities in the surrounding area.	Cycling → Cycling Routes ¹⁰⁰² Accommodation → Overnight Stays ¹⁴⁵	polder landscape ³⁵ hiking ⁸⁴¹ b&b ¹⁰⁶⁰ cycle ¹⁹⁰⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
hetoudenhuis.nl	The Ouden Huis	The Ouden Huis provides independent living with the option of assistance and care, aimed at seniors with various income levels and care needs.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹	seniors ⁹⁰⁴ house ⁸¹²¹ care ¹²³³⁸ collaboration ¹⁶⁰³⁶	West-Maas en Waal → Beneden-Leeuwen ²⁶⁰
rekreatieparkdekooi.nl	Rekreatiepark De Kooi	The website of Rekreatiepark De Kooi presents a campsite with fixed and temporary pitches, chalets, and cabins, located in the Green Heart of the Netherlands, near Gouda, and with various recreational opportunities.	Accommodation → Cabins ²³¹ Nature → Nature Reserves ¹⁰³²	seasonal pitch ²⁴ green heart ³⁹ fishing water ⁸⁷ cycling route ⁴⁵¹ chalet ¹²⁶⁴ campsite ²⁰⁹³	Krimpenerwaard → Stolwijk ²³²
thecranberrycompany.nl	Best Berry B.V.	The website of The Cranberry Company describes the organic cranberry cultivation in the Groene Hart region and highlights the harmonious relationship between agriculture and nature.	Ornithology → Bird Conservation ¹⁷⁰ Agricultural Technology & Innovation → Sustainable Agriculture ²⁷⁸	cranberry ¹⁷ berries ⁵⁴ plot ¹⁰⁵¹ nature ⁹⁰⁹⁴	Alkmaar → Oudorp ³⁴⁵
alphamakelaardij.nl	Alpha Makelaardij B.V.	The website of Alpha Makelaardij B.V. in Gouda provides an overview of housing, commercial properties, and services related to the sale, purchase, valuation, and rental of real estate. The aim is to guide potential buyers and sellers through the process.	Finance → Taxation ¹⁵⁶⁷ Real Estate & Investment → Real Estate ²¹⁴⁷¹	commercial property ⁴⁶⁹ purchase ²²¹² valuation ²⁶⁹⁷ sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Alphen aan den Rijn → Boskoop ⁶⁵²
perfectgroep.nl	Perfect Groep (merged with Mail Succes Media & Marketing Support)	The website of Perfect Groep, now merged with Mail Succes Media & Marketing Support, offers marketing, creative, and production services, and shares news and updates via a newsletter.	Online Marketing → Google Marketing ⁵⁵ News & Journalism → Newsletters ⁵⁹	creative ⁵³⁹ production ⁴⁵⁸² newsletter ⁶⁵⁰⁴ marketing ⁷¹⁰⁷	Krimpenerwaard → Gouderak ¹⁰³
lydaspoppenkleertjes.nl	Lyda's poppenkleertjes	Lyda's poppenkleertjes is an online shop selling handmade clothing for Baby Born and other 43cm dolls.	Clothing → Doll Clothing ¹⁰ Crafts → Sewing ⁵⁹¹	doll ¹⁹⁰ market ²⁷⁷² shop ⁶⁴⁸³ clothing ⁹⁴⁴³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
detweehoeven.nl	The Two Heaves	The Two Heaves is a dairy farm and cheese maker that offers tours and where you can purchase their farm cheese.	Livestock → Dairy Farming ⁶⁷¹ Tourism → Farm Visits ⁷⁶	hayloft ¹² farm shop ²⁰⁴ milk ⁴²¹ cow ⁵⁹⁶ tours ¹⁰⁴⁸ cheese ¹²⁰⁵	Krimpenerwaard → Haastrecht ¹⁹³
hhb-accoya-online.nl	Accoya Online	The website Accoya Online is the online distributor of Accoya wood in the Benelux, offering information about this sustainable wood species and its various applications.	Wood → Wood Species ¹⁹ Trade → Timber Trade ¹¹⁶	timber ³⁵³ facade ¹⁴⁹⁰ wood ⁴¹⁵³ sustainability ¹⁸⁴⁵¹	Voorne aan Zee → Brielle ⁶¹³
janspoel.nl	Jan Spoel Photography	The website JanSpoelPhotography presents photographs by Jan Spoel, primarily focused on nature photography and activities organized by the IVN (Netherlands Nature Organization) in the Gouda region and surrounding areas. The site also includes information about workshops and excursions focused on biodiversity and nature photography.	Nature & Landscape → Nature Photography ⁴⁸² Environmental Studies → Nature Education ¹⁵⁹	photoshop ⁸⁸ excursion ⁶⁶² biodiversity ⁷²⁰ photo ⁷⁷⁷⁸ photography ⁹⁵⁰³	Drimmelen → Biesbosch ³¹³
silvercityrun.nl	SilvercityRUN	The SilvercityRUN 2025 website promotes the annual hard-running event in Zilverstad Schoonhoven, a race that takes place through the Green Heart and historic center, known for its combination of sport, atmosphere, and nostalgia.	Walking → Walking Competitions ¹⁸² Outdoor Activity → Running ¹⁸²⁹	runner ¹²⁶ ferry ¹⁷⁹ route ³⁴²⁵ party ⁵⁹²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
amadeushuis.nl	Amadeushuis	The Amadeushuis provides small-scale residential care for elderly individuals with dementia, with music as a central theme, focused on preserving personal lifestyles and creating a warm, familiar environment.	Elderly Care → Dementia Care ⁴¹ Care → Residential Care ³⁰⁵	dementia ⁶⁷⁴ studio ⁵⁴⁶⁵ home ⁷⁹⁷⁶ care ¹²³³⁸ music ¹³¹⁷⁰	Lansingerland → Bergschenhoek ⁵⁶⁸
groenehartfotografie.nl	Groene Hart Fotografie	The website of Groene Hart Fotografie showcases photos of birds, plants, and landscapes in the region, particularly in the Reeuwijkse Plassen and surrounding polders and natural areas.	Landscape → Polders ²¹² Ornithology → Birdwatching ²⁷¹	wetland bird ²⁷ polder ⁴⁷⁶ pond ⁶⁸⁶ bird ⁹²² photo ⁷⁷⁷⁸	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
veenweidenkrimpenerwaard.nl	Veenweiden Krimpenerwaard	The Veenweiden Krimpenerwaard website provides information about a project focused on strengthening the peat meadow landscape in the Krimpenerwaard through the realization of 2.250 hectares of additional nature, with the participation of farmers, private landowners, the government, and partners.	Planning & Development → Spatial Planning ⁸⁸⁹ Legal & Permits → Building Permits ⁴³	permits ⁶⁴³ contractor ¹⁰³⁹ nature ⁹⁰⁹⁴	Krimpenerwaard → Gouderak ¹⁰³
koops-romeijn.nl	Koops & Romeijn Geogroep	The website of Koops & Romeijn Geogroep presents the company as a group of independent advisors specializing in geotechnical investigations, geotechnics, and hydrogeology, offering their services to a diverse range of clients.	Engineering → Environmental Engineering ⁴¹ Civil & Infrastructure → Foundation Engineering ³³		Rheden → Velp ⁷⁰⁰
atelierq.nl	AtelierQ	AtelierQ.nl is an online shop and workshop specializing in the design and creation of jewelry, with a focus on bespoke craftsmanship and quality in Zilverstad Schoonhoven.	Jewelry → Handmade Jewelry ⁸⁶² Retail & Commerce → Commerce ⁸²⁴⁴	silver ⁴⁷⁹ online shop ¹³¹⁰ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hetschapenschuurtje.nl	Het Schapenschuurtje	Het Schapenschuurtje is a tea garden and rest area located in Berkenwoude, aiming to provide a relaxing place in the Krimpenerwaard.	Garden → Tea Garden ²⁴ AccommodationTypes → Accommodation ¹²¹³⁰	rest area ¹¹ tea garden ⁹⁸ polder ⁴⁷⁶ bike ¹⁵⁴¹	Krimpenerwaard → Berkenwoude ⁶²
verloskundigenpraktijkbevaltbeter.nl	Bevalt Beter	Bevalt Beter is a midwifery practice that supports pregnant women and women who wish to become pregnant.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	breastfeeding ³⁹⁸ midwife ⁵⁵³ ultrasound ⁷⁶⁹ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹	Krimpenerwaard → Bergambacht ³⁰³
vesuvio.nl	Il Vesuvio	The website of Pizzeria Il Vesuvio presents the historic pizzeria in The Hague, with a mobile pizza wagon that also sells pizzas at various locations.	Essential → Food ⁴⁷⁹⁹⁹	pizza ⁴¹⁵⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
pealsoundsupport.nl	Peal Sound Support	Peal Sound Support is a company that organizes and supports events, particularly musical and entertainment events.	Event Planning → Sound ³³⁹	sound technology ²⁷ karaoke ¹⁷⁶ show ¹³⁹¹ photography ⁹⁵⁰³ event ⁴⁵¹⁹⁹	Drechterland → Venhuizen ¹⁵⁴
elektricien-tilburg.nl	RV Elektra	RV Elektra is an electrician based in Tilburg offering various electrical services.	Electrical Engineering → Electrical Technology ¹⁹⁶ Lighting & Electrical → Utilities ³⁸⁸	group box ⁵³ power outage ⁸⁴ charging station ⁷⁸⁹ electrician ⁸¹⁹ inspection ⁴²⁷⁹ solar panels ⁴⁷⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
stammontagebouw.nl	Stam Montagebouw	Stam Montagebouw is a specialist in installing ceilings, walls, and floors, with a focus on sustainable transformations of buildings.	Construction Companies → Finishing Contractors ³⁸³	ceiling ⁶²⁷ wall ¹³⁷⁸ floor ⁴⁷⁸¹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Stolwijk ²³²
schaik.nl	Van Schaik	Van Schaik is an automotive dealership offering new and used cars from brands such as Toyota and Suzuki, with a workshop and financing options.	Automotive Maintenance → Vehicle Inspection ¹¹⁰²	used car ⁸²⁵ lease ¹⁵⁹⁵ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autoschadezijdepark.nl	ASN Autoschade Zijdepark	ASN Autoschade Zijdepark Bergambacht is an auto body repair shop that quickly and efficiently handles damage to passenger cars and company vehicles.	Auto Repair Services → Dent Repair ¹⁸⁶ Manufacturing & Industrial → Industrial Services ⁴⁰⁰	damage ¹⁵⁶² transportation ²⁸⁵¹ insurance ⁶³⁵⁹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
deautowerkplaats.nl	De Autowerkplaats	De Autowerkplaats is an automotive service business located in Krimpen aan de Lek that offers vehicle inspections, maintenance, and repairs.	Tires → Tire Service ⁹³¹ Auto Repair Services → General Repairs ⁴⁴	apk ¹³³³ tire ¹⁹⁷⁵ air conditioning ²¹⁷⁸ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vrolek.nl	Stichting Vrolek	The website serves as an archive of the local radio station Vrolek, which operated from 1986 to 2015 in the municipality of Nederlek.	Radio → Local Radio ²⁹¹ Internet → Archives ⁴²²	evening ²⁸⁷ station ⁴²⁰ studio ⁵⁴⁶⁵ photo ⁷⁷⁷⁸ story ⁸²⁸⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
kokafvalcontainers.nl	KOK Afvalcontainers	The website of KOK Afvalcontainers offers the possibility to rent waste containers in the Krimpenerwaard and surrounding areas. The platform facilitates a simple order process and provides information on different container sizes and waste streams.	Waste Management → Waste Processing ⁹⁶ Waste Management → Container Rental ³⁶⁸	rent ⁹⁸¹ waste ¹³¹² container ¹⁷⁰⁹ order ⁶⁹¹²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
patricklaureij.nl	Patrick Laureij	The website presents a schedule of theater and cultural performances across the Netherlands.	Entertainment → Leisure Activities ³³⁸ Tourism → Cultural Attractions ⁶⁹⁸	date ¹¹¹² hall ¹⁷⁸⁶ theater ²⁵⁴⁴ schedule ²⁶²⁴ performance ⁷⁵⁸⁶	Lingewaard → Bemmel ⁵⁰⁹
overtuinbisdomvanvliet.nl	Overtuin Bisdom van Vliet Foundation	The website of the Overtuin Bisdom van Vliet Foundation describes the historical park Overtuin in Haastrecht and the efforts to preserve and restore it.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Outdoor & Garden → Garden ⁸¹⁰⁷	foundation ⁶⁶⁷⁸ garden ¹³¹²⁹	Krimpenerwaard → Haastrecht ¹⁹³
deweerdwonenenslapen.nl	De Weerd Wonen en Slapen BV	De Weerd Wonen en Slapen BV is a home interior specialist helping customers create a comfortable and stylish home through advice, an extensive product collection and personalized service.	Bedroom → Bedding ⁹⁴⁰ Decor & Furnishings → Interior Design Stores ³¹	bed ¹³⁸⁴ collection ⁷⁵⁶⁶ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
pvcdesign.nl	PVC Design	PVC Design is an online store offering high-quality PVC flooring and carpets, with a focus on advice, installation service, and a wide range of accessories and maintenance products.	Flooring → PVC Flooring ²⁴⁵	installation service ¹¹⁶ pvc flooring ¹⁹⁹ carpet ⁸⁴⁰ price ⁸³²⁸ accessories ¹²⁹⁷⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ekb-nl.nl	EKB Container Logistik Nederland B.V.	EKB Container Logistics Netherlands is a logistics company specializing in container transport across Europe.	Freight & Shipments → International Logistics ¹⁰⁷	inland waterway ⁶⁹ rail ¹⁹⁹ europe ²⁸⁹ container ¹⁷⁰⁹ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
doofenkerk.nl	Interkerkelijk Dovenpastoraat	The Interkerkelijk Dovenpastoraat (IDP) supports churches in dealing with the deaf and facilitates interpreter services and activities.	Communication → Interpreting ²⁶⁵ Language Learning → Language Education ⁴²⁷	deaf ¹⁷ interpreter ²¹⁷ bible ¹²⁷⁶ church ³⁴³⁹ volunteer ⁸³⁶⁷	Katwijk → Katwijk aan Zee ⁶¹⁶
schoonhovenkeukens.nl	Schoonhoven Keukens & Interieur	Schoonhoven Keukens & Interieur is a company specializing in designing and building custom kitchens and interior solutions.	Kitchen → Kitchen Manufacturers ¹²⁰ Decor & Furnishings → Interior Design ²³¹⁷	wood ⁴¹⁵³ showroom ⁴⁸⁸³ kitchen ⁶⁴⁴³ interior ⁸⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hogendoornbv.nl	Hogendoorn Grondverzet en Heiwerken	Hogendoorn Grondverzet en Heiwerken is a company specializing in groundworks, pile driving, and the rental of various machinery and transport equipment, with a focus on sustainable solutions such as electric mini excavators.	Building & Materials → Construction Machinery ⁷³⁰ Machine & Equipment → Machine Rental ¹⁹²	pile driving ¹⁵ mini excavator ⁵³ excavator ³⁰⁴ machine park ⁶⁴² groundwork ¹³⁴⁸ transport ⁶¹⁰⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
proeftuinkrimpenerwaard.nl	Proeftuin Krimpenerwaard	The Proeftuin Krimpenerwaard focuses on developing agricultural methods resilient to challenges like climate change and soil degradation, aiming for a sustainable future for agriculture and the cultural landscape.	Agricultural Technology & Innovation → Sustainable Agriculture ²⁷⁸	climate change ²⁰⁶ pilot ²⁰⁸ agriculture ⁷⁷⁸ soil ⁹³⁰ resilience ¹⁰⁹¹ research ⁸⁹⁶⁷
meestersvandezilverstad.nl	Meesters van de Zilverstad	The website of Meesters van de Zilverstad presents a gallery focusing on the tradition of silver craftsmanship in Schoonhoven, with a focus on contemporary jewelry and silverware.	Jewelry → Goldsmiths ³¹⁹ Artists & Studios → Galleries ¹³⁹⁸	goldsmith ²²⁴ silver ⁴⁷⁹ craftsmanship ¹⁸⁵⁸ gallery ¹⁹⁸³ jewelry ⁴⁵⁹⁹ artist ⁵⁷⁴⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
puurbloemenbinnen.nl	DutchHome BV	DutchHome PUUR is a flower and interior shop located in Schoonhoven, offering a wide range of flowers, plants, and interior items, and providing interior design advice.	Commerce → Flowers ²²³⁸ Gardening → Plants ²⁸⁶⁷	flowers ³²⁴⁸ plant ⁴⁵⁰⁹ interior ⁸⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
lekkerkerkdoordetijd.nl	Historical Association Lekkerkerk through the Ages	The website of the Historical Association Lekkerkerk through the Ages aims to preserve and promote the history and culture of the village of Lekkerkerk by initiating and stimulating various activities to foster community life.	Local History → Dutch History ¹⁰⁶⁷ Historical & Tourism → Historic Transportation ¹⁵	excursion ⁶⁶² monument ¹¹⁶⁸ culture ³⁹²² exhibition ⁵³³² history ⁷²⁸⁶ association ⁸⁵⁶²	Krimpenerwaard → Lekkerkerk ²⁴⁴
allurestijlvol.nl	Allure	Allure is a women's boutique in Schoonhoven offering elegant and timeless brands and providing personalized service.	Women’s Clothing → Boutique ¹³⁹	fashion ²²¹² jewelry ⁴⁵⁹⁹ collection ⁷⁵⁶⁶ accessories ¹²⁹⁷⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
smaakvandewaard.nl	Smaak van de Waard	Smaak van de Waard is a sustainable caterer offering various catering services in Rotterdam and the surrounding area.	Tea & Coffee → Tea Rooms ²²⁹ Fine Dining & Gastronomy → Gastronomy ⁵⁹⁹	walking dinner ²² local products ⁷¹ bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ catering ⁶⁴⁵⁶ workshop ¹⁹³²⁵	Zaltbommel → Brakel ⁹⁸
dierenportretten.nl	Art by Ruud	The Art by Ruud website showcases the artwork of Ruud van Unen, primarily portraits of dogs and birds, along with a biography of the artist.	Nature → Flora ³⁸	bird ⁹²² portrait ³⁶⁸⁵ paintings ³⁹⁰⁷ exhibition ⁵³³²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
historischevereniginghaastrecht.nl	Historical Association Haastrecht	This website of the Historical Association of Haastrecht presents the activities, history and news reports of the association, which focuses on preserving and disseminating the historical values of the municipality of Haastrecht.	National Holidays → King’s Day ³⁸⁹	monument ¹¹⁶⁸ history ⁷²⁸⁶ association ⁸⁵⁶² member ¹⁰¹⁵⁴ news ¹⁵²⁹³	Krimpenerwaard → Haastrecht ¹⁹³
nksnoekbaarsvissen.nl	NK Snoekbaarsvissen	The website of NKS Snoekbaarsvissen serves as an information hub for the Dutch Snoekbaarsvissen competition (NKS), including agendas, results, regulations, and news.	Water Activity → Fishing ¹⁰⁵⁵ Team → Cricket ⁵⁹	sponsor ¹¹⁵⁹ regulation ¹³⁵⁰ match ³⁴⁷¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
oostromgouderak.nl	Oostrom	Oostrom is an installation company offering various technical services and projects.	Building Systems & Services → Mechanical Services ⁹⁸	electrical ¹⁴¹⁴ plumbing ¹⁷⁶¹ heat pump ²⁵⁴¹ installation ¹³⁷⁴²	Rotterdam → Overschie ²⁴²
aannemingsbedrijfwvisser.nl	Aannemingsbedrijf W. Visser en Zn. B.V.	The website of Aannemingsbedrijf W. Visser en Zn. B.V. presents the company as a construction and contracting company specializing in new construction, foundation repair, renovation, expansion, restoration, and maintenance, with a long tradition dating back to 1925.	Engineering → Engineering Firms ⁹⁸⁹ Sustainable Building → Construction Projects ⁸²³	foundation repair ²⁴ building plan ¹⁶⁷ permit ⁷⁴⁴ new construction ²⁶⁷² renovation ¹³⁸⁴⁹	Albrandswaard → Rhoon ⁴⁴⁸
hhsk-sgpchristenunie.nl	SGP-ChristenUnie HHSK	The website of SGP-ChristenUnie HHSK provides news, blog posts, and information about the political activities of the party and the Hoogheemraadschap Schieland and the Krimpenerwaard, with a focus on elections and agricultural issues.	Local Politics → Parties ⁶²² Local Politics → Municipal Council ⁴⁸⁴	election program ⁸⁵ agricultural sector ⁹³ faction ¹³² election ⁴⁰⁴	Zuidplas → Moordrecht ³³²
peetborst.nl	Peet Borst Bandentechniek	Peet Borst Bandentechniek is a comprehensive band specialist offering a wide range of tire, maintenance, and repair services for various vehicle types.	Tires → Tire Specialists ²⁵ Road Services → Road Transport ⁴⁰⁰	roadside assistance ²¹¹ tire ¹⁹⁷⁵ vehicle ³⁷⁴³ shop ⁶⁴⁸³ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dedrieeendekens.nl	Brewery "De Drie Eendekens"	The website of Brewery "De Drie Eendekens" presents the history and craft production of their craft beers.	Beer → Craft Beer ¹⁹⁹ Beer → Breweries ³³⁷	brewery ⁴⁹⁸ passion ⁷⁹² craftsmanship ¹⁸⁵⁸ beer ²⁸⁸⁷ history ⁷²⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vipspa.nl	V.I.P. Spa	The website of V.I.P. SPA offers a luxury private sauna complex with a swimming pool and sauna for rent in Stolwijk, South Holland, where visitors can relax and enjoy undisturbed.	Spa → Saunas ⁹²⁰ Spa → Wellness Centers ²³⁸	steam room ¹³ whirlpool ⁵⁴ complex ⁵⁶⁸ sauna ¹¹⁷⁵ swimming pool ¹⁶⁶⁴	Krimpenerwaard → Stolwijk ²³²
archeologie-krimpenerwaard.nl	Stichting Archeologie Krimpenerwaard	This website of the Stichting Archeologie Krimpenerwaard (SAK) provides information about the foundation's activities, its objectives, its governance structure, and its annual financial reports.	Museums & Collections → Archaeology ²⁹¹	policy plan ¹¹⁴ archaeology ²⁵⁶ excavation ³⁸² lecture ¹⁶²⁴ exhibition ⁵³³²
bloemen-wonenbijliza.nl	Liza Workshops, Wonen & Groenstyling	The website of Liza Workshops, Wonen & Groenstyling is a flower and home shop offering a variety of products and services, including country-style home accessories, handmade green decorations, and flower styling workshops.	Crafts → Floral Design ²⁴¹ Decor & Furnishings → Wall Decor ¹⁰³⁵	flower arrangement ¹⁰⁷ home accessories ⁶⁰³ shop ⁶⁴⁸³ workshop ¹⁹³²⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
landwinkelspeksnijder.nl	Kaasboerderij Speksnijder	The website of Kaasboerderij Speksnijder showcases a family farm producing and selling cheese and dairy products in the Krimpenerwaard region, with a focus on traditional cheeses, corporate gifts, and a welcoming atmosphere.	Dairy → Cheese ⁵³⁰ Food → Local & Regional Products ⁹³⁰	corporate gift package ⁴⁴ dairy ²⁷⁴ milk ⁴²¹ cheese ¹²⁰⁵ online shop ¹³¹⁰ agenda ⁴³⁷⁴	Krimpenerwaard → Lekkerkerk ²⁴⁴
hoteldeals.nl	Hoteldeals B.V.	The website Hoteldeals.nl offers an overview of hotel deals and offers.	TravelBrands → Deals ³⁴⁹ Events → Weekend Getaways ¹⁰⁶	weekend ³⁸³ deals ¹⁰⁷⁰ destination ²⁵⁸⁰ hotel ³⁵⁴³ theme ⁴⁰¹⁵ accommodation ⁴⁹²¹	The Hague → Scheveningen ¹⁶²⁵
rederijthalassa.nl	Rederij Thalassa	Partyschip Thalassa provides a location for business and private parties and events.	Water Travel → Boat Tours ⁶⁴⁰ Water → Boating ¹⁵⁹²	voyage ⁵⁴ ship ⁵¹⁰³ atmosphere ⁵⁵⁹¹ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
arnouddejongmakelaardij.nl	Arnoud de Jong Makelaardij B.V.	The website of Arnoud de Jong Makelaardij B.V. aims to facilitate real estate transactions – sale, purchase, and rental – in the Krimpenerwaard and surrounding areas. It provides an overview of available properties and plots, valuation services, and the ability to place search requests.	Property Finance → Buying ²⁵⁴ Real Estate → Property Search & Listings ⁵⁰⁶	nvm ⁴³ purchase ²²¹² valuation ²⁶⁹⁷ office ²⁸⁹⁸ sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Krimpenerwaard → Berkenwoude ⁶²
bramsrabbits.nl	BramsRabbits	BramsRabbits is a hobby breeder offering Dutch Hangoordwergs/Minilops and French Hangoors for sale and breeding.	E-Commerce → Pet Supplies ¹⁰¹³ Environment → Animals ¹³⁷⁶⁴	socialization ¹³⁷ rabbit ²⁹¹ farm ²⁶²²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
boschinterieur.nl	Chris van den Bosch \| Interieur en montage	The website of Chris van den Bosch \| Interieur en montage showcases a portfolio of interior design and assembly projects, aimed at both private and business clients.	Storage → Cabinets ⁶¹² Renovation & Restoration → Interior Renovation ⁸⁷⁹	wall unit ²³ fireplace ⁷⁵² bedroom ²⁰⁵¹ bathroom ³⁷⁸⁴ kitchen ⁶⁴⁴³ interior ⁸⁰⁹³	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
josedonatzafscheidsfotografie.nl	José Donatz Afscheidsfotografie	The website of José Donatz Afscheidsfotografie offers professional photo recordings of funerals, aiming to help bereaved families honor and capture the farewell of a loved one.	Death → Funerals ⁵⁵²	farewell photography ¹³ photo report ⁵⁶ funeral ²⁴⁷⁷	Krimpenerwaard → Bergambacht ³⁰³
globalsmartshipping.nl	Nederlandse Expeditievoorwaarden	The website offers an online platform that allows businesses to easily and cost-free book international and national shipments by comparing different carriers.	Software → Online Services & Platforms ⁷³⁵ E-Commerce → Marketplaces ¹⁰⁵³	carrier ¹⁴² shipment ⁷⁰⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sluyk.nl	Sluyk	The website of Sluyk offers a comprehensive selection of kitchens, bathrooms, and building materials, emphasizing personalized service and DIY support.	Storage → Cabinets ⁶¹² Health → Resources ³⁸	diy ⁴⁴³ building materials ⁴⁸⁶ bathroom ³⁷⁸⁴ showroom ⁴⁸⁸³ kitchen ⁶⁴⁴³	Krimpenerwaard → Lekkerkerk ²⁴⁴
aenbglaszetters.nl	A&B Glaszetters	The website of A&B Glaszetters in Schoonhoven presents the company as a specialist in glass supply and installation, catering to both private and professional customers, with a focus on new construction projects and specialized glass products such as double glass and monument glass.	Windows → Glazier ⁴⁴⁰ Insulation → Glazing ¹⁸⁸	monument glass ¹¹ ventilation grille ²¹ double glass ³⁹ new construction ²⁶⁷² glass ²⁹¹⁹ warranty ⁴⁷⁰¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
joolingen.nl	Van Joolingen B.V.	The website of Van Joolingen Bouw presents the company as a specialist in plastic frames and related building materials and services, targeting private and business customers in the region of Gouda and Krimpenerwaard.	Frames → Plastic Frames ³⁴⁰ Windows → Plastic Windows ¹³²	greenhouse ⁷⁴⁰ skylight ⁹⁶⁶ plastic ¹²³² frames ²⁵⁵⁶ renovation ¹³⁸⁴⁹	Krimpenerwaard → Stolwijk ²³²
minicampingdebulte.nl	Mini camping “De Bulte”	The website for Mini camping ‘De Bulte’ provides information about a quiet campsite located near Hoogeveen and the Dwingelerveld. The campsite offers various facilities and serves as a base for nature lovers and cyclists.	Camping → Farm Camping ³⁸⁶ Camping → Camper Sites ²⁴³	amenities ³⁶³ surroundings ⁴⁶³ nature area ⁴⁹⁷ campsite ²⁰⁹³ rate ²⁶⁰⁶ holiday home ²⁷⁵³	Hoogeveen → Tiendeveen ³⁶
marketingkaart.nl	Marketingkaart	The website, Marketingkaart, provides an overview of 500+ Dutch marketing professionals and helps users quickly find a marketing agency that meets their needs.	Online Marketing → Affiliate Marketing ²⁹⁹ Business Development → Business Marketing ⁶¹⁴	marketer ⁴² compare ⁵⁸² agency ⁹⁴⁴ marketing ⁷¹⁰⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
vdbhwest.nl	VDBH West	The VDBH West website describes a company specializing in the design, landscaping, and maintenance of outdoor spaces for various organizations, with a focus on biodiversity and creating enjoyable environments for users.	Green Spaces → Green Maintenance ⁴⁴⁹ Green Spaces → Green Management ⁹⁶	green maintenance ⁷⁷ outdoor space ²⁴⁶ biodiversity ⁷²⁰ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
faaywonen.nl	Faay Wonen & Slapen	Faay Wonen & Slapen is a home decor and sleeping solutions store located in the region of Woerden, Gouda, and Schoonhoven.	Bedding → Mattresses ⁴⁰² Beds → Boxsprings ²²⁹	dream ⁸⁸³ bedroom ²⁰⁵¹ style ²³⁴⁸ interior ⁸⁰⁹³ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
deknikkerpot.nl	Speel-o-theek "De Knikkerpot"	The website of Speel-o-theek "De Knikkerpot" in Lekkerkerk provides information about borrowing toys, games, and other materials, as well as news and volunteer opportunities.	Games → Board Games ⁴¹⁶	lending ³⁴ facebook ⁸⁵⁰ toy ²²⁹⁵ game ²⁸⁰⁷ volunteer ⁸³⁶⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
taxicentraleappie.nl	Taxicentrale Appie	The website of Taxicentrale Appie in Gouda offers reliable and affordable taxi and transportation services, both locally and to international destinations via Schiphol Airport, and serves specific transportation needs such as school transportation and business travel.	Taxi & Ride Services → Taxi ¹⁰⁶² Specialized Transport → Business Transportation ²³¹	taxi ²⁰⁹⁰ rate ²⁶⁰⁶ transportation ²⁸⁵¹	Krimpenerwaard → Bergambacht ³⁰³
nana.nl	NANA Groen-Wonen	The website of 'NANA Groen-Wonen' is a florist shop offering a wide range of flowers, plants, and related items, specializing in occasion flowers, funeral flowers, bridal flowers, and corporate flowers, located in Bergambacht.	Flowers → Florists ¹⁴¹⁰	bridal ⁹⁶ pottery ¹⁵² facebook ⁸⁵⁰ funeral ²⁴⁷⁷ flowers ³²⁴⁸ home ⁷⁹⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
goudenzilversmidsgilde.nl	Goud- en Zilversmidsgilde Sint Eloy	The website of the Goud- en Zilversmidsgilde Sint Eloy presents the history, members, and activities of this gild, which represents over 30 craftspeople and organizations in Schoonhoven and is committed to quality and sustainable craftsmanship.	Jewelry → Goldsmiths ³¹⁹ Historical Associations → Guilds ⁴⁸	guild ¹⁴⁷ silver ⁴⁷⁹ craftsmanship ¹⁸⁵⁸ jewelry ⁴⁵⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
allebij.nl	Partyservice Allebij	Partyservice Allebij is a catering service specializing in events and parties in the Krimpenerwaard region.	Social & Events → Party Services ¹⁸⁷ Catering → Buffets ²⁷⁷	oven dish ¹⁶ high tea ⁵⁸⁵ bbq ⁹⁰⁸ cake ¹⁷³⁰ buffet ¹⁷⁴⁷ sandwich ⁴⁰⁹⁸
blijvendehulpvoorroemenie.nl	Stichting Blijvende Hulp voor Roemenië	The website of Stichting Blijvende Hulp voor Roemenië describes the organization, its history, projects, and goals in Romania.	Social Organization → Humanitarian Organizations ¹¹³⁵ Physical Health → Rehabilitation ¹⁰⁰⁹	romania ⁷² donation ⁵¹¹⁰ foundation ⁶⁶⁷⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
accountantkaart.nl	Accountantkaart	The website Accountantkaart presents a top 500 of Dutch accountants.	Apps → Business Apps ¹⁰ Accounting → Service Providers ⁶³	accountant ⁶¹¹ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
hetkoetshuispartyservice.nl	Het Koetshuis Party- en Cateringservice	The Koetshuis Party and Catering Service offers a wide range of party and catering services for various occasions.	Social & Events → Party Services ¹⁸⁷ Venues → Halls ⁴¹⁹	hall ¹⁷⁸⁶ meeting ²³⁸¹ wedding ⁴²⁵⁸ party ⁵⁹²⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bakkerij-kok.nl	Bakkerij Kok Schoonhoven	The website of Bakkerij Kok Schoonhoven describes the bakery, its history, and the products and services offered, including bread, pastries, cakes and catering.	Bakery & Food Production → Specialty Bakeries ⁴⁴ Parties → Birthday Parties ¹⁰⁰⁸	bread ¹⁶²² cake ¹⁷³⁰ sandwich ⁴⁰⁹⁸ party ⁵⁹²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
keurtekens.nl	Keurtekens	The Keurtekens.nl website provides information about hallmarks, master hallmarks, importer's marks, and responsibility marks used in gold, silver, and platinum, focusing on the Guarantee Act and the CCM convention. The website also offers information about testing gold and silver and the meaning of year letters.	Investing → Precious Metals ³²⁶ Government & Administration → Legislation ⁴³²	hallmark ²³ silver ⁴⁷⁹ gold ⁸⁰⁵	De Fryske Marren → Joure ⁶⁸⁹
ontstoppingsservicenederland.nl	OSN Drain Cleaning	This website offers professional drain cleaning services in Haarlem and surrounding areas, including emergency assistance, pipe repair, and more.	Plumbing → Drain Cleaning ⁷⁴⁵	septic tank ²⁷ drainage system ⁹⁸ drain ⁸⁸⁶ cleaning ⁴⁵⁶⁷	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
bobdenboer.nl	DitchWitch B.V.	The website describes the activities of a company specializing in horizontal drilling underground, primarily between cables and pipelines in the Netherlands.	Construction Technology → Drilling ⁷¹	pipeline ²⁰⁴ drill ³⁰³ cable ⁷³² machine ³⁷²⁷	Krimpenerwaard → Bergambacht ³⁰³
kerstaanbieding.nl	Kerstaanbieding.nl	The website offers Christmas packages and hotels, with the option for booking and a custom quote.	Christmas → Christmas Markets ¹⁶⁴	christmas package ²³ destination ²⁵⁸⁰ hotel ³⁵⁴³ book ¹¹³⁹⁶	Raalte → Luttenberg ⁵³²
werkenbijozhw.nl	Onderwijsgroep OZHW	The website of OZHW (Onderwijsgroep OZHW) provides information about its schools, job vacancies, and opportunities for lateral entry, aiming to attract staff and showcase the educational institutions.	Primary Education → School Districts ²⁷	internship ⁶⁹⁴ mission ¹⁰⁰⁰ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	South-Holland → Barendrecht ¹⁶⁵³
wandelarrangement.nl	Wandelarrangement.nl	The website Wandelarrangement.nl offers walking tours in the Netherlands and Belgium, featuring hotel arrangements in beautiful locations.	United States → New York ³⁶ Accommodation → Resorts ²²⁹	tours ¹⁰⁴⁸ destination ²⁵⁸⁰ arrangement ³¹⁰⁴ reservation ³³⁷³ hotel ³⁵⁴³ quote ¹²⁸⁶³	Drimmelen → Made ³³⁵
fietsarrangement.nl	Fietsarrangement	The website provides information and booking options for various cycling arrangements in the Netherlands and Germany, including themed arrangements, day trips, and vacations.	Europe → France ¹⁰⁴¹ Cycling → Cycling Holidays ²⁹⁵	germany ¹⁸⁵ netherlands ¹³⁷⁶ cycle ¹⁹⁰⁶ arrangement ³¹⁰⁴	Drimmelen → Made ³³⁵
dietistenpraktijkkuiperbesten.nl	Dietistenpraktijk De Kuiper & Den Besten	The website of Dietistenpraktijk De Kuiper & Den Besten is a practice offering nutrition advice and treatment plans for various health issues and lifestyle questions, with a focus on personalized guidance and flexible appointments.	Medical Care & Services → Nutrition ⁵⁷⁹⁹ Health → Disease & Treatment ⁴⁸⁰⁵	treatment plan ³⁸⁰ diet ⁷⁴⁷ lifestyle ²⁹¹⁸ practice ⁹⁰⁸⁹	Krimpenerwaard → Bergambacht ³⁰³
tropicanaspa.nl	Tropicana Spa	The website of Tropicana Spa presents a luxurious private sauna complex in South Holland, offering renters the opportunity to relax privately in a pool complex with various facilities.	Spa → Saunas ⁹²⁰ Spa → Wellness Centers ²³⁸	private ¹⁶⁸ complex ⁵⁶⁸ sauna ¹¹⁷⁵ pool ¹⁵³² facility ²⁶¹⁶	Krimpenerwaard → Stolwijk ²³²
bijaafke.nl	Bij Aafke	Bij Aafke is a florist in Krimpen aan de Lek specializing in delivering bouquets, floral arrangements, and creative workshops.	Flowers → Florists ¹⁴¹⁰ Gifts & Occasions → Flower Shops ⁷⁷⁶	bouquet ¹¹⁴⁷ arrangement ³¹⁰⁴ flowers ³²⁴⁸ workshop ¹⁹³²⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
defietsengroothandel.nl	De Fietsengroothandel	De Fietsengroothandel is an online store and brick-and-mortar bike shop offering a wide range of new and used bicycles, parts, and accessories.	Motorcycles → Scooters ⁹⁰³	shopping cart ¹⁵²¹ bike ¹⁵⁴¹ part ⁵⁰⁴⁴	Krimpenerwaard → Gouderak ¹⁰³
rondevanlekkerkerk.nl	Stichting Wielercomité Lekkerkerk	The website of the Rabo Ronde van Lekkerkerk presents information about the annual cycling race held in Lekkerkerk, including news, program, participants, photos and winners.	Cycling → Cycling Races ²⁰⁶ Holidays & Commemorations → National Events ⁴⁹	race ¹⁰⁴³ cycle ¹⁹⁰⁶ participant ¹⁹³⁴ sponsors ²⁶⁴²	Krimpenerwaard → Lekkerkerk ²⁴⁴
schoonhovenklassiek.nl	Stichting Schoonhoven Klassiek	The Stichting Schoonhoven Klassiek organizes a variety of music events, including the Oude Haven Concert, the MuziekFabriek, and the Springerpark Concerts, in Schoonhoven, aiming to provide music experiences for the local community and visitors.	Theater → Play ⁴⁵ Music → Classical Music ¹⁰¹⁵	concert ⁴⁴⁰⁹ music ¹³¹⁷⁰ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
elsvandenboogaard.nl	Els van den Boogaard	The website of Els van den Boogaard showcases her paintings and provides an overview of past exhibitions. It offers insight into her artistic portfolio and the locations where her works have been displayed.	Painting → Oil Painting ³²⁶ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	oil painting ¹⁹ abstracts ²⁸ acrylic ⁵⁰⁶ landscape ²⁶⁰⁹ paintings ³⁹⁰⁷ exhibition ⁵³³²	Krimpenerwaard → Bergambacht ³⁰³
bvkrimpen.nl	Basketbal Vereniging Krimpen	The website of Basketbal Vereniging Krimpen (BVK) provides information about the basketball association, its teams, training schedules, events, and membership details.	Basketball → Basketball Associations ¹⁴	basketball ¹⁷⁵ match ³⁴⁷¹ membership ¹⁰⁴⁴² training ²⁸¹³³	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
easykassa.nl	EasyKassa.nl B.V.	The website presents the EasyKassa horeca software and a list of restaurants and cafes that use this software.	Security → Antivirus ¹⁶ Water Sports → Water Recreation ⁵⁹⁹	instruction ³²⁶ license ¹²⁸⁸ cafe ¹⁶²² software ⁸²⁹¹ restaurant ¹¹²¹⁵	Berg en Dal → Groesbeek ⁶⁵³
visspecialiststruik.nl	Visspecialist Struik	The website of Visspecialist Struik Werkendam offers a range of fresh, baked, and smoked fish, ready-made meals, and barbecue packages, and provides these products at various locations in the region.	Fish & Seafood → Fish ³⁸⁸ Restaurants & Dining → Seafood Restaurants ⁶¹²	fish ¹¹²¹ lunch ¹⁵³⁴ meal ¹⁶³⁸ recipe ⁵¹⁴² assortment ⁷⁷⁹⁹	Hardinxveld-Giessendam → Boven-Hardinxveld ⁸³
cjgkrimpenerwaard.nl	Centrum voor Jeugd en Gezin Krimpenerwaard	The Centrum voor Jeugd en Gezin Krimpenerwaard provides information and support regarding child-rearing and development for parents.	Family → Parenting ¹³¹⁶	teenager ¹⁵⁹ webinar ⁸⁷⁰ parenting ⁹⁷² meeting ²³⁸¹
polderruimte.nl	The Polderruimte	The Polderruimte is an inspiring space located in the Green Heart of the Krimpenerwaard that offers space for meetings, training, courses and gatherings.	Nature → Estates ⁷⁷¹ Environment → Agriculture ¹¹¹⁶⁰	opportunity ⁵⁸¹ hospitality ³⁴⁹¹ space ³⁸⁴⁶ inspiration ⁴⁰⁸¹	Krimpenerwaard → Berkenwoude ⁶²
cdtkeukenmontage.nl	CDT keukenmontage	CDT keukenmontage is a kitchen, bathroom and toilet assembly company specializing in the installation and fitting of kitchens, bathrooms and toilets, as well as associated preparation and renovations.	Home Improvement → Heating Systems ⁶⁰⁴	assembly ¹⁷³³ showroom ⁴⁸⁸³ kitchen ⁶⁴⁴³ quote ¹²⁸⁶³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
degoudmeule.nl	Smederij de Goudmeule	The website of Smederij de Goudmeule showcases the work of goldsmith and silversmith Lien van der Meulen, her jewelry collection, and information about workshops.	Precious Metals → Gold ¹⁷⁴ Visual Arts → Museums ²⁰⁴⁹	silver ⁴⁷⁹ ring ⁸⁰⁰ gold ⁸⁰⁵ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hvonsbelang.nl	Huurdersvereniging Ons Belang	The Huurdersvereniging Ons Belang is a tenant association representing the interests of tenants of the housing corporation QuaWonen, providing information and updates on ongoing projects and activities.	Rental Properties → Tenant Associations ³⁵¹ Homeownership & Management → Housing Corporations ⁴²⁶	tenant association ⁵⁹ annual report ⁸⁷⁷ plan ²⁵⁶⁶ new construction ²⁶⁷²	Hardinxveld-Giessendam → Boven-Hardinxveld ⁸³
meesters.nl	Meesters Makelaardij	Meesters Makelaardij is a real estate agency located in Oudewater, Haastrecht, and surrounding areas, specializing in the sale, purchase, rental, and valuation of residential and commercial properties.	Real Estate → Property Valuation & Appraisal ²¹²³	listings ⁵²⁵ transaction ⁶¹³ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶ network ¹¹¹²³	Krimpenerwaard → Haastrecht ¹⁹³
iskgouda.nl	ISK Gouda	The website of ISK Gouda presents information about the school, its activities, and services, and offers registration opportunities.	Elementary Schools → Christian Primary Schools ³⁴² Primary & Secondary Schooling → Educational Settings ²⁹	language ²⁰¹⁶ municipality ⁶⁸³⁷ student ⁷⁶²³ school ⁷⁸⁵⁶	South-Holland → Zuidplas ¹¹²²
bramherens.nl	Bram Herens	The website of visual artist Bram Herens showcases his work, particularly egg tempera paintings and oil paintings, and offers a glimpse into the family history of the Van Merwede Van Muilwijk family, starting with the ruins of Alteena and Merwe.	Social Sciences → Genealogy & Family History ¹⁴⁰³ Painting → Oil Painting ³²⁶	ruin ¹⁷ family history ¹²⁶ landscape ²⁶⁰⁹ paintings ³⁹⁰⁷ artist ⁵⁷⁴⁵	Altena → Almkerk ¹⁵⁹
oudehavenconcert.nl	Stichting Schoonhoven Klassiek	The website of the Oude Haven Concert in Schoonhoven provides information about the annual outdoor concert taking place on August 30, 2025, including a description of the program and the musicians.	Music → Classical Music ¹⁰¹⁵ Festivals → Local ³¹	stichting ⁴⁸¹ musician ¹²⁰⁷ concert ⁴⁴⁰⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kerstinmenge.nl	Stichting Jacques van Mourik	The website showcases the artwork, exhibitions, and education of artist Kerstin Menge.	Periodical Publications → Magazines ¹⁰⁰¹	academy ⁵⁹³ translation ¹⁵²³ artwork ²²⁴⁸ exhibition ⁵³³² artist ⁵⁷⁴⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dierenartspraktijkhaastrecht.nl	Dierenartspraktijk Haastrecht (DAP Haastrecht)	Dierenartspraktijk Haastrecht is a veterinary practice providing medical care for various pets.	Animals → Animal Care ¹⁸⁴⁹ Animals → Veterinarians ⁸¹³	veterinary practice ⁷¹ veterinarian ⁸⁶⁴ pet ¹⁶¹⁷ practice ⁹⁰⁸⁹ appointment ¹³⁵¹⁰	Krimpenerwaard → Haastrecht ¹⁹³
baskoster.nl	Bas Koster	The website of Bas Koster provides information about his activities as an organist, teacher, and organizer of musical events, with a focus on organ concerts and music lessons.	Organ Music → Organists ³⁹ Instrument → Organs ¹⁷⁷	organist ¹¹¹ organ ⁶³³ teacher ²⁸⁹⁰ concert ⁴⁴⁰⁹ lesson ⁵¹⁵⁴	Oudewater → Hekendorp ²⁸
jazzincatstown.nl	jazzincatstown	The website publishes local news from various municipalities in the Netherlands.	Local Politics → Parties ⁶²² Local Politics → Dutch Municipalities ²⁵	economy ⁶⁸² health ⁶³⁶⁶ municipality ⁶⁸³⁷ nature ⁹⁰⁹⁴ news ¹⁵²⁹³	Zuidplas → Moerkapelle ²¹³
goudsvirtueelsluizenmuseum.nl	Stads Historisch Museum Gouda	This website is a virtual museum dedicated to the locks of Gouda and the surrounding areas.	Local History → Dutch History ¹⁰⁶⁷ Outdoor Adventures → Walking ¹²⁶⁰	harbour ²⁹ waterway ¹²⁰ windmill ²⁴⁹ locks ⁹⁵³	Zuidplas → Moordrecht ³³²
nsdmh.nl	Joint Municipality Youth and Welfare Mid-Holland	The website of the Joint Municipality Youth and Welfare Mid-Holland (GR JW) provides information on the social domain in the region of Mid-Holland, including healthcare, support, contracts, financial accountability, and contact information. The website serves as a central point for residents and providers.	Local Politics → Governing Bodies ²⁰⁰ Government & Administration → Regional Government ³⁶⁷	social domain ²²⁵ healthcare provider ⁴⁷⁴ healthcare ²³¹⁶ contract ²⁴¹⁵ report ⁴⁵⁵¹	South-Holland → Zuidplas ¹¹²²
wonenindekrimpenerwaard.nl	Wonen in de Krimpenerwaard	The website Wonen in de Krimpenerwaard is a portal connecting prospective tenants with the housing stock of various housing corporations in the Krimpenerwaard municipality. It provides options for registration, saving housing preferences (via WoonWens), and viewing available housing.	Homeownership & Management → Housing Corporations ⁴²⁶ Property Purchase → House Hunting ¹⁰	corporation ⁸³ filter ⁴⁸⁷ stock ¹¹⁵⁴ housing ⁴³⁷⁸
excelsiorouderkerk.nl	Muziekvereniging Excelsior	The website of Muziekvereniging Excelsior from Ouderkerk aan den IJssel provides information about its orchestras, courses, members, and historical activities.	Orchestras → Fanfare Orchestras ²⁴⁴ Associations & Societies → Music Associations ¹⁰⁰³	jubilee ²⁴⁴ orchestra ¹³¹⁵ history ⁷²⁸⁶ photo ⁷⁷⁷⁸ course ¹⁴⁷²⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
aannemersbedrijfklapwijk.nl	Klapwijk Aannemersbedrijf	Klapwijk Aannemersbedrijf is a construction company specializing in new construction, extensions, renovations, maintenance, and remodeling of residential and commercial buildings.	Construction Companies → Additions ⁴⁵⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	extension ¹⁹⁴¹ new construction ²⁶⁷² roofing ²⁸⁰⁶ tile ²⁸⁶⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
abcbeveiliging.nl	ABC Beveiliging	ABC Beveiliging is a key and lock specialist offering services in the Leiden region and surrounding areas, including key repair, lock installation, burglary damage repair, and security solutions.	Security Systems → Lock Systems ¹²⁴ Personal & Household → Household Services ¹⁰⁵⁰	keys ³⁷⁰ locks ⁹⁵³ security ⁶⁶⁵⁵ repair ¹⁴⁵⁷⁶	Noordwijk → Noordwijkerhout ¹⁰⁹⁹
brasserierhoonsepolder.nl	Brasserie Rhoonse Polder	The website of Brasserie Rhoonse Polder provides information about the brasserie, its facilities, menu, and events, and serves as a means of making reservations and contacting them.	Brasseries & Bistros → Brasserie ¹⁰⁰⁵ Cycling → Cycling Routes ¹⁰⁰²	golf ³¹⁹ nature reserve ³³⁹ reservation ³³⁷³ terrace ⁴⁸⁴⁷ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
fantastels.nl	Fantastels	The website fantastels.nl is a platform for an annual writing competition for stories in the genres horror, fantasy, and science fiction, with a focus on announcing the winners and organizing an awards ceremony.	Communication → Writing ²⁹⁵⁴ Online → Net ¹⁶	award ceremony ²⁴ winner ¹⁹⁰ participant ¹⁹³⁴ story ⁸²⁸⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
zangeralex.nl	Alex	The website of Alex, a Dutch party artist, presents his event schedule, music releases, and an overview of his 25-year anniversary show. It also provides information about events where he performs.	Popular → Pop ²⁹⁹ Theater → Performances ⁶⁴⁹	playlist ²³¹ schedule ²⁶²⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
bosmechanisatie.nl	Bos Mechanisatie	Bos Mechanisatie is a company specializing in the repair, maintenance, and sale of agricultural machinery and machines.	Logistics → Transportation ¹¹⁰² Trade → Agricultural Trade ⁹⁷	earthmoving machines ³³ agricultural machinery ¹⁶⁹ tractor ⁷⁸⁹ machine ³⁷²⁷ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Stolwijk ²³²
bergambachtoptiek.nl	Bergambacht Optiek	Bergambacht Optiek is an optician specializing in personalized eye care services.	Specialty Medicine → Optometry ⁵³⁹ Services → Opticians ⁵⁵¹	eye measurement ²³² eye care ²³³ eyeglasses ⁴³⁷ contact lenses ⁵³⁸ appointment ¹³⁵¹⁰	Krimpenerwaard → Bergambacht ³⁰³
fibernow.nl	FiberNow	The FiberNow website provides fiber optic connectivity solutions for both residential and business customers in the Netherlands.	Broadband → Fiber Optic ¹¹² Internet → Fiber Optic Internet ¹⁰⁰	fiber optic ²⁷⁹ voip ⁴²⁵ internet ¹⁶⁷⁸ data ⁵⁸⁷²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
afentoe-kunstroute.nl	Af en Toe Kunstroute	The website of the Af en Toe Kunstroute provides information about the annual art route that takes place in the Alblasserwaard region, including route maps, event details, and an overview of participating artists.	Galleries & Exhibitions → Art Routes ²¹⁵ Art & Culture → Art Events ³²⁷	route map ³⁷ art route ¹⁵³ ferry ¹⁷⁹ artist ⁵⁷⁴⁵	Molenlanden → Groot-Ammers ¹⁵⁸
bzc-bergambacht.nl	BZC Bergambacht	The website of BZC Bergambacht provides information about the water polo club, including membership details, sporting activities, swimming lessons, and contact information.	Sports Clubs → Water Polo ²¹⁹ Swimming → Swimming Clubs ²⁴²	swimming lesson ³⁹³ match ³⁴⁷¹ webshop ⁸⁶⁴⁸ membership ¹⁰⁴⁴²	Krimpenerwaard → Bergambacht ³⁰³
pietervanderhoog.nl	None	The website is dedicated to the life of Captain and Shipowner Pieter van der Hoog (1835-1906) and provides information about his ships, the history of seafaring, and the J&K Smit shipyard in Krimpen aan de Lek.	Social Sciences → Genealogy & Family History ¹⁴⁰³ Marine & Watercraft → Shipping ⁶⁵⁴	shipyard ¹³⁰ genealogy ⁵⁴³ biography ⁶⁹⁷ ship ⁵¹⁰³ history ⁷²⁸⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
raedthuys-haastrecht.nl	Stichting ‘t Raedthuys	The website of ‘t Raedthuys in Haastrecht presents the former town hall as a restaurant, event space, and meeting room, providing information about events and vacancies.	Architecture & Sites → Historical Sites ¹⁹⁵¹ Fine Dining & Gastronomy → Dining ⁶⁷⁷	town hall ⁶² wedding venue ⁹¹ meeting room ⁶⁸⁵ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
miekekettler.nl	Mieke Kettler	The website of Mieke Kettler showcases the work of the visual artist, focusing on her etching techniques, exhibitions, and publications.	Personal → Biographical ⁴⁴ Graphic Design & Printing → Graphic Arts ¹⁰³⁴	etching ⁴⁸ exhibition ⁵³³² collection ⁷⁵⁶⁶	Katwijk → Katwijk-North ²⁴
hetatelier.nl	Atelier Terhorst	The Atelier Terhorst website showcases the projects and services of the studio, specializing in the reconstruction and restoration of decorative paintings in historic interiors, including gold leafing, wood and marble imitations, and advisory services for restoration projects.	Instrument → Organs ¹⁷⁷ Context ¹⁶¹³⁹⁴	decorative ²⁸ organ ⁶³³ restoration ³⁴¹⁷ paintings ³⁹⁰⁷ interior ⁸⁰⁹³	Krimpenerwaard → Haastrecht ¹⁹³
recreatieparkdenes.nl	Rustpoint in the Green Heart Recreation Park	The recreational park offers a peaceful holiday destination in the Krimpenerwaard, with facilities for recreation, entertainment and cultural attractions in the surrounding area.	Landscape → Polders ²¹² Accommodation → Cottages ²⁹⁸	mill ⁴⁸⁷ chalet ¹²⁶⁴ caravan ¹³⁹⁴ animation ¹⁷⁷⁷ cycle ¹⁹⁰⁶	Molenlanden → Kinderdijk ¹⁵⁸
boerderijvanmeijeren.nl	Boerderij van Meijeren	The website of Boerderij van Meijeren presents the dairy and poultry farm of Willem and Elsbeth van Meijeren, as well as the opportunity to purchase fresh chicken from the meat vending machine.	Livestock → Dairy Farming ⁶⁷¹	dairy farm ¹²⁹ poultry ¹⁸⁰ chicken ⁹⁴⁴ farm ²⁶²²	Krimpenerwaard → Haastrecht ¹⁹³
advanpelt.nl	Ad van Pelt	This website provides an archive of information about organs and organ concerts, with a focus on the Utrecht region and Woerden, including organ builders, restorations, and organists.	Church & Religious → Organ Music ²¹² Instrument → Organs ¹⁷⁷	ensemble ⁵⁴⁶ organ ⁶³³ concert ⁴⁴⁰⁹	Bodegraven-Reeuwijk → Waarder ⁶⁸
koel-ijs.nl	De Marketing Express	The website showcases artisanal ice cream, ice buckets and ice cakes, with unique flavors and festive options, and offers a rental of the KOEL-cart for events and parties.	Chocolate & Sweets → Ice Cream ⁷⁷⁴	ice cake ⁴¹ ice cream ¹⁰⁰⁰ flavor ¹⁰³² holiday ²²⁹⁵	Krimpenerwaard → Haastrecht ¹⁹³
shirtprintservice.nl	't Vaartland	Shirtprintservice.nl is an online shop offering personalized clothing and accessories, including workwear, sportswear, event shirts, and promotional clothing. The site also provides options for designing custom apparel and sells merchandise related to various sports teams and events.	Clothing → Activewear ⁶⁴² Clothing → Workwear ¹⁰⁰¹	promotional clothing ⁸⁴ sportswear ³⁵² t-shirt ⁶⁹⁸ merchandise ¹⁰⁶¹ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵	Gooise Meren → Bussum ²²⁰¹
liselotsartandtherapies.nl	Liselot’s Arts & Therapies	The website of Liselot’s Arts & Therapies offers various forms of artistic therapies and coaching, aimed at processing emotional and physical complaints, particularly related to chronic pain, stress, burnout, and long covid.	Alternative Medicine → Orthomolecular Medicine ³⁴⁰ Education → Special Needs & Support ⁶³⁷²	long covid ⁴² intake ⁴⁶⁷ art ³⁸⁵⁶ family ⁶⁴⁶² therapy ⁷⁴⁴⁸	Krimpenerwaard → Haastrecht ¹⁹³
vvbodegraven.nl	vv Bodegraven	The website of vv Bodegraven provides information about the football club, including news, schedules, team details, membership information, sponsorship details, and photos.	Clubs → Dutch Clubs ²⁰⁰ Sports Associations → Dutch Sports Associations ⁵³	sponsorship ²⁶⁸⁶ match ³⁴⁷¹ photo ⁷⁷⁷⁸ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Montfoort → Linschoten ¹⁶⁹
vgbk.nl	Gemeente Belang Krimpenerwaard (VGBK)	The website of Gemeente Belang Krimpenerwaard (VGBK) provides information about local politics, municipal decisions, news, and activities within the municipality of Krimpenerwaard.	Local Politics → Parties ⁶²²	politics ¹²⁵⁹ initiative ¹²⁹⁷ regulation ¹³⁵⁰ municipality ⁶⁸³⁷ news ¹⁵²⁹³
gergemberkenwoude.nl	Gereformeerde Gemeente Berkenwoude	The website of the Gereformeerde Gemeente Berkenwoude provides information about the church, its services, history, faith, and activities.	Reformed → Church Organization ¹⁵⁵ Protestant Churches → Congregations ³⁰⁴	god ⁵¹⁵ mission ¹⁰⁰⁰ bible ¹²⁷⁶ church ³⁴³⁹ community ⁷⁹³¹	Krimpenerwaard → Berkenwoude ⁶²
de-ijsselmannen.nl	Shantykoor De IJsselmannen	The website of Shantykoor De IJsselmannen aims to inform visitors about the choir’s activities, members, upcoming events, and the possibility to become a sponsor.	Choir → Shanty Choir ⁴⁵ Ensemble → Vocal Groups ²²⁵	cd ⁵⁷⁴ repertoire ²⁴⁹⁷ photo ⁷⁷⁷⁸ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
veerdienstgouderak.nl	Veerdienst Schoonhoven BV	The Veerdienst Gouderak-Moordrecht website provides information about the ferry service connecting Gouderak and Moordrecht, including schedules, fares, and subscriptions.	Water Transportation → Ferries ¹²⁹ Marine & Watercraft → Ferry Services ¹²	fare ⁸⁶ pass ⁹² timetable ¹⁰⁷ ferry ¹⁷⁹ subscription ³²⁸⁷ board ³⁴³⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hetwittehof.nl	Donnie & Babette Diemel	The Witte Hof restaurant in Haastrecht offers a culinary experience, event possibilities, and a comfortable atmosphere.	Architecture & Sites → Historical Sites ¹⁹⁵¹	owner ⁵¹⁵ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
nnfsports.nl	NNF Sports	The website of NNF Sports describes the organization of football events, including summer camps and a business club, and invests in the development of young footballers.	Sports & Fitness → Sports Training ⁷¹¹ Initiatives & Projects → Organizations ²⁷⁵⁵	exercise material ¹⁵ summer camp ¹³⁹ youth ³¹²⁶ coach ²⁵⁸¹⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
fairtradegemeentekrimpenerwaard.nl	Municipality of Krimpenerwaard	The website of the working group for the municipality of Krimpenerwaard describes the activities of the municipality as a Fairtrade Municipality, including news, annual reports, and information on how to participate yourself.	Initiatives & Collaboration → Initiatives ⁴⁵⁹ Commerce → Fair Trade ¹⁹¹	fairtrade ²⁰⁰ village ⁸⁰⁸ campaign ³⁴²⁸ municipality ⁶⁸³⁷ news ¹⁵²⁹³
elmart.nl	OnlineGallery	The website of Elma Hoste showcases her paintings and artwork, along with information about her exhibitions and interviews.	Knowledge → Arts ³⁷⁷²⁵	art ³⁸⁵⁶ paintings ³⁹⁰⁷ exhibition ⁵³³² nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hetgebouwammerstol.nl	Eetcafé Het Gebouw	Eetcafé Het Gebouw is a restaurant, event venue, and pancake house located in Ammerstol that offers a diverse range of food, drinks, and activities.	Accommodation → Holiday Homes ⁷²⁷	pancake house ¹⁷ event venue ⁸⁶ wifi ¹³⁷² terrace ⁴⁸⁴⁷ association ⁸⁵⁶² restaurant ¹¹²¹⁵	Krimpenerwaard → Ammerstol ⁴⁹
deijsselborgh.nl	Restaurant de IJsselborgh	The website of Restaurant de IJsselborgh presents the restaurant, its menus, catering options and takeaway options, with a focus on a pleasant and flavorful culinary experience.	Fundraising & Charity → Party Packages ¹⁰ Food → Meat ¹¹²³	high tea ⁵⁸⁵ buffet ¹⁷⁴⁷ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Haastrecht ¹⁹³
schiltenuurwerkrestauratie.nl	Robert Schilten Uurwerkrestauratie	The website of Robert Schilten is a portfolio and information source for an antique clock and watch restorer and goldsmith, focusing on the conservation of the original condition and detailed knowledge of watchmaking techniques.	Historical & African Art → Historical Art ¹⁸ Antiques & Collectibles → Clocks ⁷⁶	clocks ¹⁷⁸ goldsmith ²²⁴ watch ¹¹⁶⁶ archive ²⁰⁶⁷ restoration ³⁴¹⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
amicitia-lekkerkerk.nl	Amicitia Lekkerkerk & Grand Café Roos	Amicitia Lekkerkerk & Grand Café Roos is a venue and catering business offering event space, hall rentals, catering services, and a restaurant.	Office Space → Rental Space ⁵³⁷ Venues → Halls ⁴¹⁹	grand café ⁹⁵ hall ¹⁷⁸⁶ wedding ⁴²⁵⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
stadswandelingschoonhoven.nl	Stichting Stadswandeling Schoonhoven	The website of Stadswandeling Schoonhoven provides information and booking options for guided city walks through the historic city of Schoonhoven, known as the Silver City.	Local History → Dutch History ¹⁰⁶⁷ Tourism → City Tours ⁴⁶⁸	fortification ²² craft ⁵³⁸ center ¹¹¹⁵ walk ²¹⁶¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wurks.nl	Wurks	The website of Wurks presents itself as a leading supplier of innovative, sustainable, and CO2-neutral raised floors and flooring.	Interior → Flooring ²⁷⁹¹	floor ⁴⁷⁸¹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Stolwijk ²³²
hillegondahoeve.nl	Dogterom Communicatie	The Hillegondahoeve in Stolwijk offers a tranquil setting for vacations, horse boarding, and experiencing ‘Boergoendisch’ (regional) cuisine.	Accommodation → Country Estates ⁷³⁸	holiday house ⁴⁰² cow ⁵⁹⁶ farm ²⁶²² horse ⁴³³⁷	Krimpenerwaard → Stolwijk ²³²
hoeksesluis.nl	Belevenisboerderij De Hoeksesluis	De Hoeksesluis is a farm experience farm offering hospitality, respect for nature and various activities.	Accommodation → Beds ²²⁸	farm ²⁶²² animal ²⁹⁰⁸ hospitality ³⁴⁹¹ accommodation ⁴⁹²¹ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
citybeatsschoonhoven.nl	City BEATS Schoonhoven	City BEATS Schoonhoven is a musical festival that brings together various music styles.	Festivals → Music Festivals ¹⁰²⁰ Events & Activities → Outdoor Activities ¹⁰⁴³	lineup ²⁶⁷ rules ⁵⁹³ ticket ²⁷⁸⁵ festival ³⁸⁰⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
aandedijck.nl	Restaurant and bar Aan de Dijck	The website aims to inform visitors about restaurant and bar 'Aan de Dijck', a hospitality establishment in the Krimpenerwaard, and to offer the possibility of reservations, viewing the menu, and seeing upcoming events.	Bars → Pubs ⁵⁴⁶	hostess ¹⁶⁵ bar ¹²¹⁶ terrace ⁴⁸⁴⁷ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
eetcafebergambacht.nl	Eetcafe 't Centrum	Eetcafe 't Centrum is a restaurant located in Bergambacht offering a welcoming and cozy atmosphere.	Cafes & Lunch → Local Restaurants ²⁹ Mediterranean & Middle Eastern → Takeout ²⁸⁶	soup ¹⁰⁴³ buffet ¹⁷⁴⁷ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
nabilsbarbershop.nl	Nabil’s Barbershop	Nabil’s Barbershop is a modern barbershop in Bergambacht that focuses on providing stylish haircuts and good service.	Men’s Grooming → Barbers ³⁹³ Services → Personal Services ¹⁰⁶²	look ¹⁶⁹ barber ⁴¹⁸ beard ⁴⁶⁸ haircut ¹¹⁵⁸ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
slapenindepolder.nl	Slapen in de Polder	Slapen in de Polder is a Bed and Breakfast (B&B) offering holiday homes in the Krimpenerwaard.	Landscape → Polders ²¹² AccommodationTypes → Holiday Rentals ²⁰	e bike ⁴⁰ polder ⁴⁷⁶ peace ¹¹¹³ holiday home ²⁷⁵³ terrace ⁴⁸⁴⁷ kitchen ⁶⁴⁴³	Krimpenerwaard → Bergambacht ³⁰³
stoutjesfarm.nl	Stoutjesfarm	The Stoutjesfarm website presents a group accommodation in the Gouda area, suitable for groups of up to 32 people, featuring a cozy living room, large terrace, and playground.	Accommodation → Group Accommodation ⁸⁴⁴ Nature → Nature Lodges ³²	hiking route ¹⁵⁵ accommodation ⁴⁹²¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
zilverfeesten.nl	Stichting Zilverfeesten Schoonhoven	The website of Zilverfeesten Schoonhoven provides information about the annual festivals and events held in Schoonhoven.	Festivals → Local Festivals ¹⁷⁰ Immigrant & Cultural Groups → Cultural Initiatives ¹⁵	lineup ²⁶⁷ foundation ⁶⁶⁷⁸ volunteer ⁸³⁶⁷ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wereldwinkelhaastrecht.nl	Vereniging Levenskans voor Allen	Wereldwinkel Haastrecht is a non-profit organization committed to fair trade, sustainability, and supporting development projects.	Africa → Uganda ²⁹ Commerce → Fair Trade ¹⁹¹	income ⁶⁶⁰ donation ⁵¹¹⁰ gift ⁶⁴⁴² membership ¹⁰⁴⁴²	Krimpenerwaard → Haastrecht ¹⁹³
kerkvanammerstol.nl	Gemeente rond de kerk van Ammerstol	This website serves as the online face and information source for the municipality surrounding the church of Ammerstol, providing information about the community, its church leadership, policies, events, and historical data.	Protestantism → Dutch Protestantism ¹⁴¹ Protestantism → Protestant Church in The Netherlands (PKN) ³⁰¹	consistory ⁷⁵ church service ⁸⁷⁹ policy ²¹⁴⁹ municipality ⁶⁸³⁷ history ⁷²⁸⁶	Krimpenerwaard → Ammerstol ⁴⁹
oskamschoenen.nl	Oskam shoes	The Oskam shoes/sport/clothing website presents a wide assortment of shoes, sportswear, and clothing for women, men, and children.	Clothing → Activewear ⁶⁴² Fashion → Shoes ¹²⁷⁴	sportswear ³⁵² shoes ²⁶⁹⁹ assortment ⁷⁷⁹⁹ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
villavoorncamp.nl	Villa Voorncamp	Villa Voorncamp is a comfortable bed & breakfast located in Schoonhoven, Netherlands, offering rooms and accommodation facilities.	Landscape → Betuwe ³⁹ AccommodationTypes → Other Accommodation ¹⁷²	b&b ¹⁰⁶⁰ room ³⁴¹¹ terrace ⁴⁸⁴⁷ accommodation ⁴⁹²¹ property ⁷⁴⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
houdijkdenboer.nl	Loonbedrijf Houdijk den Boer BV	Loonbedrijf Houdijk den Boer BV is a rental and service company operating in the GGW, sports fields, and horticulture sectors.	Relationships → Partnerships ⁴⁸¹ Logistics & Transportation → Rental Companies ⁴¹⁴	path ⁴⁶⁶ level ⁴⁹⁴ machine ³⁷²⁷ rental ⁷²⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
ruitenco.nl	RUIT EN CO	The website of RUIT EN CO is a clothing store in Lekkerkerk offering a wide assortment of trendy fashion for men and women.	Commerce → Shopping Centers ¹⁰⁰¹ Clothing & Accessories → Shoe Stores ⁴⁴¹	instagram ¹²¹⁶ coffee ³⁸³⁸ shop ⁶⁴⁸³ newsletter ⁶⁵⁰⁴ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
kaasboerniek.nl	Kaasboer Niek	The website of Kaasboer Niek is a cheese specialty shop based in Schoorl, Netherlands, offering a selection of North Holland and other cheeses and delicatessen, with a focus on artisanal cheeses and family history.	Dairy → Cheese ⁵³⁰ Economy → Retail & Commerce ⁹⁹⁴¹	mustard ³³ gift basket ⁷² delicatessen ¹⁴⁷ cheese ¹²⁰⁵ family ⁶⁴⁶²	Bergen → Schoorl ⁴⁸¹
schoenmakeraanhuis.nl	Schoenmaker Aan Huis	Schoenmaker Aan Huis provides custom orthopedic shoe solutions at home, focusing on personalized foot support and comfort.	Orthopedics → Foot Problems ⁹⁷⁷ Decorative Arts & Crafts → Craftsmanship ¹¹⁷	orthopedic ¹⁴ insole ³⁵¹ comfort ¹⁴⁷³ foot ¹⁹²⁹ shoes ²⁶⁹⁹ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hfvi.nl	HFVI B.V.	The website of HFVI B.V. is a wholesale partner specializing in the import and sale of fresh vegetables and fruits, aimed at professional clients.	Produce & Vegetables → Vegetables ¹⁰⁷⁰ Produce & Vegetables → Fruit ⁸⁰¹	importer ¹¹¹ wholesaler ²²⁵ fruit ¹¹⁶⁶ vegetables ¹⁴¹⁶ newsletter ⁶⁵⁰⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kinderenopstap.nl	Kinderen op Stap	Zorgboerderij Kinderen op Stap provides housing and short-term accommodation for children with a mental health condition, aiming to create a safe place for relaxation and development.	Alternative Living → Alternative Housing ¹⁸⁴	farm ²⁶²² accommodation ⁴⁹²¹ child ¹¹⁵⁶⁶	Krimpenerwaard → Haastrecht ¹⁹³
zorgboerderijgravestein.nl	Zorgboerderij Gravestein	Zorgboerderij Gravestein offers day programs and work integration for people with diverse needs.	Farms & Farm Businesses → Care Farms ⁴⁷³ Career & Guidance → Pre ¹⁵	indication ¹⁶⁴ supervisor ¹⁹⁶ pony ⁴⁰⁹ cow ⁵⁹⁶ participant ¹⁹³⁴	Oudewater → Hekendorp ²⁸
ov-oranjenassau.nl	Oranjevereniging ‘Oranje Nassau’	The Oranjevereniging ‘Oranje Nassau’ in Lekkerkerk is a community organization dedicated to celebrating the birthdays of its members and the Dutch Royal Family.	Associations → Orange Associations ¹⁸ National Holidays → King’s Day ³⁸⁹	winner ¹⁹⁰ parade ⁵¹³ registration ⁴³⁶⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
bothboerenzorg.nl	Both BoerenZorg	Both BoerenZorg is a care farm located in the Krimpenerwaard region, offering care and activities to people of all ages through practical work on a real farm.	Care → Alternative Care ⁵² Social Issues & Welfare → Social Security ³³⁶	polder ⁴⁷⁶ farm ²⁶²² care ¹²³³⁸	Woerden → Middelland ⁵⁸
zorgopdeboerderij.nl	Stichting Christelijke Zorgboerderij Krimpenerwaard	The Christelijke Zorgboerderij Krimpenerwaard offers accommodation and day activities for children and adult helpers in a Christian setting.	Farms & Farm Businesses → Care Farms ⁴⁷³ Outdoor Adventures → Landscape Recreation ²⁶	farm ²⁶²² hosting ³¹²⁵ accommodation ⁴⁹²¹ care ¹²³³⁸	Krimpenerwaard → Vlist ³⁷
sietskepedicure.nl	Sietske Pedicure	Sietske Pedicure is an ambulant pedicure offering professional foot care services at home in the Krimpenerwaard municipality.	Foot Care → Professional Foot Care ¹¹⁶ Services → Personal Services ¹⁰⁶²	footcare ⁷⁶⁷ foot ¹⁹²⁹ treatment ²¹²⁰³
op-lekkerkerk.nl	Ondernemers Coöperatie Lekkerkerk	The website ‘Op Lekkerkerk’ showcases the shopping center of Lekkerkerk and the diverse local entrepreneurs located within it.	Commerce → Shopping Centers ¹⁰⁰¹ Places → Towns ³⁸⁰	groceries ³⁵⁸ supermarket ⁴⁰⁶ shopping center ⁴⁹¹ fashion ²²¹²	Krimpenerwaard → Lekkerkerk ²⁴⁴
oudjaarsuitje.nl	Oudjaarsuitje.nl	The website offers New Year’s Eve arrangements, both in the Netherlands and Germany.	Parties → New Year’s Eve ⁷¹ Europe → Germany ⁶⁵⁴	castle ⁴⁹⁴ destination ²⁵⁸⁰ boat ²⁹⁸⁰ arrangement ³¹⁰⁴	Raalte → Luttenberg ⁵³²
hh97.nl	HH97	The website of HH97 provides information about the football club, its teams, events, and news.	Clubs → Dutch Clubs ²⁰⁰ Social Organization → Youth Organizations ¹⁷²⁶	sponsor ¹¹⁵⁹ schedule ²⁶²⁴ news ¹⁵²⁹³	Midden-Drenthe → Wijster ⁶⁷
kvdorestad.nl	Kanovereniging Dorestad	KVDorestad is a canoeing association catering to sporty nature enthusiasts from Wijk bij Duurstede and surrounding areas.	Water Sports → Rowing ³⁰³ Water Sports → Canoeing ¹⁷⁶	canoe ²⁶⁹ clubhouse ⁷⁸⁴ trip ²⁰³² association ⁸⁵⁶² member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Buren → Maurik ¹⁶²
boerenwagens.nl	Stichting de Boerenwagen	This website documents the history, restoration, and inventory of farm wagons, with a focus on elaborately carved wagons from the river region.	Historical & African Art → Historical Art ¹⁸ Historical & Tourism → Carriages ¹⁸	inventory ¹⁶¹³ restoration ³⁴¹⁷	Molenlanden → Hoornaar ⁶¹
glasatelierdegrienduil.nl	Glasatelier de Grienduil	Glasatelier de Grienduil is a traditional workshop specializing in the design, creation, and restoration of glass objects, particularly stained glass.	Glassworking → Stained Glass ²⁰²	glass fusing ⁴⁵ stained glass ³¹⁷ restoration ³⁴¹⁷ workshop ¹⁹³²⁵ design ²⁷²⁰²	Vijfheerenlanden → Everdingen ⁶⁴
topkamerverhuur.nl	Topkamerverhuur.nl	The website offers a network of rental rooms in the Netherlands.	Rental Properties → Rooms ¹⁰² Energy & Sustainability → National Websites ¹¹	landlord ²⁶⁷ database ¹¹⁵³ room ³⁴¹¹ rental ⁷²⁵⁷	Bunschoten → Bunschoten-Spakenburg ³⁸²
maxmagazinejubileum.nl	MAX Magazine	This website describes an action by MAX Magazine in which prizes are drawn by the Staatsloterij and Lotto, with a total value of €22,500. Participation is free, but the action has now ended.	Games & Play → Games ³⁹¹¹ Periodical Publications → Magazines ¹⁰⁰¹		Apeldoorn → Hoog Soeren ⁴⁸
vrouwenbondgergem.nl	Women’s Bond Reformed Congregations	The Women’s Bond (Vrouwenbond) is an organization that informs, supports, and connects women within the Reformed Church in the Netherlands. It organizes holiday weeks, regional evenings, and national assemblies, and provides inspiration and lectures.	Religious Organizations → Protestant Organizations ¹¹⁴ Social Organization → Women’s Organizations ²²⁵	holiday week ²⁷ woman ¹⁴¹⁹ lecture ¹⁶²⁴ event ⁴⁵¹⁹⁹	Neder-Betuwe → Dalwagenseweg ²¹⁹
entgenluijten.nl	Stichting Entgen Luijten	The website of Stichting Entgen Luijten aims to raise funds for the creation of a statue honoring Entgen Luijten, a historical figure who was a pioneer in the business world for her time.	Historical Sites → Monuments ¹⁰²⁷ Architecture & Sites → Middle Ages ¹⁸²	statue ⁷⁴ self-awareness ⁷⁵¹ donation ⁵¹¹⁰ history ⁷²⁸⁶ story ⁸²⁸⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
studioliedorp.nl	Studio Liedorp	Studio Liedorp is a full-service advertising agency based in Krimpen aan de Lek offering design, illustrations, and printing services to clients.	Design & Creative → Graphic Services ¹⁰⁰³ Marketing & Advertising → Business Advertising ⁸⁶	media plan ¹⁰ advertising ²³⁰² illustration ²⁴⁴⁷ print ⁵⁵¹¹ portfolio ⁶⁸⁵⁴ design ²⁷²⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hervormdstolwijk.nl	Reformed Congregation of Stolwijk	The website of the Reformed Congregation of Stolwijk provides information about the congregation, its services, activities, and contact details.	Protestant Churches → Congregations ³⁰⁴	congregation ³⁰² church service ⁸⁷⁹	Krimpenerwaard → Stolwijk ²³²
musicalkoorrotterdam.nl	Musicalkoor Rotterdam	The website of Musicalkoor Rotterdam showcases the choir, its goals and activities, particularly recruiting new members and promoting performances.	Choir → Vocal Choir ³⁷	rehearsal ¹⁶³⁹ choir ³¹²³ performance ⁷⁵⁸⁶ member ¹⁰¹⁵⁴	Rotterdam → Center ³⁸²
buurtverenigingschuwacht.nl	Vrij Holland Neighborhood Association	The website of the Schuwacht Neighborhood Association presents information about the activities, history, and contact details of the Schuwacht hamlet.	Village Focus → Village Life ²⁶²	hamlet ¹⁹ friend ⁶³⁹ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Zoetermeer → Willem de Zwijgerlaan ²¹
112krimpenerwaard.nl	Krimpenerwaard Municipality	The website provides ambulance call logs from the Krimpenerwaard municipality and surrounding areas.	Emergency Services → Fire Department ¹³⁸ Health → Medical Care & Services ²⁹⁴⁶¹	ambulance ¹⁷⁸ call ²⁰⁴ emergency ⁷⁵⁰ municipality ⁶⁸³⁷	Krimpenerwaard → Bergambacht ³⁰³
deguldenvrijheid.nl	Buurtvereniging De Gulden Vrijheid	The website of De Gulden Vrijheid neighborhood association presents information about the activities and events that the association organizes for the neighborhood of Opperduit.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Community & Social → Community Activities ⁵²	neighborhood ²⁴²⁴ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
autohoppercapelle.nl	Autohopper Roggeveen	The Autohopper Roggeveen website offers car rental, minibus rental, and moving truck rental services in the Capelle aan den IJssel, Rotterdam, and surrounding areas. Its goal is to facilitate the rental of vehicles for short and long periods.	Moving → Moving Companies ⁸³⁵ Rental Services → Car Rental ¹⁰⁴⁷	moving truck ³⁷ minibus ⁷⁴ rental ⁷²⁵⁷ price ⁸³²⁸ car ¹⁰⁸⁶⁵	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
hervormdbergambacht.nl	Hervormde Gemeente Bergambacht	The website of the Bergambacht Reformed Congregation provides information about the church, its activities, services, and contact details.	Reformed → Dutch Reformed Church ²¹⁹ Protestantism → Churches ¹⁰⁰⁹	pastoral care ¹²² mission ¹⁰⁰⁰ church ³⁴³⁹ app ⁴⁵⁹⁵ collection ⁷⁵⁶⁶	Krimpenerwaard → Bergambacht ³⁰³
bos-grotematenmode.nl	Bos Grote Maten Mode	Bos Grote Maten Mode is an online store specializing in clothing for men with larger sizes, particularly those who are tall and/of stout.	Fashion → Men’s Fashion ⁶⁹⁰ Context ¹⁶¹³⁹⁴	men's clothing ¹⁸ size ⁸⁰⁰ assortment ⁷⁷⁹⁹ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
brassbandschoonhoven.nl	Brass Band Schoonhoven	The website of Brass Band Schoonhoven provides information about the band, its events, history, members, and contact details.	Associations & Societies → Music Societies ²²⁸ Instrument → Instrumental Music ¹⁹⁷	brass band ¹³² director ⁷¹⁶ musician ¹²⁰⁷ concert ⁴⁴⁰⁹ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
flanq.nl	FlanQ accountants	FlanQ accountants, located in Dordrecht and Lekkerkerk, provides various financial services to businesses in the SME sector.	Accounting → General Accounting ⁹³⁹ Finance & Insurance → Tax Systems ⁸³³	sme ⁴⁶⁶ financial advice ⁶⁰⁵ bookkeeping ¹³¹⁹ tax advice ¹⁵²² account ⁵⁷⁸¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
studio-berk.nl	Studio Berk Lichtexperts	Studio Berk is a lighting expert offering lighting design, planning, branding, installation, and projects.	Events & Hospitality → Planning ⁶⁶³	detail ⁶³⁸ light ⁵¹⁴⁸ collaboration ¹⁶⁰³⁶ design ²⁷²⁰²	Krimpenerwaard → Haastrecht ¹⁹³
vdvoet.nl	Van der Voet	Van der Voet is an accounting firm that provides financial, tax, and administrative services to individuals and entrepreneurs in Haastrecht, Amsterdam, and Rotterdam.	Business Operations → Office Administration ²⁴² Government & Legal → Tax ¹³²²	annual reports ³¹¹ tax returns ⁴²³ payroll ¹⁸²³ employee ⁴⁴²⁹ account ⁵⁷⁸¹	Krimpenerwaard → Haastrecht ¹⁹³
fysio-mtc.nl	Fysiotherapie Medisch Training Centrum (MTC)	The website of Fysiotherapie MTC presents the services and specializations of the physiotherapists in Lopik and Schoonhoven and provides information about treatments and appointments.	Medicine → Physiotherapy ²³⁷²	sports physiotherapy ⁴³⁶ ultrasound ⁷⁶⁹ physiotherapy ⁴⁶⁸⁸ child ¹¹⁵⁶⁶ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
de-endskamer.nl	De Endskamer B&B	De Endskamer is a Bed & Breakfast located in the Twente region, offering guests the opportunity to explore the surrounding area by bike and on foot.	Hiking → Trails ³⁵⁶ Hiking → Routes ²⁷⁹	hiking ⁸⁴¹ b&b ¹⁰⁶⁰ breakfast ¹⁸²² bicycle ²⁸³⁸ hospitality ³⁴⁹¹	Haaksbergen → Buurse ⁵⁹
klassekip.nl	Klasse Kip	Klasse Kip is a restaurant and shop that offers fresh, grilled, and ready-to-eat chicken meals.	Supermarkets & Grocery → Food Stores ¹⁰⁵⁸ Food → Meat ¹¹²³	grill ⁵⁶² takeaway ⁶⁵³ chicken ⁹⁴⁴ meal ¹⁶³⁸ assortment ⁷⁷⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
chigarden.nl	Chi Garden	The website of Chi Garden in Stolwijk presents a takeaway menu with a variety of Chinese dishes, catering services, and opening hours of the restaurant.	Asian → Chinese-Indonesian ³² Vegetarian → Vegetarian Dishes ¹⁷	takeaway menu ⁴⁰ spring rolls ¹⁴¹ soup ¹⁰⁴³ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵	Krimpenerwaard → Stolwijk ²³²
wimmudde.nl	Wim Mudde	The website of Wim Mudde Driving School offers driving lessons, with specialized support for students with ADHD, autism, and anxiety.	Personal Development → Self-Help ¹⁷⁹¹ Mental & Emotional Well-Being → Anxiety ¹¹⁶⁹	driving school ⁶⁹⁶ license ¹²⁸⁸ instructor ³¹²⁶ student ⁷⁶²³ car ¹⁰⁸⁶⁵	Krimpenerwaard → Gouderak ¹⁰³
publiquest.nl	Publiquest	Publiquest is a communication bureau established in 2016 as a strategic collaboration between three leading communication agencies. The agency focuses on strategy, dialogue, and participation to make complex issues, such as elder abuse, visible.	Writing → Copywriters ⁶³² Communication → Science Communication ⁶⁸	dialogue ⁴²⁶ strategy ⁹³⁷⁹ communication ¹⁰¹⁶²	Krimpenerwaard → Bergambacht ³⁰³
bijlfietsen.nl	Bijl Tweewielercentrum	Bijl Tweewielercentrum is an e-bike specialist offering a wide range of electric bikes and accessories in Bergambacht.	Auto Parts & Tires → Wheels ⁵⁴⁵ Cycling → Electric Bikes ⁴⁴⁵	e-bike ⁹⁰⁸ bike ¹⁵⁴¹ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
overslagbergambacht.nl	Overslag Terminal Bergambacht B.V.	The website of Overslag Terminal Bergambacht (OTB) presents the services and activities of a family-run business specializing in inland waterway and road freight transport in the Hollands Midden region.	Transportation Services → Freight Transport ³⁷⁸ Administrative Support → Family Businesses ⁶⁶⁴	load ¹³⁶ container ¹⁷⁰⁹ storage ²⁴⁴⁶ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
mdewitte.nl	Bouwkundig Bureau M. de Witte	The website of Bouwkundig Bureau M. de Witte provides architectural services, including drawings, permits, advice, and structural calculations, primarily focused on the Krimpenerwaard and Rotterdam regions.	Visual Arts → Drawing ¹⁰⁴⁶ Engineering → Engineering Firms ⁹⁸⁹	structural calculation ³⁶ permits ⁶⁴³ drawings ¹³²⁹ budget ¹³³⁵	Krimpenerwaard → Bergambacht ³⁰³
hoofdweg256-260.nl	Leyten	This website provides information about the plans for the development of a new residential complex at the location of Hoofdweg 256-260 in Rotterdam.	Apartment Living → New Construction ¹³⁶² Community → Government & Administration ¹⁰⁵⁶⁷	greenery ¹⁰¹ apartment complex ¹⁴⁰ garage ¹²¹⁰ office ²⁸⁹⁸ home ⁷⁹⁷⁶	's-Hertogenbosch → Oud-Empel ¹³
boele-rietveld.nl	Boele & Rietveld	The website of Boele & Rietveld describes a company specializing in advising, designing, installing, and maintaining various technical installations, including electrical engineering, solar panels, security systems, and home automation.	Security → Intrusion Detection ¹³⁷ Technology → Smart Home & Automation ¹¹⁴⁶	home automation ³⁷⁶ electrical engineering ⁸¹⁷ solar panels ⁴⁷⁰¹ security ⁶⁶⁵⁵ installation ¹³⁷⁴²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
slagerijfredvanlaar.nl	Slagerij Fred van Laar	The website of Slagerij Fred van Laar presents the products and services of a traditional butcher shop and catering service, located in Bergambacht, with a focus on quality, traditional preparation, and a wide range of products.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Dairy & Cheese → Delicatessens ⁶¹⁷	sausage ²⁵⁶ meal ¹⁶³⁸ meat ²⁰⁵⁵ promotion ²⁰⁶² catering ⁶⁴⁵⁶ assortment ⁷⁷⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
dusbv.nl	DUS bv	The DUS website is an online platform offering recruitment and staffing services in the construction, technology, office, and green sectors. It aims to connect talent with companies for long-term collaborations and to list job vacancies.	Staffing & Recruitment → Technical Staffing ³⁹⁵	zzp ¹²¹ recruitment ²⁰¹⁵ staff ³⁴⁰⁵ vacancy ⁶⁵⁹⁸ technology ⁶⁸¹⁶ construction ⁷⁴²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autodebruijn.nl	Automobielbedrijf de Bruijn B.V.	The website aims to showcase a range of new and used Volkswagen, Audi, Seat, and Skoda vehicles, as well as the services offered by the workshop, including maintenance, repair, and the option to order original parts.	Automotive → Cars (Brands) ⁴³⁶ Retail & Commerce → Leather Goods ¹⁵³	configurator ²³⁴ part ⁵⁰⁴⁴ car ¹⁰⁸⁶⁵ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stemvandewaard.nl	Gemeente Krimpenerwaard	The website provides information about the ‘Voice of the Waard’ singing competition, including details about the 2025 event.	Genres → Jazz ⁹⁸⁹	jury ³²²	Krimpenerwaard → Stolwijk ²³²
vivazschoonhoven.nl	Vivaz Ladies and Gents	Vivaz Ladies and Gents is a store in Schoonhoven that offers fashion and personal styling.	Fashion → Clothing ⁸⁰⁶⁷ Wellness → Fashion Retail ⁹³	fashion ²²¹² style ²³⁴⁸ store ³⁹⁰¹ collection ⁷⁵⁶⁶ clothing ⁹⁴⁴³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
chineesindischrestaurantdepauwhaastrecht.nl	De Pauw	The 'De Pauw' Chinese and Indonesian restaurant in Haastrecht offers an extensive online menu with various dishes, including sushi, nasi goreng, spring rolls, and other specialties.	Vegetarian → Vegetarian Dishes ¹⁷ Asian → Chinese ⁴¹⁵	nasi goreng ⁶⁵ spring roll ⁸² satay ³²⁰ soup ¹⁰⁴³ sushi ¹⁶⁹⁵	Krimpenerwaard → Haastrecht ¹⁹³
nowa.nl	Nowa Computers	The Nowa Computers website is a local ICT service provider and shop in Schoonhoven that offers repairs, data recovery, and the sale of computer-related products.	Computer → Computer Repair ⁸⁹⁸ Computer Hardware & Peripherals → Computer Stores ²⁸¹	computer ¹⁹⁶⁹ shop ⁶⁴⁸³ network ¹¹¹²³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stichting-svn.nl	Stichting Servicepunt Verenigingen Nederlek (SVN)	The Stichting Servicepunt Verenigingen Nederlek (SVN) provides support and care to sports clubs in Krimpen aan de Lek and Lekkerkerk.	Football → Amateur Football ⁷⁵⁷ Sport Facility → Sports Parks ⁵⁷	sportpark ⁷⁵ asylum seekers ⁹⁶ infrastructure ¹⁴⁶⁰ club ⁴²²⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
degroenewegkringloop.nl	Stg Vrienden OostEuropa Zending	The Groene Weg Kringloopwinkel is a second-hand shop that sells its proceeds to support aid projects in Eastern Europe.	Europe → Romania ¹⁷ Retail & Commerce → Commerce ⁸²⁴⁴	eastern europe ¹¹ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷ furniture ⁸⁷⁵¹ clothing ⁹⁴⁴³	Amsterdam → East ¹⁴²³
ababanden.nl	ABA Banden	ABA Banden is a specialist in Stolwijk providing a wide range of tires, wheels, and truck tires for customers in the region.	Tires → Tire Service ⁹³¹ Auto Parts & Tires → Wheels ⁵⁴⁵	truck tires ¹⁵ wheel ⁷⁴⁶ tire ¹⁹⁷⁵ car ¹⁰⁸⁶⁵	Krimpenerwaard → Bergambacht ³⁰³
demarktvankrimpen.nl	Markt van Krimpen Shopping Center	The Markt van Krimpen shopping center in the Krimpenerwaard presents an overview of the shops and facilities in the center of Krimpen aan de Lek.	Commerce → Shopping Centers ¹⁰⁰¹ Parks & Gardens → Public Space ⁴⁸	public transport ⁸⁴ shopping center ⁴⁹¹ parking ¹⁹²⁸ hospitality ³⁴⁹¹ shop ⁶⁴⁸³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hetnieuwewonen.nl	Het Nieuwe Wonen	The website ‘Het Nieuwe Wonen’ informs and supports residents of various municipalities (including Gorinchem, Hardinxveld-Giessendam, Molenlanden, Sliedrecht and Krimpenerwaard) on how to save energy in their homes, with the aim of providing both financial benefits and a positive impact on the environment.	Insulation → Insulation Companies ¹²⁴ Energy → Energy Saving ¹¹⁵¹	thermal scan ¹⁰ voucher ²⁷⁹ municipality ⁶⁸³⁷ home ⁷⁹⁷⁶ sustainability ¹⁸⁴⁵¹	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
groenwonenvlist.nl	Groen Wonen Vlist	The website of Groen Wonen Vlist provides information and services for tenants and potential tenants of social rental housing in the municipalities of Haastrecht, Stolwijk, and Vlist. The platform covers topics such as rent, repairs, maintenance, housing connections, and contact points.	Sustainable Living → Housing Associations ³²⁵ Home Improvement & Services → Home Maintenance ¹⁰⁰²	tenant ⁹²⁰ rent ⁹⁸¹ housing ⁴³⁷⁸ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Haastrecht ¹⁹³
makelaardijvanwijngaarden.nl	Makelaardij Henk van Wijngaarden	The website of Makelaardij Henk van Wijngaarden offers real estate brokerage services, purchase advice, and appraisals in the Gouda region and surrounding areas.	Real Estate → Property Valuation & Appraisal ²¹²³ Financial Services → Real Estate Brokerage ¹⁹³	broker ⁹⁰² appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Zuidplas → Moordrecht ³³²
ehbo-stolwijk.nl	EHBO Vereniging Stolwijk	The website of the EHBO Vereniging Stolwijk provides information about the association, its services and courses, and aims to attract new members.	Prevention → First Aid ¹⁰⁷⁰ Government & Administration → Government Organizations ¹⁰⁰²	ehbo ¹⁵⁸ resuscitation ²⁵⁰ aed ⁴⁹⁰ member ¹⁰¹⁵⁴ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Stolwijk ²³²
eilandenrijk.nl	SamenThuis Vastgoedontwikkeling BV	The website of the Krimpenerwaard municipality presents information about the 'Eilandenrijk' project in Haastrecht Zuid, a plan for housing construction aimed at addressing the housing shortage in the municipality and improving its livability.	Local Economy & Development → Regional Development ²⁹⁶	housing construction ¹²⁵ housing ⁴³⁷⁸ municipality ⁶⁸³⁷ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Haastrecht ¹⁹³
lopikoost.nl	SAB	The Lopik Oost website presents a new housing development project in Lopik, featuring a diverse range of homes including starter homes, senior homes, apartments, and detached houses and plots. The project aims to create a mix of residents and lifestyles.	Apartment Living → New Construction ¹³⁶²	senior ¹¹⁵ apartment ⁵⁰⁸⁸ home ⁷⁹⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kyaros.nl	Kyaros	Kyaros is a luxury cat resort and grooming salon located in Krimpen aan de Lek, Netherlands, offering temporary accommodation and care for cats.	Dog Care → Grooming Salons ⁶⁵¹ Accommodation → Pet Hotels ⁸⁹	grooming salon ²⁶³ resort ²⁷⁹ accommodation ⁴⁹²¹ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
huisartsenpraktijkvandergaag.nl	Huisartsenpraktijk van der Gaag	The website of Huisartsenpraktijk van der Gaag in Schoonhoven provides patients with access to practice information, appointment scheduling, medical information, and contact details.	Digital & Telehealth → Online Healthcare Services ⁵² Medical Care & Services → Primary Care ⁵⁶⁹⁹	general practitioner ⁵⁰⁸ result ¹⁹⁰² staff ³⁴⁰⁵ patient ⁴⁰⁸² practice ⁹⁰⁸⁹ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gvcrimpenerhout.nl	Vereniging Golfpark Crimpenerhout	Vereniging Golfpark Crimpenerhout is a golf club that organizes recreational and competitive activities for various age groups.	Golf → Golf Clubs ¹⁸⁹	rules ⁵⁹³ youth ³¹²⁶ membership ¹⁰⁴⁴² course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
nieuwbouw-zoetermeer.nl	Nieuwbouw Zoetermeer	The website Nieuwbouw Zoetermeer provides information about all new construction projects, purchase and rental homes in the municipality of Zoetermeer and the surrounding municipalities.	Municipalities → Gilze ²⁴ Online Services → Job Boards ¹⁰³⁶	new construction project ⁷⁹ map ⁸⁰¹ municipality ⁶⁸³⁷ home ⁷⁹⁷⁶	South-Holland → Waddinxveen ¹⁰⁴⁶
smederijfritskramer.nl	Smederij Frits Kramer	Smederij Frits Kramer is a blacksmith shop that has been offering traditional blacksmithing, restoration, and custom solutions since 1881.	Metalworking → Blacksmithing ¹²² Metalworking → Blacksmiths ²⁰	blacksmithing ⁵⁴ blacksmith ⁶⁰ restoration ³⁴¹⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
nieuwbouw-krimpenerwaard.nl	Nieuwbouw Krimpenerwaard	The website Nieuwbouw Krimpenerwaard provides an overview of all new construction projects, for sale and rent properties, in the Krimpenerwaard region, including information about project locations, prices, and availability.	Local Politics → Parties ⁶²² Local Governance → Civic Engagement ⁵¹⁵	updates ²⁰⁰ region ⁵⁴¹² property ⁷⁴⁰⁶ price ⁸³²⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
werkgroepbehoudlopikerwaard.nl	Stichting Werkgroep Behoud Lopikerwaard	The website of the Lopikerwaard Preservation Group (WBL) provides information about the organization, its goals, and activities aimed at preserving and strengthening the Lopikerwaard and its surroundings, including nature, landscape, and cultural heritage.	Nature → Environmental Protection ¹²⁰ Environment → Conservation ³²⁸	preservation ⁷⁶ board ³⁴³⁸ goal ⁴⁹⁷⁴ foundation ⁶⁶⁷⁸ nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
nieuwbouw-lansingerland.nl	Nieuwbouw Lansingerland	The website Nieuwbouw Lansingerland provides information and an overview of all new construction projects, for sale and to rent, within the municipality of Lansingerland and surrounding areas.	Local News → Municipal Information ⁸⁶ Context ¹⁶¹³⁹⁴	map ⁸⁰¹ account ⁵⁷⁸¹ home ⁷⁹⁷⁶	South-Holland → Delft ⁵³⁰⁹
vandervlistschilderwerken.nl	Van der Vlist Schilderwerken	Van der Vlist Schilderwerken is a painting company with a long tradition that provides services to private and business customers.	Essential → Home ⁷⁰⁷⁰⁸	wallpaper ¹⁷⁵⁶ paint ⁸⁷⁴⁷	Krimpenerwaard → Stolwijk ²³²
jnw-krimpen.nl	Jeugdnatuurwacht Krimpen	The website of the Jeugdnatuurwacht Krimpen provides information about activities and events organized by the organization.	Local Events → Fairs ⁷⁰⁷ Lifestyle → Sports ⁴³⁸⁰⁰	calendar ¹⁵⁵⁶ walk ²¹⁶¹ film ³⁰⁰⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
logopediekrimpenadijssel.nl	Logopediepraktijk Lek and IJssel	The website of Logopediepraktijk Lek and IJssel offers speech, language, voice, hearing, and swallowing therapy and advice for a wide range of speech, language, and related issues.	Childcare → Language Development ⁵⁷⁴ Eye & Vision → Audiology ⁵⁷¹	speech therapy ⁵⁴⁰ reading ⁷⁸⁴ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
kaashandeldevriesbv.nl	Kaashandel de Vries BV	Kaashandel de Vries BV is a family-owned business specializing in the sale of cheese and cheese products, with fixed sales locations in the region.	Local Events → Markets ¹⁰⁹⁷ Commerce → Wholesale ¹⁸⁵⁵	wholesale ²⁸⁰ cheese ¹²⁰⁵ storage ²⁴⁴⁶ family ⁶⁴⁶² shop ⁶⁴⁸³ network ¹¹¹²³	Nieuwkoop → Zevenhoven ⁹²
autoservice-elbert.nl	Autoservice Elbert	Autoservice Elbert is an RDW-recognized garage offering various automotive services.	Repair → Garage ¹⁷⁷⁹ Automotive Maintenance → Vehicle Inspection ¹¹⁰²	mot ⁸⁰⁶ garage ¹²¹⁰ tire ¹⁹⁷⁵ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Stolwijk ²³²
haptonomie-gouda.nl	Christine Bak	The website provides information about haptotherapy and haptonomic pregnancy guidance offered by Christine Bak in Gouda, focusing on restoring balance and guiding through pregnancy and loss.	Therapy → Haptotherapy ⁶³³ Health → Pregnancy & Childbirth ⁴²²²	haptonomy ¹²¹ haptotherapy ⁴⁴⁴ loss ⁷⁴⁰ pregnancy ²⁷³⁹	Krimpenerwaard → Bergambacht ³⁰³
verlichteproeverijen.nl	VBR Zoeterwoude	This website provides information about the ‘Verlichte Boerderijen’ (Illuminated Farms) route, a seasonal event that showcases agricultural heritage and local products in South Holland and Utrecht.	Hiking → Walking Routes ²²⁶	heritage ⁸¹⁸ farm ²⁶²² route ³⁴²⁵	South-Holland → Nieuwkoop ¹⁰⁴¹
deleerhulp.nl	De Leerhulp	De Leerhulp is an organization that provides support and guidance to students in primary and secondary education.	Educational Support → Student Guidance ¹³⁴ Learning Disabilities → Dyslexia ⁴³⁸	atmosphere ⁵⁵⁹¹ research ⁸⁹⁶⁷	Krimpenerwaard → Bergambacht ³⁰³
iconsult.nl	iConsult	iConsult offers a software package (SnelStart) for invoicing and accounting, including installation, support, and integration with other systems.	Business Software → Accounting Software ⁹⁸⁴ Business Software → Invoicing Software ¹⁰⁴	snelstart ¹⁶ invoice ⁷⁹⁵ integration ¹⁴⁵¹ account ⁵⁷⁸¹	Krimpenerwaard → Bergambacht ³⁰³
campingdebovenstad.nl	Camping de Bovenstad	Mini-camping de Bovenstad is a rural campsite located in the Green Heart of Holland, near the river Lek, offering camping facilities to guests.	Cycling → Bicycle Rental ⁶⁴³ Tourism → Rural Tourism ⁵⁹	shower ²⁷⁰ river ³¹² caravan ¹³⁹⁴ bike ¹⁵⁴¹ campsite ²⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
dorpshuislekkerkerk.nl	Stichting Dorpshuis Lekkerkerk	Dorpshuis Lekkerkerk is a meeting place for associations, organizations, and residents in Lekkerkerk.	Village Focus → Village Halls ²⁶⁴ Community & Social → Community Activities ⁵²	facility ²⁶¹⁶ community ⁷⁹³¹ volunteer ⁸³⁶⁷ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
carinabossenbroek.nl	Carina Bossenbroek	The website provides information about the panfluitist Carina Bossenbroek, including her biography, agenda, and contact details.	Instrument → Instrumental Music ¹⁹⁷ Music → Performers ³²⁹	pan flute ¹¹ biography ⁶⁹⁷ certificate ¹⁰³⁶ teacher ²⁸⁹⁰ agenda ⁴³⁷⁴ concert ⁴⁴⁰⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
antoelektra.nl	Anto Elektra	Anto Elektra is a specialist in the Krimpenerwaard offering a wide range of household appliances and repair services.	Kitchen → Kitchen Appliances ⁷²⁴ Technology → Electronics & Components ¹¹²⁶¹	device ⁶⁹⁸ technician ⁸¹⁵ appliance ⁹⁵⁶ kitchen ⁶⁴⁴³	Krimpenerwaard → Stolwijk ²³²
mkaclinics.nl	MKA Clinics Zoetermeer	MKA Clinics Zoetermeer provides a wide range of treatments for jaw, tooth, and mouth problems, with a focus on oral and maxillofacial surgery and sleep apnea.	Dentistry → Oral Surgery ⁵⁵	sleep apnea ⁴⁴ patient ⁴⁰⁸² treatment ²¹²⁰³	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
op-t-land.nl	Op ’t Land	Op ’t Land is a small-scale meeting and retreat location nestled in nature, catering to business gatherings and team days.	Conferences & Meetings → Meeting Venues ⁷²⁹ AccommodationTypes → Accommodation ¹²¹³⁰	meeting space ²⁰⁰ venue ⁸⁷⁹ privacy ¹²⁸⁶ atmosphere ⁵⁵⁹¹ nature ⁹⁰⁹⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Stolwijk ²³²
krimpenerwaard-oekraine.nl	Krimpenerwaard Oekraine	The website Krimpenerwaard Oekraine is dedicated to coordinating the collection and transportation of aid goods to Ukraine, primarily organized by funeral entrepreneur Kees Stoppelenburg.	Humanitarian Aid → Disaster Relief ⁷⁴ International Cooperation Projects → International Relations ⁴⁶⁵	aid goods ¹⁵ generators ⁹⁶ dog food ²⁰⁴ medicine ⁴³⁵ truck ¹⁴¹²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
daginfo.nl	Daginfo.nl	Daginfo.nl is a website that provides an overview of local, regional, and national news.	Providers → Domain Names ¹⁴⁶⁶ News & Journalism → News Websites ³⁴⁰	overview ³²⁹ domain ¹⁸¹¹ region ⁵⁴¹² news ¹⁵²⁹³	Montfoort → Linschoten ¹⁶⁹
koolmeesenvanvlietbouw.nl	Koolmees & van Vliet Bouw BV	The website of Koolmees & van Vliet Bouw BV is a platform to request a quote for private construction projects, including extensions, dormers, and renovations.	Construction Companies → Residential Construction ¹⁰¹³	woodworking ³⁴⁵ construction company ⁸²⁴ extension ¹⁹⁴¹ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	Neder-Betuwe → Dalwagenseweg ²¹⁹
rovickmotors.nl	Rovick Motors	The website of Rovick Motors is a motor repair and maintenance business located in Schoonhoven, specializing in motorcycles, scooters, quads and accessories, and offering services such as repairs, maintenance, and used motorcycles.	Motorcycles → Scooters ⁹⁰³	used motorcycle ¹² quad ⁸³ scooter ¹²³⁶ motorcycle ²¹¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
spekkozijn.nl	Spek Kozijntechniek B.V.	The website of Spek Kozijntechniek showcases their services and projects related to providing high-quality hardwood frames, doors, and windows, with a focus on quality and customer satisfaction.	Windows → Frames ¹²¹¹	woodworking ³⁴⁵ window ²⁰³⁰ door ²²¹⁰ frames ²⁵⁵⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
autobedrijfdewaal.nl	Autobedrijf de Waal	The website aims to inform potential customers about the car services and occasions offered by Autobedrijf de Waal.	Leasing → Auto Leasing ⁵⁶⁵ Automotive Maintenance → Vehicle Inspection ¹¹⁰²	apk ¹³³³ lease ¹⁵⁹⁵ occasion ²⁰³⁶ car ¹⁰⁸⁶⁵ maintenance ²⁰⁰⁹³	Gouda → Broekhuizen ²⁴
autobedrijfkoosboer.nl	Mercy Creations	The website of Autobedrijf Koos Boer provides information about the company, including services, contact details, and opening hours.	Classic Cars → Fiat ¹³ Engines → Outboard Motors ¹⁸	warranty ⁴⁷⁰¹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Gouderak ¹⁰³
tipkrimpenerwaard.nl	TipKrimpenerwaard	TipKrimpenerwaard is a digital platform that allows residents of Krimpenerwaard to share their opinions and ideas on current topics.	Participation → Citizen Participation ²³⁷ Local Governance → Civic Engagement ⁵¹⁵	opinion ⁴¹⁷ questionnaire ⁶⁶⁶ topic ¹²³⁸ policy ²¹⁴⁹ idea ²³⁶⁷
pcpokrimpenerwaard.nl	PCPO Krimpenerwaard	The website of PCPO Krimpenerwaard provides information about the eight Christian primary schools in the Krimpenerwaard, job vacancies, the temporary pool, and the strategic plan.	Elementary Schools → Christian Primary Schools ³⁴² Higher Learning → Educational Institutions ¹⁰⁴⁹	strategic plan ²⁷ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶ education ¹³⁴⁷¹
horizoncreative.nl	Horizon Creative	Horizon Creative is a creative agency specializing in developing and implementing complete brand identities across various communication channels.	Creative & Design Services → Creative Agencies ⁸⁹⁸ Architecture & Design → Creative Industries ¹¹⁵⁷	lego ³⁴¹ brand identity ¹⁴⁵⁷ presentation ¹⁷⁸⁵ model ³⁵⁴⁶ design ²⁷²⁰²	Amsterdam → Nieuw-West ⁸⁴⁴
tanrdam.nl	TAN Nederland	The website of TAN Nederland, specifically the Rotterdam branch, serves as a platform for members of a technical car enthusiast club, where the agenda, meeting minutes and news reports of activities and events are published.	Maintenance & Services → Automotive Clubs ¹⁵³ Social Organization → Senior Organizations ⁷⁵⁰	minutes ¹⁶⁹ branch ²⁶⁸ drive ⁴²⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
smash-tennis-padel.nl	Smash Tennis & Padel	The Smash Tennis & Padel website offers a wide range of tennis and padel courses and clubs for various levels and ages, focusing on both performance and recreation.	Tennis → Padel ⁸⁸⁰	padel ⁶⁰² tennis ⁸³⁶ club ⁴²²⁵ lesson ⁵¹⁵⁴ course ¹⁴⁷²⁸	Krimpenerwaard → Bergambacht ³⁰³
the-roustabouts.nl	JRS Productions	The Roustabouts’ website provides information about the rock & roll band, including their tour schedule, news, photos, and the sale of compilation albums.	Rock → Roll ⁴³	compilation ²⁰ album ¹⁴⁹⁵ concert ⁴⁴⁰⁹ video ⁶⁷¹⁴ news ¹⁵²⁹³	Castricum → Akersloot ²⁴²
facilityfacts.nl	Facility Facts B.V.	Facility Facts B.V. is an installation company with 25 years of experience focused on communication, quality, and customer service.	Business Services → Customer Service ¹⁴⁵¹	communication ¹⁰¹⁶² installation ¹³⁷⁴²	Krimpenerwaard → Stolwijk ²³²
meetbureauwindroos.nl	Meetbureau Windroos	Meetbureau Windroos provides professional surveying and building measurement services for various construction projects.	Technology & Innovation → Construction Technology ⁷⁹⁰	volume ¹⁶⁶ dimension ²¹⁶ survey ³⁷⁰ measurement ⁷³¹	Krimpenerwaard → Bergambacht ³⁰³
staal2000.nl	Staal2000	The website of Staal2000 presents the company as a specialist in the calculation, engineering, delivery, and assembly of steel structures, with over 35 years of experience in the metal industry and a focus on reliability and customer service.	Metals & Fabrication → Metals ⁴⁸⁶ Assembly & Production → Assembly ²²⁷	steel structure ²⁰⁸ job vacancies ¹²⁴¹ engineering ¹⁴⁶⁸ assembly ¹⁷³³	Krimpenerwaard → Bergambacht ³⁰³
ijsclubemm.nl	IJsclub EMM	The website of IJsclub Eendracht Maakt Macht provides information about the ice club, including the latest news about the ice rink, skating activities, competitions, and photos, as well as opportunities for membership and following the club via social media.	Skating → Inline Skating ⁵⁸	ice rink ²⁶⁵ competition ⁴⁷⁵⁹ photo ⁷⁷⁷⁸ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
lauradelange.nl	Stichting de Lange	This website presents the work of pianist Laura de Lange, specializing in chamber music and vocal accompaniment, featuring concert schedules, recordings, and teaching opportunities.	Classical Music → Pianists ⁸³ Instrument → Piano ⁵⁷²	duo ³²⁸ piano ⁸²⁰ voice ¹⁰⁹⁰ festival ³⁸⁰⁴ concert ⁴⁴⁰⁹ lesson ⁵¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
meertesmeden.nl	Meer Te Smeden	The website ‘Meer te smeden’ showcases handcrafted jewelry and provides information about the maker, Myrthe.	Exhibitions → Art Fairs ¹⁹⁶	christmas market ¹⁶³ maker ¹⁹⁹ jewelry ⁴⁵⁹⁹ shop ⁶⁴⁸³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vrouwengezondheidzuidplas.nl	Caroline Zwanenburg	The website of Caroline Zwanenburg provides support and advice to women experiencing hormone-related health issues through a holistic approach.	Women’s Health → Hormonal Health ¹⁴⁰	hormone ⁵⁶³ holistic ⁶⁹⁹ complaint ⁶⁴⁷⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
chickadeemusic.nl	Chickadee	The website of Chickadee presents their shows, repertoire, and events, including a campfire sing-along and tent days, and promotes ticket sales for their performances and a fundraiser for Alpe d’HuZes.	Live Entertainment → Music Performances ²⁶⁵ Genres → Countries ⁴¹	campfire ⁸⁷ vocals ²⁰⁶ show ¹³⁹¹ ticket ²⁷⁸⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
keukenstyl.nl	KeukenStyl	KeukenStyl is a complete kitchen solution, offering design and purchase services to help customers create their dream kitchens.	Kitchen → Kitchen Design ⁴⁴³ Kitchen & Dining → Kitchen Shops ¹⁵	advisor ¹⁰⁵⁵ style ²³⁴⁸ wishes ²⁷¹⁷ equipment ⁴¹⁴³ kitchen ⁶⁴⁴³ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
despellerie.nl	De Spellerie	The website De Spellerie sells board games, with a particular focus on games that are beneficial for people with dementia or other brain problems, and educational games for all ages.	Games → Board Games ⁴¹⁶ Care → Elderly ⁸²	educational ⁶³ dementia ⁶⁷⁴ memory ¹⁶⁴¹ game ²⁸⁰⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
keukenateliermaats.nl	Keukenatelier Maat’s	Keukenatelier Maat’s is a company specializing in the design and manufacture of custom kitchens, interior furniture, and bathroom furniture.	Kitchen → Kitchen Solutions ²⁴ Interior → Furniture ⁷⁴⁵⁴	bathroom furniture ¹³⁰ kitchen ⁶⁴⁴³ interior ⁸⁰⁹³ workshop ¹⁹³²⁵	Westland → Wateringen ⁵³⁶
hoflandtaxaties.nl	Hofland	The Hofland website offers valuation services for jewelry, watches, clocks, and silverware, and sells engagement and wedding rings from various brands.	Accessories → Jewelry ³⁵¹⁷	ring ⁸⁰⁰ watch ¹¹⁶⁶ valuation ²⁶⁹⁷ jewelry ⁴⁵⁹⁹ history ⁷²⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
portas-gouwe.nl	PORTAS	The PORTAS website in Gouda showcases the company’s renovation services, focusing on door, kitchen, and staircase renovations, as well as the installation of suspended ceilings and custom cabinets.	Interior → Wall Coverings ⁴³⁵ Renovation → Stair Renovation ³⁵⁰	suspended ceiling ⁴⁰ staircase ⁴⁵⁴ cabinet ¹⁷³⁰ kitchen ⁶⁴⁴³ renovation ¹³⁸⁴⁹ sustainability ¹⁸⁴⁵¹	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
medischcentrumhofplein.nl	Medisch Centrum Hofplein – Montfoort	The website provides information about medical facilities and services available in Montfoort and its surrounding areas.	Primary Care → Medical Centers ⁹⁴ Medical Care & Services → Healthcare Institutions ⁵²	podology ¹²⁰ logopedie ¹²¹ center ¹¹¹⁵ physiotherapy ⁴⁶⁸⁸ practice ⁹⁰⁸⁹ care ¹²³³⁸	Rotterdam → Center ³⁸²
roomboter.nl	Kaashandel van Dijk	Roomboter.nl is an online store selling artisanal butter and other dairy products, focusing on traditional recipes and local delivery.	Dairy & Cheese → Dairy ⁷⁶³ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	butter ⁶¹ production process ¹⁶⁸ dairy ²⁷⁴ family business ⁷⁹³ market ²⁷⁷² assortment ⁷⁷⁹⁹	Lansingerland → Berkel and Rodenrijs ⁹²⁹
fanvanhoutenmeubels.nl	Fan van Houten Meubels	Fan van Houten Meubels is a furniture maker based in Haastrecht that creates custom hardwood furniture, primarily tables, to order.	Woodwork → Tables ⁸¹⁴ Woodwork → Wooden Furniture ⁴⁷⁶	table ¹⁷⁷⁸ wishes ²⁷¹⁷ wood ⁴¹⁵³ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹	Krimpenerwaard → Haastrecht ¹⁹³
haastrechtseijsclub.nl	Haastrechtse IJsclub	The website of the Haastrechtse IJsclub provides information about the club, its activities, board, history, and the ice rinks it operates, with attention to events such as tours and meetings.	Ice Rinks → Ice Skating Clubs ²¹⁸	ice rink ²⁶⁵ facebook ⁸⁵⁰ tour ²³¹⁵ meeting ²³⁸¹ membership ¹⁰⁴⁴²	Krimpenerwaard → Haastrecht ¹⁹³
bolderkade.nl	Van Herk Nieuwbouwmakelaars	The website of Van Herk Nieuwbouwmakelaars presents new apartments in the Bolderkade, a new construction project in Ouderkerk aan den IJssel, emphasizing modern amenities, spacious living areas, and a connection to the Hollandse IJssel.	Apartment Living → Maisonette ¹⁰¹	parking space ²⁹⁴ balcony ⁸⁴⁶ heat pump ²⁵⁴¹ apartment ⁵⁰⁸⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
westewindrecruitment.nl	Westewind B.V.	Westewind is a recruitment agency that connects professionals in the finance and technical sectors with job opportunities or temporary assignments.	Translation → Language Translation ²⁸⁸ Real Estate → Agencies ²⁴³	technical ²⁹¹ recruitment ²⁰¹⁵ finance ⁵³⁴¹ vacancy ⁶⁵⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
groen-werk.nl	Groen-Werk	The website of Groen-Werk offers a list of vacancies in the green maintenance sector and functions as a recruitment agency specializing in finding suitable jobs for people in the industry.	Jobs → Vacancies ¹⁰⁹⁹ Agriculture → Agricultural Services & Contracting ⁷⁰⁸	machinist ²⁷ green maintenance ⁷⁷ qualification ⁹⁶ recruitment agency ²⁵⁸ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
studioframe.nl	Studio Frame	Studio Frame is an architecture studio that undertakes challenging design projects in various disciplines and locations.	Conferences & Meetings → Meeting Venues ⁷²⁹	pavilion ¹³⁰ atelier ¹⁴¹⁷ environment ⁴⁸⁷³ collaboration ¹⁶⁰³⁶ design ²⁷²⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
avvhoveniers.nl	AVV Hoveniers	AVV Hoveniers is a landscaping company offering services for garden design, landscaping, maintenance, and related work, such as paving, planting, and boundary demarcation.	Outdoor & Garden → Landscape Companies ³³⁹	garden maintenance ⁴⁶² garden design ⁹⁶⁴ landscaping ¹⁵²⁹ paving ¹⁹⁴²	Krimpenerwaard → Bergambacht ³⁰³
rondomstijl.nl	Rondom Stijl	Rondom Stijl is an interior design studio that provides customized interior designs for renovations and new constructions.	Architectural Firms → Individual Architects ⁶⁶	sparring partner ¹⁴⁹ interior design ¹⁸⁰² inspiration ⁴⁰⁸¹ home ⁷⁹⁷⁶ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
paltrok.nl	Dierenkliniek de Paltrok	Dierenkliniek de Paltrok is a veterinary practice serving pets in the Gouda, Reeuwijk, and Haastrecht areas.	Primary Care → Veterinary Medicine ⁷⁰⁴ Veterinarians → Veterinary Clinics ⁴¹⁹	rodent ⁵⁸ veterinarian ⁸⁶⁴ cat ¹⁵⁷⁸ food ³⁸⁷² dog ⁵⁴⁸³ appointment ¹³⁵¹⁰	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
kerstweekend.nl	Kerstweekend .nl	The website offers information and books Christmas arrangements, such as Christmas hotels, Christmas brunch, Christmas markets, and Christmas cruises.	North Rhine-Westphalia → Düsseldorf ¹¹ Christmas → Christmas Markets ¹⁶⁴	christmas market ¹⁶³ destination ²⁵⁸⁰	The Hague → Scheveningen ¹⁶²⁵
verkadecaravans.nl	Verkade Caravans V.O.F	The Verkade Caravans website provides a wide range of services and products related to caravans, folding campers, and trailers, including sales, maintenance, repairs, and storage.	Recreational Vehicles → Caravans ⁸²⁰	used car ⁸²⁵ caravan ¹³⁹⁴ storage ²⁴⁴⁶ accessories ¹²⁹⁷⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Stolwijk ²³²
zangverenigingvriendschap.nl	Gemengde Zangvereniging Vriendschap Berkenwoude	The website of Gemengde Zangvereniging Vriendschap Berkenwoude serves as an information hub for the association, its activities, members, and events, with the aim of attracting new members and supporting the association.	Choir → Women’s Choir ¹⁷⁹ Choir → Mixed Choir ²³¹	jubilee ²⁴⁴ rehearsal ¹⁶³⁹ sponsors ²⁶⁴² choir ³¹²³ concert ⁴⁴⁰⁹ member ¹⁰¹⁵⁴	Krimpenerwaard → Berkenwoude ⁶²
makelaaroverzicht.nl	HuisVerkopen.nl	The website provides an overview of real estate agents in the Netherlands and information about selling and buying houses.	Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴ Boats → Selling ²⁰	buy ¹⁶⁹ sell ²³⁰ agent ¹²⁵³ valuation ²⁶⁹⁷ house ⁸¹²¹	Simpelveld → Bocholtz ⁷⁰
svmakelaardij.nl	Swijnenburg & Valk Makelaardij	The website of Swijnenburg and Valk Makelaardij provides a platform for buying and selling real estate, with a focus on the Krimpenerwaard and Capelle region. The purpose is to inform and connect potential buyers and sellers with suitable properties.	Business Strategy → Business Sales ¹¹	buyer ²³³ transaction ⁶¹³ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
deschijnwerper.nl	Schijnwerper	The website of the Schijnwerper theater group provides information about their performances, rehearsals, contact details, and history.	Theater → Theater Groups ⁶⁷³	piece ⁸⁷ theater group ²²³ director ⁷¹⁶ theater ²⁵⁴⁴ agenda ⁴³⁷⁴ performance ⁷⁵⁸⁶	Krimpenerwaard → Haastrecht ¹⁹³
vandergraaf-services.nl	Van der Graaf’s Services	Van der Graaf’s Services Lekkerkerk is a website offering an experienced mechanic for car and truck repairs and maintenance, primarily available for garages.	Repair → Garage ¹⁷⁷⁹	automotive business ¹¹ mechanic ²⁸² garage ¹²¹⁰ truck ¹⁴¹² repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
lennartdeneef.nl	Lennart de Neef	This website presents the artistic projects and exhibitions of Lennart de Neef, an artist based in the Netherlands.	Visual Arts → Installation Art ⁵⁷⁶ Painting → Contemporary Art ⁸⁰⁵	residency ¹⁰⁰ commission ⁶⁰⁹ exhibition ⁵³³² installation ¹³⁷⁴²	Krimpenerwaard → Haastrecht ¹⁹³
inhanden.nl	In Handen	The website of In Handen presents a practice offering holistic energetic therapies, massage, meditation and spiritual development, with a focus on the client's overall wellbeing.	Essential ²⁴¹⁰¹⁶	reiki ¹²⁸⁴ meditation ²⁴⁰⁰ therapy ⁷⁴⁴⁸ massage ⁷⁶⁴⁶ course ¹⁴⁷²⁸ treatment ²¹²⁰³	Alphen aan den Rijn → Boskoop ⁶⁵²
nootkracht.nl	Nootkracht	The website of Nootkracht presents an online store and market stall offering a wide range of nuts, dried fruits, peanuts, peanut butter, nut pastes, crackers, and other grains and seeds, all roasted and processed on-site.	Vegetables → Nuts ¹⁰⁴ E-Commerce → Marketplaces ¹⁰⁵³	peanuts ³² dried fruits ⁵⁰ nuts ⁴¹⁷ market ²⁷⁷² store ³⁹⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
zontec.nl	Zontec	The Zontec website provides information and offers sustainable solar energy solutions for businesses and private individuals, including advice, installation, and maintenance.	Energy & Sustainability → Energy Consulting ⁸⁸³	roof ³⁶⁶² solar panels ⁴⁷⁰¹ quote ¹²⁸⁶³ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
truckrunkrimpenerwaard.nl	TruckRun Krimpenerwaard	The TruckRun Krimpenerwaard website provides information about the annual truck caravan that drives across the Krimpenerwaard region, an event revived in 2019 after a decade of inactivity.	Local & Regional → Regional Events ⁸²¹ Lifestyle → Travel ⁴²⁹¹²	caravan ¹³⁹⁴ truck ¹⁴¹² driver ¹⁸³² event ⁴⁵¹⁹⁹
weidevogelbescherminglopik.nl	Vrijwillige Weidevogelbescherming Lopik	The Vrijwillige Weidevogelbescherming Lopik website provides information and activities related to the protection of wetland birds in the Lopikerwaard area, including the use of drones for monitoring and research.	Foundations → Environmental Organizations ¹⁸⁵ Nature → Nature Reserves ¹⁰³²	wetland bird ²⁷ nest ¹⁴⁰ monitor ¹⁰⁶³	Lopik → Benschop ¹²⁶
accountantskantoor-tak.nl	Accountantskantoor E. Tak B.V.	Accountantskantoor E. Tak B.V. offers administrative, fiscal and financial services to businesses and individuals.	Accounting → General Accounting ⁹³⁹	annual financial statement ¹²⁵ payroll administration ⁹⁷⁹ tax ²¹⁰⁰ account ⁵⁷⁸¹ administration ⁶⁵⁸⁷	Krimpenerwaard → Ammerstol ⁴⁹
bosbedrijfskleding.nl	Bos Bedrijfskleding	Bos Bedrijfskleding is a supplier of workwear and business attire, offering a wide range of products and customization options.	Clothing → Workwear ¹⁰⁰¹ Commerce → Textile Retail ¹³⁷	attire ¹⁷ workwear ⁸⁵¹ shoes ²⁶⁹⁹ print ⁵⁵¹¹ assortment ⁷⁷⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
cbs-deark.nl	Christelijke BasisSchool de Ark	The Christelijke BasisSchool de Ark in Bergambacht is a Christian primary school that offers open and passionate education to all students.	Primary Education → Christian Education ⁴⁴⁶ Higher Learning → Educational Institutions ¹⁰⁴⁹	study day ⁴⁰ annual report ⁸⁷⁷ tour ²³¹⁵ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
herrevelddevogel.nl	Herreveld & de Vogel makelaardij	Herreveld & de Vogel makelaardij is a real estate agency specializing in the Krimpenerwaard, dedicated to guiding private and commercial clients through the purchase, sale, and rental of real estate.	Property Agents & Brokers → Regional Agents ³⁵² Commercial Property → Office Buildings ¹⁴⁴	negotiation ²⁹⁶ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶ house ⁸¹²¹	Krimpenerwaard → Bergambacht ³⁰³
hv-makelaardij.nl	HV-Makelaardij	HV-Makelaardij is a real estate agency specializing in valuation, purchase and sales guidance in the Krimpenerwaard and surrounding areas.	Property Agents & Brokers → Realtors ³⁴¹	realtor ¹⁴² negotiation ²⁹⁶ reference ³³² valuation ²⁶⁹⁷ sale ⁵⁹³⁰ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
werkenbijversluis.nl	Versluis	This website offers job postings for the Versluis control practice.	Control → Pest Control ⁸²⁴	controller ²³⁹ assistant ²⁶¹ financial statement ³²¹ control ⁹¹¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
partybushurenrotterdam.nl	Partybus Rotterdam	The website offers party bus rental services in and around Rotterdam, focusing on events like festivals, concerts, and bachelor/bachelorette parties, and allows users to compare multiple quotes.	Passenger Transport → Bus Rental ²⁰² Event Services → Party Transportation ¹⁵	partybus ¹⁰⁵ festival ³⁸⁰⁴ rental ⁷²⁵⁷ quote ¹²⁸⁶³ event ⁴⁵¹⁹⁹	South-Holland → Dordrecht ⁴⁵³¹
jlkunststoffen.nl	JL Kunststoffen	JL Kunststoffen is a recognized Triflex processor specializing in applying Triflex systems and waterproofing roofs and roof details.	Maintenance & Repair → Facility Services ⁶⁷¹ Building & Materials → Concrete Structures ²⁶⁸	concrete structure ²¹ waterproofing ⁵⁹ pathway ⁴⁴⁷ roof ³⁶⁶²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
goudseslotenmaker.nl	Goudse Slotenmaker	The website of Slotenmaker Gouda offers 24/7 emergency locksmith services and locksmith repair services in Gouda and the surrounding municipalities, with a focus on reliability, quality, and transparency.	Security Systems → Lock Systems ¹²⁴ Transportation → Emergency Services ⁶³⁰	locksmith ⁹¹⁹ locks ⁹⁵³ security ⁶⁶⁵⁵	Krimpenerwaard → Bergambacht ³⁰³
aacee.nl	AaCee Bouwen en Milieu	This website, created by Kees van der Linden and Ceciel Sillevis, serves as an archive and information source, primarily focused on their work in construction and environmental projects ("AaCee Bouwen en Milieu") and Els Sillevis’ watercolors, as well as family photos, gatherings, and historical projects.	Image Products → Photo Albums ⁵⁴ Social Sciences → Genealogy & Family History ¹⁴⁰³	photo album ⁶⁸⁶ archive ²⁰⁶⁷ environment ⁴⁸⁷³ family ⁶⁴⁶² construction ⁷⁴²¹	South-Holland → Delft ⁵³⁰⁹
meenks-schoof.nl	Huisartsenpraktijk Meenks en Schoof	The website of Huisartsenpraktijk Meenks en Schoof provides information about the practice, appointment scheduling, emergency contact, and helpful links.	Primary Care → Family Medicine ²⁷⁴	urine test ²⁰ e consult ²⁹ blood test ²⁰⁰ doctor ¹³⁹⁷ staff ³⁴⁰⁵ appointment ¹³⁵¹⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
fietsnaarvandervelden.nl	B. van der Velden Tweewielers	The website of B. van der Velden Tweewielers is a bicycle shop that specializes in selling and repairing bicycles, with a particular focus on electric bikes, and offers personalized service and advice to customers.	Cycling → Bicycle Sales ⁴⁵⁵	test ride ⁹⁹ electric bike ³⁴¹ saddle ³⁶⁴ bicycle ²⁸³⁸
camperpioneer.nl	Camper Pioneer	The website Camper Pioneer offers custom-built bus campers, focusing on various truck brands and a wide range of designs and options.	Camping → Bus Campers ²⁰ Vehicles → Camper Vehicles ⁷²	buscamper ⁴⁰ creative ⁵³⁹ layout ⁸⁹⁹ truck ¹⁴¹² portfolio ⁶⁸⁵⁴ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Bergambacht ³⁰³
mooizolingerie.nl	Mooi Zo Lingerie	Mooi Zo Lingerie is an online lingerie store that sells garments for various cup sizes and styles.	Lingerie → Bras ³⁰	sports bra ²⁰ bra ¹¹⁶ underwear ²⁸¹ swimwear ³⁴⁵ lingerie ⁴⁸⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
johnvolk.nl	John Volk Boomzorg	The website of John Volk Boomzorg presents the services of a tree care company specializing in environmentally conscious tree management for various clients, including municipalities, businesses, and individuals.	Garden Maintenance → Tree Care ⁶⁶⁰	felling ⁸² pruning ⁴⁹³ tree ¹⁸⁷⁹ plant ⁴⁵⁰⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
autobedrijfterlouw.nl	Smits Auto	The website informs about the cessation of operations of Carteam Autobedrijf Terlouw in Bergambacht and refers customers to colleague car dealership Smits Auto for maintenance, warranty, and roadside assistance.	Automotive → Cars (Brands) ⁴³⁶	winter tires ¹¹³ roadside assistance ²¹¹ used cars ⁸⁹⁴ warranty ⁴⁷⁰¹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
ctbb.nl	CTBB B.V.	The website of CTBB B.V. presents company information and the scope of their civil technical works.	Engineering → Engineering Firms ⁹⁸⁹ Construction → Civil & Infrastructure ³⁴⁵³	distribution center ⁷⁷ buildings ⁸⁹⁸ infrastructure ¹⁴⁶⁰ work ³¹²²	Krimpenerwaard → Bergambacht ³⁰³
anneliesdolle.nl	Annelies Dölle	The website showcases the paintings of Annelies Dölle created using the egg tempera technique, focusing on abstract art and the storytelling through color and form.	Galleries & Exhibitions → Art Routes ²¹⁵ Painting → Abstract Painting ⁵⁹⁴	form ⁶⁷⁹ paintings ³⁹⁰⁷ color ⁴¹⁵⁹ exhibition ⁵³³²	Molenlanden → Groot-Ammers ¹⁵⁸
dutchride.nl	Dutchride.nl	Dutchride.nl is a website providing information about and offering carriage arrangements, with a focus on sharing experiences of riding in carriages, particularly based on their own experiences in Lapland.	Outdoor → Horse Riding ⁹⁴¹ Parties → Birthday Parties ¹⁰⁰⁸	lapland ¹⁸ carriage ¹²⁵ children's parties ¹²⁶ ride ¹⁰⁷⁵ arrangement ³¹⁰⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
breekbaarwit.nl	Studio Seen	The Breekbaarwit website is a portfolio of a porcelain atelier located in Middelburg, Netherlands, showcasing the artwork of the artist Petra, including information on exhibitions, an agenda, and contact details.	Ceramics → Porcelain ¹⁷ Painting → Contemporary Art ⁸⁰⁵	porcelain ¹⁷⁵ clay ⁴⁹⁵ atelier ¹⁴¹⁷ exhibition ⁵³³² portfolio ⁶⁸⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
verloskundigenkrimpen.nl	Verloskundigen IJssel & Lek	Verloskundigen IJssel & Lek is a midwifery practice that supports pregnant women and their partners throughout pregnancy, childbirth, and postpartum care.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	contraception ¹⁵⁸ postpartum ⁴⁶⁴ midwife ⁵⁵³ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹ care ¹²³³⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hethofland.nl	Tennisvereniging Het Hofland Schoonhoven	Tennisvereniging Het Hofland Schoonhoven is a tennis club that organizes activities and events for its members and guests.	Tennis → Tennis Clubs ⁷²⁰	tennis ⁸³⁶ court ⁹⁹⁹ competition ⁴⁷⁵⁹ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vanbruggenjuwelen.nl	Van Bruggen Jewelry Utrecht	Van Bruggen Jewelry Utrecht is a jeweler and watch dealer specializing in the sale of high-quality jewelry and watches, featuring products from both Dutch and European brands and offering custom-made pieces.	Accessories → Jewelry ³⁵¹⁷	gem ²⁶ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ brand ¹⁷⁷³⁷ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hoeve-zegenvrucht.nl	Kaasboerderij Van der Burg Zegenvrucht	The website of Kaasboerderij Van der Burg Zegenvrucht offers a range of organic beef, lamb, wild goose meat, and cheese, all sourced locally and sustainably.	Meat → Beef ¹⁸³ Environment → Agriculture ¹¹¹⁶⁰	lamb ¹⁰⁰ beef ³¹⁹ cheese ¹²⁰⁵
het-tuinhuis.nl	The Tuinhuis	The Tuinhuis provides childcare services, including Kinderdagverblijf (KDV) and Buitenschoolse Opvang (BSO), as well as Gastouderbureau services, and provides information about locations and rates.	Employment & Labor → Work ³³⁶² Family Fun → Children’s Recreation ²⁴	kinderdagverblijf ¹⁵ rate ²⁶⁰⁶ childcare ³⁵¹²	Alphen aan den Rijn → Boskoop ⁶⁵²
asis-t.nl	Asis-T Schoonhoven	The website of Asis-T, based in Schoonhoven, provides advice, project support, and second opinions related to insulation, asbestos, corrosion, and scaffolding construction.	Environmental Technology → Asbestos Remediation ¹⁹¹ Renovation & Restoration → Construction Techniques ⁷⁶	corrosion ⁴⁹ project support ⁹⁰ asbestos ³⁸⁷ scaffolding ⁵¹⁹ insulation ²⁴⁴⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wensveengrafiek.nl	Wensveengrafiek	The website of Monique van Wensveen showcases her artwork as a visual artist, specializing in creations using etched copper, blueprints, and drawings, and her participation in art and church events.	Visual Arts → Printmaking ³⁰² Galleries & Exhibitions → Exhibitions ¹⁰⁸³	blueprint ¹⁴⁵ artwork ²²⁴⁸ exhibition ⁵³³² course ¹⁴⁷²⁸	Krimpenerwaard → Ammerstol ⁴⁹
jansiemonsma.nl	Jans Simonsma	The website documents bicycle tours along cycling nodes in the Netherlands, with descriptions and locations.	Local Life → Attractions ¹⁷ Context ¹⁶¹³⁹⁴	bicycle route ²⁰ place ²⁴² observation ²⁴⁸	West-Maas en Waal → Appeltern ¹¹³
goudsekleipijpen.nl	De SWAEN	This website is dedicated to the history and variety of Gouda clay pipes.	Local History → Dutch History ¹⁰⁶⁷ Crafts → Ceramics ¹¹⁵⁶	period ⁹⁴ tile ²⁸⁶⁹ decoration ⁴⁰⁸⁵	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
speelgoed-info.nl	Speelgoed-info.nl	The website, speelgoed-info.nl, is a platform designed to help users find toy stores, learn about toys, and offer services to toy businesses. It provides a search function for local toy stores, articles about toys, and business services for the toy industry.	Lifestyle → Recreation ³⁴²⁴⁹	company profile ⁸⁷ toy ²²⁹⁵ article ⁶⁰⁰⁰ community ⁷⁹³¹	Haarlemmermeer → Hoofddorp ²⁷³⁹
fietsverhuurschoonhoven.nl	Bike Totaal Zilverstad	The website of Bike Totaal Zilverstad in Schoonhoven offers a range of new and second-hand bicycles, bicycle rentals, and professional saddle measurements to customers in the Schoonhoven area and surrounding region.	Cycling → Bicycle Rental ⁶⁴³	saddle ³⁶⁴ bicycle ²⁸³⁸ route ³⁴²⁵ rental ⁷²⁵⁷ accessories ¹²⁹⁷⁵	Molenlanden → Kinderdijk ¹⁵⁸
peterstuurman.nl	Peter Stuurman Photography	The website of Peter Stuurman Photography presents and sells photographs of the Krimpenerwaard, a polder region in the Green Heart of the Netherlands, and offers photography courses.	Nature & Landscape → Nature Photography ⁴⁸² Nature & Landscape → Landscape Photography ⁵³⁰	photographs ²⁵⁴ polder ⁴⁷⁶ course ¹⁴⁷²⁸	Krimpenerwaard → Bergambacht ³⁰³
dezilverenschaats.nl	De Zilveren Schaats	The website of the ice and inline skating club ‘De Zilveren Schaats’ presents information about the club, activities, events, and history.	Ice Rinks → Ice Skating Clubs ²¹⁸	ice rink ²⁶⁵ skating ³¹⁴ club ⁴²²⁵ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vanbemmelbouwconstructies.nl	Van Bemmel Advies Bouwconstructies VBA	Van Bemmel Advies Bouwconstructies is a construction advisory firm specializing in building structures and projects.	Construction Companies → Construction Contractors ⁵³⁶ Personal & Household → Other Services ¹²⁰	architect ⁶⁰⁹ contractor ¹⁰³⁹ construction ⁷⁴²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autocrewkrimpenerwaard.nl	AutoCrew Krimpenerwaard	AutoCrew Krimpenerwaard is an auto dealership located in Stolwijk, offering a range of services including car sales, maintenance, repairs, and tire services, specializing in commercial vehicles and campers/caravans.	Auto Parts & Tires → Tires ¹⁵²⁶ Maintenance & Services → MOT ⁵⁹	commercial vehicle ³²⁶ mot ⁸⁰⁶ tire ¹⁹⁷⁵ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Stolwijk ²³²
flirtfashion.nl	FlirtFashion	The website of FlirtFashion presents a women's fashion store with locations in Lekkerkerk, Papendrecht, and Bergambacht. The aim is to inform visitors about opening hours, locations, and the offered clothing.	Fashion → Men’s Fashion ⁶⁹⁰	women's fashion ¹⁰⁵ opening hours ²⁹⁵³ store ³⁹⁰¹ clothing ⁹⁴⁴³	Krimpenerwaard → Bergambacht ³⁰³
fit-enjoy.nl	FIT &JOY	FIT &JOY physiotherapy offers guidance and exercises to restore enjoyment of movement for people with physical ailments and stress.	Pain → Chronic Pain ²⁴⁰ Medical Care & Services → Nutrition ⁵⁷⁹⁹	sleep ⁷⁴⁶ pain ¹⁹¹⁹ movement ²³⁰⁴ wellbeing ²⁶²⁰ physiotherapy ⁴⁶⁸⁸ nutrition ⁴⁹³⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
dezwaanberkenwoude.nl	De Zwaan	The website of De Zwaan in Berkenwoude presents the venue for various events, including weddings, parties, and business gatherings, and provides information about the facilities and opening hours.	Conferences & Meetings → Meeting Venues ⁷²⁹ AccommodationTypes → Accommodation ¹²¹³⁰	village ⁸⁰⁸ venue ⁸⁷⁹ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Berkenwoude ⁶²
toa-geluidsinstallaties.nl	Vodavi bv	The website of TOA geluidsinstallaties and Vodavi bv offers a selection of audio and broadcast installations, amplifiers, microphones, and speakers, geared towards professional applications and custom solutions.	Installation & Fixings → Installation Materials ²⁴⁷ Audio → Sound Technology ¹⁶⁸	sound system ¹⁶⁶ microphone ¹⁹⁸ amplifier ³⁰² speaker ¹⁴⁸¹ installation ¹³⁷⁴²	Krimpenerwaard → Bergambacht ³⁰³
debodega-vanwijk.nl	Slijterij De Bodega	Slijterij De Bodega is an alcohol shop specializing in whisky and other alcoholic beverages, operating in Capelle and surrounding areas.	Gifts & Souvenirs → Liquor Stores ²³³	checks ¹⁹ whisky ³⁷³ shop ⁶⁴⁸³	Schouwen-Duiveland → Nieuwerkerk ¹¹⁰
delphiacademy.nl	Delphi Academy	The website of Delphi Academy presents a three-month intensive training program focused on acquiring basic skills for developing with Delphi.	Training → IT Training ²²⁰	delphi ²² database ¹¹⁵³ course ¹⁴⁷²⁸ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
fietswereld-noorlander.nl	Fietswereld Noorlander	Fietswereld Noorlander is a bicycle shop in Ouderkerk aan den IJssel that sells a wide range of bicycles, e-bikes, and accessories, as well as repair and maintenance services.	Repair → Bicycle Repair ⁴⁰⁵ Bicycles → Two-Wheelers ²³⁸	bicycle shop ⁹⁹ e-bike ⁹⁰⁸ bicycle ²⁸³⁸ accessories ¹²⁹⁷⁵ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
rioolserviceklapwijk.nl	Klapwijk Rioolservice	The website of Klapwijk Rioolservice offers drain services, including unclogging, repair, inspection, odor detection, preventative maintenance, new installation, and replacement of drainage systems, and informs visitors about potential misdirection and fraud within the drain cleaning sector.	Plumbing → Waste Water Management ¹⁴ Plumbing → Drainage ⁵⁷⁰	unclogging ²⁴⁴ drain ⁸⁸⁶ drainage ¹³²² vacancy ⁶⁵⁹⁸ quote ¹²⁸⁶³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
hvsamenwonen.nl	Huurdersvereniging Samen Wonen (HSW)	The website of the Huurdersvereniging "Samen Wonen" (HSW) serves as a platform for tenants of the housing corporation "QuaWonen" in the communities of Schoonhoven, Bergambacht, Berkenwoude and Ammerstol to find information and contact regarding their rights and interests.	Rental Properties → Tenant Associations ³⁵¹ Homeownership & Management → Housing Corporations ⁴²⁶	right ³⁷⁹ tenant ⁹²⁰ complaint ⁶⁴⁷⁹	Krimpenerwaard → Bergambacht ³⁰³
hbvlekkerkerk.nl	Huurders Belangen Vereniging Lekkerkerk	The Huurders Belangen Vereniging Lekkerkerk aims to advocate for the interests of all Lekkerkerk residents.	Rental Properties → Tenant Associations ³⁵¹ Dutch Politics → Second Chamber ¹²	rent allowance ¹¹ second chamber ⁵⁵ tenant association ⁵⁹ tenant ⁹²⁰ municipality ⁶⁸³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
kindertheateronwijz.nl	Christelijk Kindertheater Onwijz	The website of Christelijk Kindertheater Onwijz presents information about their Christian children's theater productions, the schedule of performances, and the possibility of booking the theater group.	Theater → Children’s ¹⁶⁸ Theater → Youth Theater ²⁰⁴	theater group ²²³ schedule ²⁶²⁴ church ³⁴³⁹ performance ⁷⁵⁸⁶	Woerden → Harmelen ³³⁵
galjaard-onderwijsadvies.nl	Galjaard Onderwijsadvies	Galjaard Onderwijsadvies provides customized educational advice.	Business & Management → Educational Consulting ⁵⁶¹ Research & Academia → Educational Development ³⁵⁴	consultant ⁷⁰⁶ learning ⁹²⁰ education ¹³⁴⁷¹	Krimpenerwaard → Haastrecht ¹⁹³
design-station.nl	Designstation	The website of Designstation presents the services of a design studio, primarily focused on the design and realization of various marketing and communication products.	Creative & Design Services → Design Agencies ⁴⁵⁷ Design → Graphic Design ²⁴³³	brand identity ¹⁴⁵⁷ brochure ¹⁶⁴² campaign ³⁴²⁸ production ⁴⁵⁸² logo ⁴⁶⁶⁰ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bothautos.nl	Both Auto's Bergambacht	Both Auto's Bergambacht is a family-run car dealership offering car sales, maintenance, repairs, and used car sales.	Automotive → Car Dealerships ¹⁶⁴⁷ Transportation → Automotive Technology ³¹⁵	used car ⁸²⁵ apk ¹³³³ tire ¹⁹⁷⁵ air conditioning ²¹⁷⁸ car ¹⁰⁸⁶⁵ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
covsdrachten.nl	Scheidsrechtervereniging Drachten e.o.	This website provides information about the Scheidsrechtervereniging Drachten e.o., including activities, news, and contact details.	Football → Referees ²⁰ Associations → Sports Associations ¹⁰⁸²	knvb ³⁴ referee ⁷⁹ association ⁸⁵⁶² training ²⁸¹³³	Smallingerland → Drachten ²⁰⁵²
wcdewaardrenner.nl	Wielrenvereniging de Waardrenner	Wielrenvereniging de Waardrenner is a cycling association with a website providing information about membership, events, board members, history, and contact details.	Ice Rinks → Ice Skating Clubs ²¹⁸ Sports Clubs → Dutch Sports Clubs ³³⁷	time trial ²⁰ chairman ²⁴ sponsorship ²⁶⁸⁶ association ⁸⁵⁶² membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
pointzsports.nl	Pointz Sports	Pointz Sports provides tennis and padel lessons in the Krimpenerwaard region, with a focus on padel courses and clinics.	Tennis → Padel ⁸⁸⁰	padel ⁶⁰² tennis ⁸³⁶ trainer ¹⁹⁶⁶ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
belbus-schoonhoven.nl	Belbus Krimpenerwaard	The website of Belbus Schoonhoven and Krimpenerwaard provides information about the transportation service, volunteer opportunities, and sponsorship, along with details on fees and contact information.	Bus Services → Public Transportation ⁷⁸²	seniors ⁹⁰⁴ sponsor ¹¹⁵⁹ ticket ²⁷⁸⁵ volunteer ⁸³⁶⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tcberkenwoude.nl	TC Berkenwoude	The website of TC Berkenwoude Tennis Club provides information about the club, including events, the agenda, rules, news, and membership information.	Sports Clubs → Local Sports Clubs ²⁴⁸ Tennis → Tennis Clubs ⁷²⁰	tennis club ³³⁷ tournament ²⁴⁷⁶ agenda ⁴³⁷⁴ membership ¹⁰⁴⁴²	Krimpenerwaard → Bergambacht ³⁰³
homoontmoetingsplekken.nl	homoontmoetingsplekken.nl	The website presents locations along Dutch highways and carpool lanes where men meet.	Roads → Highways ²⁶ Social Media → Dating ¹⁶⁴⁴	parking area ⁵¹ highway ⁸⁸ man ⁴⁵³ meeting ²³⁸¹	Emmen → Nieuw-Amsterdam ¹⁴⁹
tentdagen.nl	Stichting TENTdagen Schoonhoven	The website of Stichting TENTdagen Schoonhoven provides information about an annual event held in the last week of summer vacation.	Family Fun → Family Activities ¹⁴⁹³ Local & Regional → Regional Events ⁸²¹	event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
afo-fotogroep.nl	AFO Fotogroep	The website of AFO Fotogroep presents information about the photography club of the Krimpenerwaard, including their activities, member benefits, agenda, and portfolio.	Arts → Imaging & Photography ⁷⁶⁸⁷	club evening ⁶⁴ trip ²⁰³² photography ⁹⁵⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
beautybyfleur.nl	Beauty by Fleur	Beauty by Fleur is a beauty salon in Schoonhoven that offers various biological skin care treatments and products.	Cosmetics & Aesthetic → Small Business Services ¹⁰⁵	facial treatment ¹¹⁵² skin ²⁵¹⁸ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dealger.nl	Antiekhandel De Alger	The website of Antiekhandel ‘De Alger’ presents the collection of an antique shop located in Haastrecht, specializing in antiques, furniture, and collectibles.	Home → Antiques & Collectibles ¹⁵²³	collectibles ¹¹⁸ clocks ¹⁷⁸ antique ⁴³² farmhouse ⁸⁷⁸ furniture ⁸⁷⁵¹	Krimpenerwaard → Haastrecht ¹⁹³
hessinggoud.nl	hessinggoud	The website compares the costs of goldsmith specialists in various regions of the Netherlands.	Precious Metals → Gold ¹⁷⁴	goldsmith ²²⁴ gold ⁸⁰⁵ cost ¹⁹⁹⁰ region ⁵⁴¹²	Sittard-Geleen → Munstergeleen ⁶⁶
hylcon.nl	HylCon	HylCon is an advisory firm specializing in policy and management in the outdoor space.	Planning & Development → Spatial Planning ⁸⁸⁹ Nature → Environmental Management ⁵²⁹	issue ²¹⁴ policy ²¹⁴⁹ party ⁵⁹²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
carinewintermans.nl	Carine Wintermans	The website of Carine Wintermans showcases her artwork as a painter and provides information about her background and contact details.	Painting → Oil Painting ³²⁶ Painting → Abstract Painting ⁵⁹⁴	oil paintings ²⁵ paintings ³⁹⁰⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kleigoedkeramiek.nl	kleigoed keramiek – Petra de Jong	The website of kleigoed keramiek – Petra de Jong showcases the work and activities of ceramic artist Petra de Jong, who specializes in creating ceramics with organic forms and human figures.	Crafts → Ceramics ¹¹⁵⁶	glaze ⁹⁷ forms ²⁴⁴ clay ⁴⁹⁵ ceramics ¹²⁷¹ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
springerparkconcert.nl	Stichting Schoonhoven Klassiek	The website presents the annual open-air concert program of the Springerpark Concert in Schoonhoven, with a focus on diverse music genres outside of classical music.	Music → Genres ¹⁷⁵² Lifestyle → Events ³²⁴⁷⁵	park ¹⁸⁶³ band ²⁹⁷⁷ concert ⁴⁴⁰⁹ music ¹³¹⁷⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
prinsheerlijkdelicatessenhuis.nl	CONO Kaasmakers	PrinsHeerlijk! Delicatessenhuis is a delicatessen shop selling various types of cheese, nuts, regional products, and other delicacies.	Dairy & Cheese → Specialty Food Stores ⁶⁴ Dairy & Cheese → Delicatessens ⁶¹⁷	regional products ³⁹¹ nuts ⁴¹⁷ cheese ¹²⁰⁵	Purmerend → Middenbeemster ³⁶⁷
bellofriet.nl	Bello Friet	Bello Friet is a snack bar located in Bergen and Warmenhuizen offering fresh-cut fries and other snacks.	Fast Food → Fries ⁹⁴⁹ Family Activities → Day Trips ⁴¹⁹	locomotive ⁸⁶ potato ⁵⁴² meat ²⁰⁵⁵ fries ²⁷⁵³ snack ²⁹¹⁶ hospitality ³⁴⁹¹	Schagen → Warmenhuizen ²⁴⁴
winkelhof.nl	Winkelhof Bergambacht	The Winkelhof Bergambacht website is a shopping center located in Bergambacht, offering a diverse range of products and services, including home goods, fashion, shoes, accessories, food, care, pet supplies, and more.	Shopping Centers → Local Shopping Centers ²⁶ Economy → Local Economy & Development ⁷²¹	home goods ³⁹ voucher ²⁷⁹ shopping center ⁴⁹¹ instagram ¹²¹⁶ fashion ²²¹² food ³⁸⁷²	Krimpenerwaard → Bergambacht ³⁰³
willdoomakelaardij.nl	Willdoo Makelaardij	Willdoo Makelaardij is a real estate agency located in Schoonhoven that specializes in selling, renting, and buying properties.	Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴ Real Estate → Immobilien ²⁸⁴	agent ¹²⁵³ wishes ²⁷¹⁷ sale ⁵⁹³⁰ rental ⁷²⁵⁷ house ⁸¹²¹	Krimpenerwaard → Bergambacht ³⁰³
padmosmakelaardij.nl	Padmos Makelaardij B.V.	Padmos Makelaardij is a real estate agency that sells, buys, and appraises properties in Krimpen aan den IJssel and surrounding areas.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴	appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
stolwijkkaas.nl	Stolwijk Kaas	Stolwijk Kaas is a webshop that offers fresh cheese directly from the market to customers.	Online Retail → Food Retail ³⁴⁰ Tourism → Farm Visits ⁷⁶	cheese ¹²⁰⁵ holiday ²²⁹⁵ market ²⁷⁷² order ⁶⁹¹²	Krimpenerwaard → Stolwijk ²³²
harmoniestolwijk.nl	Muziekvereniging ‘Harmonie’ Stolwijk	The website of Muziekvereniging ‘Harmonie’ Stolwijk presents news, events, information on membership, and the activities of the association.	Orchestras → Brass Bands ³⁸⁸ Associations & Societies → Music Associations ¹⁰⁰³	percussion group ⁶⁹ musician ¹²⁰⁷ orchestra ¹³¹⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
rederijkerskamerexcelsior.nl	Rederijkerskamer Excelsior Stolwijk	The website of Rederijkerskamer Excelsior Stolwijk presents the association, its activities, theatrical performances, history, and contact information.	Theater → Theater Groups ⁶⁷³ Education & Youth → Local Life ⁴¹	theatrical performance ⁵⁹ dinner ¹⁵³³ rehearsal ¹⁶³⁹ youth ³¹²⁶ history ⁷²⁸⁶	Krimpenerwaard → Stolwijk ²³²
kunstschildercorvisser.nl	Cor Visser	The website of artist Cor Visser showcases his artwork and offers visitors the opportunity to contact him.	Painting → Dutch Art ³²²	atelier ¹⁴¹⁷ paintings ³⁹⁰⁷ artist ⁵⁷⁴⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
rondjekunstschoonhoven.nl	Rondje Kunst Schoonhoven	The website provides information about ‘Rondje Kunst Schoonhoven’, an annual event where artists and goldsmiths exhibit and sell their work in the city of Schoonhoven.	Galleries & Exhibitions → Art Routes ²¹⁵ Art & Culture → Art Events ³²⁷	route map ³⁷ exhibition ⁵³³² artist ⁵⁷⁴⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
peking-schoonhoven.nl	Chinees Indisch Restaurant ‘Peking’ Schoonhoven	The website of Chinese-Indian Restaurant ‘Peking’ in Schoonhoven provides an online platform to view menus, place takeout orders, make reservations, and find opening hours.	Asian → Chinese ⁴¹⁵	takeout ¹¹⁵ opening hours ²⁹⁵³ reservation ³³⁷³ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
degenkamp-isolatie.nl	Degenkamp Isolatie B.V.	Degenkamp Isolatie is a company specializing in various forms of insulation, including heat, cold, and acoustic insulation, and offers thermal inspections and advice.	Insulation & Glazing → Insulation ¹⁵⁴³	cost ¹⁹⁹⁰ insulation ²⁴⁴⁸ energy ⁹⁰⁷⁵	Krimpenerwaard → Bergambacht ³⁰³
merel-pics.nl	merel-pics	The website merel-pics is a photography competition focused on capturing and sharing memories through photography.	Investing → Crypto ⁷²	mining ⁵⁶ crypto ³⁸⁴ photography ⁹⁵⁰³ blog ¹³³⁹²	Venlo → Tegelen ³²⁴
kevintimmerman.nl	Kevin Timmerman	The website showcases the work of artist and jewelry maker Kevin Timmerman, including sculptures and jewelry, and provides an overview of past exhibitions.	Jewelry → Handmade Jewelry ⁸⁶²	sculpture ¹⁴⁴⁰ jewelry ⁴⁵⁹⁹ exhibition ⁵³³²	Stichtse Vecht → Vreeland ¹⁰⁶
mvwitconsultancy.nl	MVW ITconsultancy	MVW ITconsultancy is an IT consultancy company focused on optimizing business processes by advising, developing, delivering, implementing, and managing information systems, primarily using FileMaker Pro.	Training → IT Training ²²⁰	informationsystem ⁴¹ it consultancy ⁵² business processes ⁵⁶⁴ database ¹¹⁵³	Krimpenerwaard → Lekkerkerk ²⁴⁴
toldo.nl	Toldo	The website provides information and services related to outdoor shading and outdoor living products.	Windows → Roller Shutters ⁴⁷ Garden → Sun Shading ⁵⁶⁸	outdoor living ⁶² roller shutters ¹³⁸ shading ³⁶⁴ screen ¹⁴³⁸ installation ¹³⁷⁴²	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
dapschoonhoven.nl	Dierenartspraktijk Schoonhoven	Dierenartspraktijk Schoonhoven is a veterinary practice located in Schoonhoven, Netherlands, that treats various types of animals.	Veterinarians → Veterinary Clinics ⁴¹⁹	veterinary practice ⁷¹ emergency ⁷⁵⁰ cat ¹⁵⁷⁸ dog ⁵⁴⁸³ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vtg.nl	Ventilatie Techniek Gouda B.V.	Ventilatie Techniek Gouda is a company specializing in ventilation systems and products, focused on improving air quality and reducing operating costs.	Home Improvement → HVAC Systems ⁷⁷³ Installation & Repair → Ventilation ⁸⁵⁹	grille ⁴² price list ²⁰¹ filter ⁴⁸⁷ ventilation ¹¹¹⁰ color ⁴¹⁵⁹	Krimpenerwaard → Haastrecht ¹⁹³
hetijsbuffetvanschoonhoven.nl	The IJsbuffet van Schoonhoven	The IJsbuffet van Schoonhoven is an ice cream parlor that sells artisanal Italian ice cream and cakes, with the option to pre-order them.	Ice Cream → Ice Cream Parlors ⁵²¹	nougat ¹⁴ cannoli ²⁵ ice cream ¹⁰⁰⁰ flavor ¹⁰³² cake ¹⁷³⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
diemillapraktijk.nl	Diemilla practice	Diemilla practice is a yoga and massage practice offering various yoga styles, meditation, massage, and workshops.	Palliative & End-Of-Life Care → Spiritual Care ⁸⁶	class ²⁰⁷⁶ meditation ²⁴⁰⁰ yoga ³⁷⁰⁴ atmosphere ⁵⁵⁹¹ massage ⁷⁶⁴⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jackstrimsalon.nl	Jack’s Trimsalon	Jack’s Trimsalon is a grooming salon specializing in the care of dogs and cats, focusing on breed-standard grooming and providing a safe and friendly environment.	Dog Care → Grooming Salons ⁶⁵¹ Knowledge → Education ⁶⁹⁶⁶⁶	poodle ³⁰ grooming ⁸⁹⁶ cat ¹⁵⁷⁸ dog ⁵⁴⁸³ workshop ¹⁹³²⁵
vanderendebv.nl	Bouw- en aannemingsbedrijf Van der Ende	The website of Bouw- en aannemingsbedrijf Van der Ende from Bergambacht presents the company as a comprehensive general contractor specializing in new construction, maintenance, and commercial construction, operating in the Randstad region and focused on delivering high-quality projects for various clients.	Architecture → Architectural Services ¹⁰⁰⁶ Project Management → Construction Management ¹⁰³⁸	housing corporation ⁴²⁴ new construction ²⁶⁷² maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
cbsebenhaezer.nl	CBS Eben-Haëzer	The website of CBS Eben-Haëzer in Lekkerkerk provides information about the school, its program, news, events, and the possibility for parents to connect and register.	Primary Education → Protestant Primary School ³² Primary & Secondary Schooling → School Information ²⁴⁶	calendar ¹⁵⁵⁶ parent ⁴³¹⁸ school ⁷⁸⁵⁶ news ¹⁵²⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
studiohairline.nl	Studio Hairline	The website of Studio Hairline is a hair salon offering a wide range of brands and beauty treatments, with a focus on hair styling, nail styling, and tanning.	Eyelash Services → Eyebrows ⁷⁷⁷ Cosmetics & Aesthetic → Appearance ³⁵³	tanning ⁵⁵ nails ¹⁷¹⁹ hair ³⁰¹⁴ salon ⁵⁵⁴¹ brand ¹⁷⁷³⁷ treatment ²¹²⁰³	Krimpenerwaard → Stolwijk ²³²
dezilverenparel.nl	De Zilveren Parel	De Zilveren Parel provides child and parent coaching to support children and their parents.	Counseling → Family Counseling ⁵²⁸	attachment ²⁰⁸ trauma ²¹⁰⁷ parent ⁴³¹⁸ child ¹¹⁵⁶⁶ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
argentojeudeboules.nl	Argento Jeu de Boules	The website of Argento Jeu de Boules provides information about the club, its activities, events, news, and contact details, primarily focused on the Jeu de Boules competition and tournaments.	Team Sports → Boules ¹⁵⁹ Historical Associations → Guilds ⁴⁸	jeu de boules ¹¹⁷ tournament ²⁴⁷⁶ sponsors ²⁶⁴² club ⁴²²⁵ agenda ⁴³⁷⁴ news ¹⁵²⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jvbergambacht.nl	JVB – Jeu de Boules Vereniging Bergambacht	The website of JVB – Jeu de Boules Vereniging Bergambacht provides information to members, potential members, and visitors about the association, its activities, rules, members, and contact details.	Team Sports → Boules ¹⁵⁹	boules ³⁸ clubhouse ⁷⁸⁴ tournament ²⁴⁷⁶ sponsors ²⁶⁴² region ⁵⁴¹² member ¹⁰¹⁵⁴	Krimpenerwaard → Bergambacht ³⁰³
carolahaarmode.nl	JUULZ HAIRSTYLE	The website announces the upcoming takeover of Carola’s Haarmode hair salon in Haastrecht by Sabrina, under the name JUULZ HAIRSTYLE, and includes important information about the transition, subscriptions, discounts, and the end of certain benefits.	Men’s Grooming → Barbershops ¹⁰¹²	hair salon ⁷¹⁷ haircut ¹¹⁵⁸ subscription ³²⁸⁷	Krimpenerwaard → Haastrecht ¹⁹³
bmmband.nl	BMM Band	The BMM Band website provides information about the band, their performances, members, and stories from their musical history.	Bands → Dutch Bands ¹⁰⁰ Blogs & Publications → Press Releases ⁷³¹	tradition ⁷³⁶ band ²⁹⁷⁷ performance ⁷⁵⁸⁶ member ¹⁰¹⁵⁴ music ¹³¹⁷⁰	Krimpenerwaard → Haastrecht ¹⁹³
trouborst.nl	Automobielbedrijf Trouborst	Automobielbedrijf Trouborst is an automotive dealership with over 50 years of experience, specializing in BMW, offering car sales, repair, and maintenance, and employing a customer-friendly approach.	Brand → BMW ¹¹⁷ Transportation → Automotive Electronics ⁷⁶	bmw ³⁴⁴ occasion ²⁰³⁶ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
tpijsselland.nl	TP IJsselland	Tandartsenpraktijk IJsselland is a dental practice located in Krimpen a/d IJssel that provides high-quality and patient-centered dental care.	Dentistry → Private Practices ¹⁶	dentistry ⁶⁰⁶ dentist ²⁵¹⁴ patient ⁴⁰⁸² treatment ²¹²⁰³	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
hagendijkbouw.nl	Hagendijk Bouw	Hagendijk Bouw is a construction company that carries out home renovations and new construction projects in the Krimpen aan den IJssel region and surrounding areas.	Construction Companies → Additions ⁴⁵⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	construction company ⁸²⁴ carpentry ²²¹⁸ new construction ²⁶⁷² home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
skillstuinen.nl	Skills Tuinen	The Skills Tuinen website presents the professional gardening company and its services.	Garden Maintenance → Gardeners ⁶⁸⁵	gardening company ¹⁷ championship ²¹⁰ contact form ²⁷⁰ video ⁶⁷¹⁴ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
evertvandergrinten.nl	Evert van der Grinten	The website of Evert van der Grinten is a portfolio and information resource for the goldsmith based in Amersfoort, who creates custom jewelry, provides repairs, and showcases his own collection.	Jewelry → Goldsmiths ³¹⁹ Crafts → Goldsmithing ¹⁶⁸	goldsmith ²²⁴ atelier ¹⁴¹⁷ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ design ²⁷²⁰²	Utrecht Hill Ridge → Leersum ³⁵³
dierenwinkel-moordrecht.nl	Dierenwinkel Moordrecht	Dierenwinkel Moordrecht is a pet store offering everything for your pet, including food, snacks, fishing supplies, and a free delivery service.	Animals → Pet Food ⁵⁸⁴ Retail & Commerce → Commerce ⁸²⁴⁴	pet ¹⁶¹⁷ food ³⁸⁷² assortment ⁷⁷⁹⁹	Zuidplas → Moordrecht ³³²
hsinfra-advies.nl	HS Infra Advies	HS Infra Advies provides project management, EMVI planning, and contract management for infrastructure projects.	Architecture & Design → Architectural Consulting ⁴⁹⁰ Civil & Infrastructure → Infrastructure Management ¹⁴	contract management ²¹⁰ infrastructure ¹⁴⁶⁰ project management ³⁴²³ consulting ³⁶³⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
xidsign.nl	Xidsign Studio-Photography and Design	The website of Xidsign Studio-Photography and Design presents a photography studio in Schoonhoven offering various types of photo shoots and graphic designs, targeting individuals and businesses.	Wedding → Event Photography ⁴⁹³	portrait ³⁶⁸⁵ studio ⁵⁴⁶⁵ portfolio ⁶⁸⁵⁴ photography ⁹⁵⁰³ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bedrijfsbouwpartners.nl	Bedrijfsbouw Partners	Bedrijfsbouw Partners is a construction company specializing in the design and construction of office buildings and commercial real estate.	Commercial Property → Business Parks ³²⁴ Construction Companies → Residential Construction ¹⁰¹³	office buildings ³¹ business park ³⁷² real estate ⁴⁹⁸¹ construction ⁷⁴²¹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Bergambacht ³⁰³
zorgboerderij-vlist.nl	Stichting Agrarische Zorgonderneming Vlist (SAZOV)	The website of Stichting Agrarische Zorgonderneming Vlist (SAZOV) provides information about a care farm, day care, home care, and support for adults with intellectual disabilities.	Farms & Farm Businesses → Care Farms ⁴⁷³ Social Services → WMO ¹⁶²	care farm ²⁴⁶ wmo ³⁴⁰ home care ⁸²⁷ daycare ¹³⁶⁵ foundation ⁶⁶⁷⁸ care ¹²³³⁸	Krimpenerwaard → Vlist ³⁷
boboot.nl	Boboot voerboten	Boboot voerboten is a company that supplies bait boats, parts, and related services.	Fishing → Fly Fishing ⁵⁸	fishfinder ²⁰ gps ²⁵⁵ rental ⁷²⁵⁷ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
werkenbijvlr.nl	VLR	The website of VLR Accountants presents job vacancies and describes the accounting firm as an experienced and diverse organization with two locations in the Krimpenerwaard.	Business Software → Accounting Software ⁹⁸⁴	accounting firm ²⁵⁰ audit ⁶²² industry ¹⁷⁸⁰ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
lizevanveen.nl	Lize van Veen - Coaching	The website of Lize van Veen offers psychological therapy and coaching to women struggling with trauma, stress, grief, and burnout, from a Christian perspective.	Trauma & Recovery → Loss ⁷¹⁴ Mental & Emotional Well-Being → Trauma ¹⁰⁰¹	grief ¹⁵⁷⁷ trauma ²¹⁰⁷ podcast ³³²⁸ stress ³⁹⁶⁵ therapy ⁷⁴⁴⁸ coach ²⁵⁸¹⁰	Woerden → Middelland ⁵⁸
praktijkarise.nl	Praktijk Arise	Praktijk Arise provides individual and relationship therapy to foster connection and promote happiness.	Relationships → Relationship Problems ⁶⁴³ Mental & Emotional Well-Being → Psychotherapy ⁶⁸⁵	desire ¹⁹⁶ therapist ¹⁸⁹⁰ pattern ²⁰¹² connection ⁴⁰⁰⁷ relationship ⁴²⁰⁵ therapy ⁷⁴⁴⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
middelblok22.nl	Van Rhijn Makelaars	The website of Van Rhijn Makelaars presents a spacious, iconic villa located in Gouderak, South Holland, which was built in 2023 and is for sale subject to approval.	Property Features & Details → Land ¹⁷⁰ Accommodation → Villas ¹⁰¹⁸	shipyard ¹³⁰ land ⁴⁷² villa ¹³⁵¹ house ⁸¹²¹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Gouderak ¹⁰³
hofmeijermechanics.nl	Hofmeijer MP B.V.	Hofmeijer MP B.V. is a company specializing in the design, engineering, construction, and maintenance of pumps and pumping systems, with a focus on innovative and sustainable solutions.	Nature Conservation → Water Management ¹¹³⁸	waterboards ¹⁷ mill ⁴⁸⁷ pump ⁶²⁵	Velsen → Velserbroek ²⁹⁷
vanreeuwijkbv.nl	Van Reeuwijk B.V.	Van Reeuwijk B.V. is a company specializing in various demolition and construction-related services.	Building & Materials → Demolition Services ³¹⁷	drill ³⁰³ asbestos ³⁸⁷ demolition ¹¹⁴⁴ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
lenc-schoonhoven.nl	L+C Schoonhoven B.V.	L+C Schoonhoven is a metal processing company that produces custom parts from design to production.	Metalworking → Welding ⁸⁹³	laser cutting ²⁵¹ welding ¹⁰⁵¹ engineering ¹⁴⁶⁸ production ⁴⁵⁸² part ⁵⁰⁴⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
annemariecaris.nl	Annemarie Caris	The website of Annemarie Caris showcases handcrafted jewelry often imbued with personal significance and designed to keep memories alive.	Crafts → Handmade ¹¹⁴⁷ Decorative Arts & Crafts → Craftsmanship ¹¹⁷	goldsmith ²²⁴ jewelry ⁴⁵⁹⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
star-frame.nl	StarFrame	StarFrame is a wholesale supplier providing frames, mounting services, and related accessories to professional clients such as framers, galleries, and museums.	Visual Arts → Framing ¹³⁹	passe partout ¹⁵ framer ¹⁹ frames ²⁵⁵⁶ glass ²⁹¹⁹ accessories ¹²⁹⁷⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
m-mulder.nl	M.Mulder	The website of M.Mulder offers a wide selection of professional cleaning machines, including sweepers, radial sweepers, seated sweepers, and shovel-towed sweepers, for various sectors.	Metalworking → Machines ³⁰⁷ Agriculture → Agricultural Machinery & Equipment ⁶³¹	sweeper ⁴⁹ part ⁵⁰⁴⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sunkrimpenerwaard.nl	SUN Krimpenerwaard	The website of SUN Krimpenerwaard provides financial assistance to individual households in the Krimpenerwaard municipality facing acute financial emergencies, when other support options are unavailable. The organization's aim is to offer direct financial support through the Noodfonds and/or a rent-free loan via the Sociaal Leenfonds, as part of a national network of emergency aid organizations.	Assistance Services → Financial Assistance ²²⁴	service provider ²²⁵ household ³⁸² municipality ⁶⁸³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
unieckzorg.nl	Unieck Zorg	Unieck Zorg offers supported independent living and sheltered housing, focusing on assisting individuals in organizing and developing their own lives.	Senior & Assisted Living → Care Facilities ⁵⁰ Social Services → Person-Centered Care ²⁸	growth ⁴⁰⁵⁴ housing ⁴³⁷⁸ care ¹²³³⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jikkehoogveld.nl	Jikke Hoogveld Als Wandelcoach & Organizer	Jikke Hoogveld Als Wandelcoach & Organizer provides coaching to individuals seeking more clarity, insight, and balance in their lives.	Weight Loss → Dieting ¹⁰⁸	time ⁹³² stress ³⁹⁶⁵ balance ⁴⁵⁸² goal ⁴⁹⁷⁴ coach ²⁵⁸¹⁰	Krimpenerwaard → Haastrecht ¹⁹³
womensportsonlyschoonhoven.nl	Women Sports Only Schoonhoven	Women Sports Only Schoonhoven is a sports club specifically designed for women, providing a welcoming and enjoyable environment for them to exercise and live a healthier lifestyle.	Fitness → Pilates ⁵⁹⁸	pilates ⁵⁴⁵ gym ⁶⁹⁹ class ²⁰⁷⁶ nutrition ⁴⁹³⁵ coach ²⁵⁸¹⁰ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
aspectusaurei.nl	Aspectus Aurei	The Aspectus Aurei website showcases a collection of figurative artwork by Goudse artist and painter Marco Bakker, focusing on capturing the images of Gouda and its surroundings through drawings and paintings.	Local History → City History ⁴⁸ Galleries & Exhibitions → Local Art ²⁸	drawings ¹³²⁹ image ²⁶⁰⁵ portrait ³⁶⁸⁵ paintings ³⁹⁰⁷	Lingewaard → Bemmel ⁵⁰⁹
schouten-polsbroek.nl	Schouten Polsbroek B.V.	Schouten Transport Polsbroek is a logistics company specializing in container transport, dedicated transport, and occasional transport.	Temporary & Specialized Property → Storage Facilities ²⁵	warehouse ¹⁰²⁷ fleet ¹³⁵¹ container ¹⁷⁰⁹ storage ²⁴⁴⁶ logistics ³²⁵⁷ transport ⁶¹⁰⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
novamoetblijven.nl	novamoetblijven.nl	The website is a blog that presents local news and information from various Dutch municipalities and regions, such as Maasbracht, Midden-Limburg, and other areas.	TravelContent → Travel Guides ⁹³⁸ News & Journalism → Regional News ⁹⁴⁸	leaf blower ²⁶ region ⁵⁴¹² blog ¹³³⁹² news ¹⁵²⁹³	Maasgouw → Maasbracht ²⁴⁸
fysiostaete.nl	Fysiotherapie Oranjestaete/Fysiostaete Gouda	The website Fysiotherapie Oranjestaete/Fysiostaete Gouda presents a physiotherapy practice with locations in Gouda and Gouderak, offering various treatment methods including general physiotherapy, physical training, manual therapy and psychosomatic physiotherapy.	Physical Therapy → Pain Therapy ⁹³⁶	psychosomatic physiotherapy ²⁶ manual therapy ¹³²⁰ physiotherapy ⁴⁶⁸⁸ appointment ¹³⁵¹⁰	Krimpenerwaard → Gouderak ¹⁰³
arievandervlist.nl	Arie van der Vlist	The website of Arie van der Vlist, an organist, pianist, and conductor, provides information about his performances, albums, sheet music, and concerts.	Organ Music → Organists ³⁹	sheet music ²⁶⁹ pianist ²⁹¹ organ ⁶³³ conductor ¹²¹⁷ album ¹⁴⁹⁵ concert ⁴⁴⁰⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
bedrijvenadressen.nl	www.bedrijvenadressen.nl	The website ‘Companies & Directories’ is a directory that presents local businesses and contact information by municipality.	Office & Workspace → Business Directories ⁴²¹	municipality ⁶⁸³⁷	Krimpenerwaard → Bergambacht ³⁰³
ontdekwatbijjepast.nl	Marja	The website of Marja offers career coaching to individuals who are dissatisfied with their current job and are searching for a suitable new role. The goal is to help individuals discover their talents and potential and identify which work activities are a good fit for them.	Human Resources → Talent Management ⁵³⁷	career coaching ⁴⁸⁰ career ²⁵¹³ talent ³⁹⁸⁷ coach ²⁵⁸¹⁰	Krimpenerwaard → Stolwijk ²³²
fysiokrimpen.nl	Fysiotherapie de Waterpoort	Fysiotherapie de Waterpoort is a physiotherapy practice located in Krimpen aan de Lek that offers a variety of therapies.	Primary Care → Clinics ¹⁰⁰⁹	echography ¹⁰ sports physiotherapy ⁴³⁶ manual therapy ¹³²⁰ physiotherapy ⁴⁶⁸⁸ therapy ⁷⁴⁴⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
brommobielrotterdam.nl	Brommobiel Rotterdam	Brommobiel Rotterdam offers mobility solutions for individuals without a driver's license through the sale of electric vehicles.	Road Services → Automotive ¹⁸⁷⁶⁴	electric vehicle ¹⁷⁵ showroom ⁴⁸⁸³ brand ¹⁷⁷³⁷ maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
destelling.nl	De Stelling	De Stelling offers various spaces for storage and business, including garage boxes, office units, and business units in Gouda and Bergambacht.	Office & Workspace → Office Space ¹²⁹²	self storage ²⁰ business unit ¹²⁹ garage box ¹³⁸ space ³⁸⁴⁶ price ⁸³²⁸	Krimpenerwaard → Bergambacht ³⁰³
braalsloopwerken.nl	Braal Sloopwerken	Braal Sloopwerken is a demolition company based in Lekkerkerk that provides demolition services in South Holland and North Holland for both business and private clients.	Building & Materials → Demolition Services ³¹⁷	demolition work ⁶⁷ demolition ¹¹⁴⁴ job ²⁷⁹⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
ligierrotterdam.nl	Ligier Rotterdam	The website of Ligier Rotterdam promotes and sells electric microcars (brommobielen) of the Ligier brand, specifically targeting potential customers in Rotterdam and the surrounding area who are looking for a practical and environmentally friendly mode of transportation.	Car Selling & Valuation → Passenger Cars ⁹⁹² Fuel & Energy → Electric Vehicles ¹²¹²	microcar ⁴⁰ electric ²⁶⁹ groceries ³⁵⁸ freedom ⁸⁴⁸ driver's license ¹²⁸³ parking ¹⁹²⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
gemeentehuisvesting.nl	GemeenteHuisvesting	GemeenteHuisvesting is a knowledge platform focused on developments and innovations impacting the work environment of municipal organizations regarding workspace.	Energy → Heat Generation ⁶⁶ Management & Consulting → Consultants ⁴⁴⁴	operation ⁴⁸⁰ workplace ¹⁰⁴⁶ innovation ⁴⁶⁵⁹ municipality ⁶⁸³⁷ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Bergambacht ³⁰³
witvlietmeubelen.nl	Witvliet Meubelen	Witvliet Meubelen is an interior construction and furniture maker that creates custom interiors and furniture for private and business clients.	Interior → Furniture ⁷⁴⁵⁴ Crafts → Woodworking ¹¹⁰⁹	wood ⁴¹⁵³ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
mangotree-verzekeringen.nl	Mangotree Verzekeringen	Mangotree Verzekeringen provides individual insurance advice and support, emphasizing transparency and personalized guidance.	Insurance → Personal ⁶⁷ Insurance → Commercial Insurance ³⁹²	policy ²¹⁴⁹ insurance ⁶³⁵⁹	Voorne aan Zee → Brielle ⁶¹³
hervormdlekkerkerk.nl	Hervormde Gemeente ‘t Venster	The website of Hervormde Gemeente ‘t Venster in Lekkerkerk provides information about the church, its faith, and the various activities it organizes.	Protestantism → Protestant Church in The Netherlands (PKN) ³⁰¹ Government & Administration → Local Municipalities ²¹⁹	schedule ²⁶²⁴ church ³⁴³⁹ history ⁷²⁸⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
flowgarden.nl	Flow Garden	The Flow Garden website presents itself as a coaching practice that helps individuals with self-discovery, developing authenticity, setting boundaries, and dealing with worries and fears.	Coaching → Relationship Coaching ⁵⁵⁸ Personal Development → Self-Help ¹⁷⁹¹	desire ¹⁹⁶ self-discovery ²⁰⁷ authenticity ³²³ boundaries ⁵⁴⁶ mission ¹⁰⁰⁰ coach ²⁵⁸¹⁰	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
dezet.nl	Dezet Plastics	Dezet Plastics is a manufacturer and supplier of vacuum products, serving various industries and offering customized solutions.	Plastics → Plastics Processing ¹⁵⁴	milling ²⁷⁵ mold ³⁵⁶ plastic ¹²³² machine ³⁷²⁷	Krimpenerwaard → Haastrecht ¹⁹³
ovkelektra.nl	OVKelektra	OVKelektra is an electrical installation company that provides services in Krimpen aan den IJssel and surrounding areas.	Energy → Electricity ⁷¹² Installation & Mounting → Installers ¹⁰⁰⁷	electrician ⁸¹⁹ heat ²¹⁸⁸ data ⁵⁸⁷² installation ¹³⁷⁴²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
kuechenoutlet.nl	Küchenoutlet	Küchenoutlet is a German kitchen outlet in the Netherlands offering affordable German kitchens with a guarantee and fast delivery. The website provides 3D designs, showroom locations, and a tool for comparing kitchen quotes.	Kitchen → Kitchen Design ⁴⁴³ Kitchen → Kitchen Suppliers ⁴³⁷	kitchen design ²⁴ 3d design ¹³¹ showroom ⁴⁸⁸³ kitchen ⁶⁴⁴³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kosinus-elektrotechniek.nl	Kosinus Elektrotechniek B.V.	Kosinus Elektrotechniek B.V. is an electrical installation company that provides services to various sectors.	Electrical Engineering → Electrical Technology ¹⁹⁶ Electric Vehicles → Charging ²⁹¹	power ²⁶¹ charging stations ⁴²¹ installer ⁶⁷⁷ solar panels ⁴⁷⁰¹ light ⁵¹⁴⁸ data ⁵⁸⁷²	Krimpenerwaard → Stolwijk ²³²
praktijkvoormondhygiene.nl	Dental Hygiene Practice	The website of the Dental Hygiene Practice in Hoorn presents the services of dental hygienist Nelleke Zwager, who offers individual dental hygiene and treatment with a focus on healthy mouths. The site provides information about the practice, its approach and procedures.	Dentistry → Dental Hygienist ⁶⁵¹ Body & Movement → Oral Care ³¹⁸	insurance card ¹⁵ dental hygienist ⁵²² oral health ⁶⁸⁶ treatment ²¹²⁰³	Krimpenerwaard → Gouderak ¹⁰³
munierbadkamerspecialist.nl	Munier Installatietechniek	Munier Installatietechniek is a bathroom specialist offering complete bathroom and toilet renovations.	Home Improvement → Plumbing ²⁷³³ Renovation → Bathroom Renovation ⁸³⁴	toilet ⁴⁶⁷ drawing ¹¹⁰¹ bathroom ³⁷⁸⁴ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
zandijkelektro.nl	Zandijk Elektro	The website of Zandijk Elektro presents the electrical installation services that the company offers to both private and business clients.	Environmental Technology → Air Purification ³² Agriculture → Greenhouse & Protected Cultivation ¹⁵⁸	customer base ¹⁷¹ electrical ¹⁴¹⁴ quote ¹²⁸⁶³ installation ¹³⁷⁴²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
levenslicht-verloskundigen.nl	Levenslicht Verloskundigen	Levenslicht Verloskundigen is a midwifery practice that supports women during pregnancy, childbirth, and the postpartum period.	Pregnancy & Childbirth → Midwifery ⁶¹⁹ Health → Medical Care & Services ²⁹⁴⁶¹	postpartum ⁴⁶⁴ ultrasound ⁷⁶⁹ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
leukeauto.nl	Leukeauto.nl	Leukeauto.nl is an automobile dealership based in Bergambacht that offers used cars and financing options.	Loans & Credit → Auto Loans ²⁴² Leasing → Auto Lease ³⁰	used car ⁸²⁵ showroom ⁴⁸⁸³ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵	Krimpenerwaard → Bergambacht ³⁰³
armainfra.nl	Arma Infra B.V.	Arma Infra B.V. is a civil construction company providing various services in the Netherlands, including soil remediation, drainage and roadwork, and earthworks.	Environmental Technology → Soil Remediation ⁵⁸ Civil & Infrastructure → Earthworks ³⁷⁰	civil works ¹⁴ waste container ⁹⁹ soil remediation ¹⁴⁹ roadwork ¹⁵⁶ earthwork ⁴³⁵ drainage ¹³²²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
natasjavandoesburg.nl	Natasja van Doesburg	The website of Natasja van Doesburg is an online platform offering her services as a violin, viola, and keyboard teacher, as well as background music performances with various ensembles.	Live Entertainment → Music Performances ²⁶⁵ Music Education → Violin Lessons ⁶⁶	viola ²¹ keyboard ²³⁷ conservatory ²³⁷ violin ²⁵⁴ duo ³²⁸ performance ⁷⁵⁸⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
goldenriverlekkerkerk.nl	Golden River	The website Golden River from Lekkerkerk offers the possibility to order meals online. It presents a menu with various dishes and a monthly menu, with a focus on Indonesian cuisine.	Asian → Chinese ⁴¹⁵ Food Delivery → Indonesian ⁵⁰²	monthly menu ⁶⁰ spring roll ⁸² nasi ²⁴² satay ³²⁰ soup ¹⁰⁴³ dish ⁵⁹³⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
drogisterijflach.nl	Drogisterij Flach	Drogisterij Flach is a pharmacy and parcel delivery service with locations in Stolwijk and Krimpen aan de Lek.	Freight & Logistics → Courier Services ⁸³⁹ Pharmaceuticals & Medical Products → Pharmacies ¹⁰²⁹	sunscreen ¹²⁵ passport ²⁶³ perfume ⁵³⁴ pharmacy ⁷⁰² ship ⁵¹⁰³ shop ⁶⁴⁸³	Krimpenerwaard → Stolwijk ²³²
okkrimpenerwaard.nl	Ondernemerskring Krimpenerwaard	The Ondernemerskring Krimpenerwaard is an organization that connects and strengthens entrepreneurs in the Krimpenerwaard region, with the goal of representing their material and immaterial interests.	Local Economy & Development → Regional Development ²⁹⁶ Associations & Groups → Business Associations ¹⁰¹⁸	policy ²¹⁴⁹ region ⁵⁴¹² network ¹¹¹²³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
melsrenes-betonvloeren.nl	Betonbedrijf Renes B.V.	The website of Mels Renes Betonvloeren presents the services and expertise of the company in the pouring and finishing of concrete floors for various sectors.	Building & Materials → Concrete ³⁹⁰	concrete floor ¹⁸⁴ factory ⁵²⁶	Krimpenerwaard → Stolwijk ²³²
jagtstoffeerderij.nl	Van der Jagt Stoffeerderij	Van der Jagt Stoffeerderij is a upholstery workshop specializing in restoring and renewing interiors of cars, furniture, boats, campers, and caravans.	Upholstery & Fabrics → Upholsterers ¹⁶⁵ Personal & Household → Household Services ¹⁰⁵⁰	upholstery ⁶⁷³ boat ²⁹⁸⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ car ¹⁰⁸⁶⁵	Krimpenerwaard → Bergambacht ³⁰³
squizzo.nl	Squizzo Architecten	Squizzo Architecten is an architecture firm that designs and executes projects in the Netherlands and abroad, with a focus on residential construction, commercial construction and interior design.	Architecture → Architectural Services ¹⁰⁰⁶ Architecture & Design → Building Consulting ³¹⁴	residential construction ²⁵⁰ permits ⁶⁴³ interior design ¹⁸⁰² sustainability ¹⁸⁴⁵¹	Voorne aan Zee → Oostvoorne ²⁶⁰
fysiotherapie-lek-yssel.nl	Fysiotherapie en Manuele therapie Lek & Yssel	Fysiotherapie en Manuele therapie Lek & Yssel is a practice located in Lekkerkerk and Krimpen aan den IJssel specializing in the treatment of complaints related to the musculoskeletal system.	Physiotherapy → Pediatric Physiotherapy ³²⁷	shockwave ⁹⁸ pelvic physiotherapy ¹⁹⁸ pediatric physiotherapy ²⁵⁸ ultrasound ⁷⁶⁹ manual therapy ¹³²⁰ physiotherapy ⁴⁶⁸⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
boerencampingstolwijk.nl	Boerencamping Stolwijk 'Vreede is Rijckdom'	The website of Boerencamping Stolwijk 'Vreede is Rijckdom' presents a farm camping located in the Beijersche, in the Krimpenerwaard, and offers information about the camping, rates, and photos.	Children’s Activities → Playgrounds ⁷⁰² Animal Encounters → Agricultural Experiences ²⁸	cattle ¹⁶⁷ play equipment ¹⁷³ polder ⁴⁷⁶ camp ²⁴⁶⁶ farm ²⁶²²	Krimpenerwaard → Stolwijk ²³²
dakdekkersoverzicht.nl	Dakdekkersoverzicht.nl	This website, dakdekkersoverzicht.nl, is a directory designed to help users find a roofing contractor in their region.	Online & Digital → Online Directories ⁸⁶	roofing contractor ⁷⁸ directory ¹⁷⁶ province ⁵¹⁸ region ⁵⁴¹² municipality ⁶⁸³⁷	Het Hogeland → Leens ¹⁰⁴
vuurwerkgouda.nl	Hoogeveen Vuurwerk Gouda	Hoogeveen Vuurwerk Gouda is a firework webshop and store located in Gouda offering a wide assortment of fireworks, stunts, and cake deals.	Party Supplies → Fireworks ²⁵⁸ Parties → New Year ¹⁸	stunts ¹⁰ compound ⁶⁰ fireworks ⁴¹³ cake ¹⁷³⁰ package ⁶¹¹²	Zuidplas → Moordrecht ³³²
rondekozijnen.nl	The Gebogenhoutfabriek	The Gebogenhoutfabriek specializes in producing and supplying a wide range of round and oval wooden frames, windows, and other wooden products.	Windows → Frames ¹²¹¹ Crafts → Woodworking ¹¹⁰⁹	fabrication ⁵⁶ customer focus ¹⁰⁰ window ²⁰³⁰ frames ²⁵⁵⁶ wood ⁴¹⁵³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
autorestauratiesarmen.nl	Autorestauraties Armen	The website of Autorestauraties Armen showcases their services and projects related to car restoration and welding.	Auto Repair Services → Body Repair ¹⁰ Metalworking → Welding ⁸⁹³	bodywork ³¹⁹ welding ¹⁰⁵¹ part ⁵⁰⁴⁴	Krimpenerwaard → Vlist ³⁷
ongediertebestrijdingdewaard.nl	Ongediertebestrijding De Waard	The website of Ongediertebestrijding De Waard provides services for the control of various types of pests, including wasps, woodlice, moles and summer pests. The website also offers information, tips and news about pest control.	Control → Pest Control ⁸²⁴ Maintenance & Repair → Facility Services ⁶⁷¹	nest ¹⁴⁰ wasps ¹⁸¹ pests ²⁰¹ control ⁹¹¹ tips ²⁷⁸⁹	Utrecht → Vijfheerenlanden ¹⁹⁷⁷
sodan.nl	Cleaning Solutions International B.V.	The Sodan® Coatings website offers solutions for restoring and maintaining various surfaces, including powder-coated materials, metals, plastics, glass, and stainless steel.	Cleaning Services → Industrial Cleaning ⁸⁵ Cleaning Services → Facade Cleaning ⁴¹⁸	surface ¹³⁰ stainless steel ⁷³⁷ coating ⁸⁰⁶ glass ²⁹¹⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Gouderak ¹⁰³
swv-po-mh.nl	Samenwerkingsverband PO Midden-Holland	The website of the Samenwerkingsverband PO Midden-Holland (SWVPO) provides information and resources about inclusive education for elementary school students within the collaboration.	Education → Educational Policy & Systems ⁵³⁹ Education → Special Needs & Support ⁶³⁷²	school district ²⁰ inclusive education ⁸⁴ newsletter ⁶⁵⁰⁴ student ⁷⁶²³ school ⁷⁸⁵⁶	South-Holland → Alphen aan den Rijn ³⁹⁷⁸
oversluizen.nl	Oversluizen Bouwkundig Adviesbureau	Oversluizen Bouwkundig Adviesbureau is a construction advisory agency offering services in the areas of construction management, construction supervision and permit applications.	Architecture → Architectural Services ¹⁰⁰⁶ Project Management → Construction Management ¹⁰³⁸	building permit ⁶² construction supervision ¹⁸⁷ construction management ¹⁹⁹ drawings ¹³²⁹ project management ³⁴²³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
knbbmiddenholland.nl	KNBB Midden Holland	The website of KNBB Midden Holland provides information about billiards under the KNBB’s flag in the Midden Holland district, including governance, associations, teams, programs, results, and communication.	Card Games → Bridge ¹⁸⁶ Team → Billiards ³⁶⁵	knbb ¹³ billiard ³⁴¹ district ³⁷¹ results ³⁹⁵⁴ competition ⁴⁷⁵⁹ association ⁸⁵⁶²	Alphen aan den Rijn → Boskoop ⁶⁵²
ggzflexibel.nl	GGZ Flexibel	GGZ Flexibel offers flexible and social psychiatric care, including individual coaching and interim care management.	Health → Mental & Emotional Well-Being ²³⁷⁰⁴	vulnerability ¹⁴⁹ care ¹²³³⁸ treatment ²¹²⁰³ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
carservicekrimpenerwaard.nl	CarXpert Car Service Krimpenerwaard	CarXpert Car Service Krimpenerwaard is a garage in Lekkerkerk offering maintenance, repair, and APK (vehicle inspection) services for all car brands, including hybrid and electric vehicles, along with tire services, diagnostics, and roadside assistance.	Tires → Tire Service ⁹³¹ Automotive Maintenance → Vehicle Inspection ¹¹⁰²	diagnostics ⁶⁸⁷ apk ¹³³³ tire ¹⁹⁷⁵ vehicle ³⁷⁴³ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
fitdepot.nl	Fit Depot	The website of Fit Depot showcases a health club with various facilities and services, including personalized coaching, Technogym equipment, and a BIOCIRCUIT fitness program.	Group Class → Fitness Centers ¹⁰¹⁰ Sport Facility → Sports Centers ⁴³⁹	biocircuit ¹⁹ training plan ¹²² equipment ⁴¹⁴³ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mondzorgaandelek.nl	Mondzorg aan de Lek	Mondzorg aan de Lek is a dental practice located in Krimpen aan de Lek that offers various services and information to patients.	Veterinarians → Veterinary Clinics ⁴¹⁹	dentistry ⁶⁰⁶ prevention ¹⁷⁶³ dentist ²⁵¹⁴ patient ⁴⁰⁸²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
tandartsbergambacht.nl	Tandartspraktijk Bergambacht	The website of Tandartspraktijk Bergambacht provides information about the practice, treatments, team members, and contact details.	Dentistry → Implantology ³⁰⁴	oral hygiene ²⁵⁶ prevention ¹⁷⁶³ dentist ²⁵¹⁴ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
tandartsvanes.nl	Praktijk voor Tandheelkunde E.W. van Es	The website of Praktijk voor Tandheelkunde, Tandarts van Es in Schoonhoven offers information about the practice, its range of treatments and services, and contact details.	Dentistry → Oral Hygiene ⁷⁵⁰	root canal ¹⁵ hygienist ¹⁹⁰ denture ⁴⁶² dentist ²⁵¹⁴ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vdvsolartechniek.nl	VDV Solar techniek	VDV Solar techniek is a company specializing in the supply and installation of solar panels and sustainable energy solutions in Gouda and Krimpenerwaard.	Installation & Mounting → Installers ¹⁰⁰⁷	solar panels ⁴⁷⁰¹ energy ⁹⁰⁷⁵ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	South-Holland → Gouda ³⁵²¹
schildersbedrijflekstreek.nl	Schildersbedrijf Lekstreek	Schildersbedrijf Lekstreek provides professional painting and repair services to homeowners, VVEs (homeowners associations), and businesses in the Alblasserwaard region and surrounding areas.	Home Improvement → Decorating ³³³ Insulation → Glazing ¹⁸⁸	timber repair ³⁸ wall finishing ³¹⁰ paint ⁸⁷⁴⁷	South-Holland → Alblasserwaard ²⁸¹
glaszetter-nu.nl	glaszetter-nu.nl	The website glaszetter-nu.nl is a platform that helps consumers find a local glazenzetter (glazier) in their region. It provides a directory of glazers in various provinces of the Netherlands.	Windows → Glazier ⁴⁴⁰	glazier ¹⁷⁴ province ⁵¹⁸ region ⁵⁴¹²	Westerkwartier → Zuidhorn ²⁸⁶
pbfk.nl	Praktijk Bekken Fysiotherapie Krimpenerwaard	The website of Praktijk Bekken Fysiotherapie Krimpenerwaard offers physiotherapy focused on pelvic problems, lower back pain, and pelvic floor dysfunction for both men and women.	Physiotherapy → Pelvic Physiotherapy ¹³⁷ Health → Pregnancy & Childbirth ⁴²²²	pelvic ²⁶ pelvic floor ¹¹⁷ pain complaints ¹²⁵	Krimpenerwaard → Bergambacht ³⁰³
zorgmaatjeskrimpenerwaard.nl	Zorgmaatjes Krimpenerwaard B.V.	Zorgmaatjes Krimpenerwaard BV provides household help to seniors in the Krimpenerwaard region, enabling them to stay at home for as long as possible.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Care → Personal Care ⁵⁹²	help ⁸⁶⁴ task ¹⁵⁰⁷ wishes ²⁷¹⁷ environment ⁴⁸⁷³ care ¹²³³⁸
verkeersmaquette.nl	Verkeersmaquette	The website presents the Traffic Model, a tool for traffic education.	Traffic Management → Traffic ⁵⁸⁹ Driving & Vehicle → Transportation Education ⁶³	traffic education ²⁴ manual ⁹⁶ model ³⁵⁴⁶ student ⁷⁶²³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
rct-rivierenland.nl	N/A	The website presents a collection of recent articles and posts on various topics, including local news, financial developments, and tips.	Content Creation → Online Money Making ³¹ Context ¹⁶¹³⁹⁴	freelance ¹⁶⁹ village ⁸⁰⁸ exam ²¹²⁰ finance ⁵³⁴¹ insurance ⁶³⁵⁹	Emmen → Erica ¹²³
cafa.nl	Capaan Falkeisen	The website of Capaan Falkeisen is a houseboat broker that helps individuals with the purchase, sale, valuation, and certification of houseboats, house barges, and floating homes. They offer advice on financing and operate in the Amsterdam region.	Water → Boating ¹⁵⁹² Water → Boats ⁹³⁵	floating home ¹² houseboat ¹³⁰ mooring ¹⁵³ valuation ²⁶⁹⁷ finance ⁵³⁴¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
kinderopvangtoeslagaanvragen.nl	Ministry of Social Affairs and Digitalization (SZW)	This website provides information and an application procedure for childcare subsidy (kinderopvangtoeslag).	International Travel → Visas ⁹³ Early Years → Childcare ⁶⁰²⁹	condition ⁴²⁵ application ³³⁷⁷ municipality ⁶⁸³⁷	Amsterdam → Weesp ¹⁰⁰⁵
schooninhuis.nl	Schooninhuis	The website of Schooninhuis offers professional upholstery cleaning and stain removal services, targeting both private and business clients.	Cleaning Services → Carpet Cleaning ⁸⁴	sofas ³²² carpet ⁸⁴⁰ mattress ⁸⁹⁹ chair ¹²²³ cleaning ⁴⁵⁶⁷ furniture ⁸⁷⁵¹	Schagen → Tuitjenhorn ³⁸²
loodgieter-bergambacht.nl	Loodgieter Bergambacht	Loodgieter Bergambacht is a local plumber offering 24/7 service and various plumbing services in Bergambacht and surrounding areas.	Regional News → Province of North Brabant ⁶³ Home Improvement → Plumbing ²⁷³³	plumber ¹²¹⁰ rate ²⁶⁰⁶ warranty ⁴⁷⁰¹	Krimpenerwaard → Bergambacht ³⁰³
loodgieter-stolwijk.nl	Loodgieter Stolwijk	Loodgieter Stolwijk is a plumbing company in Stolwijk that offers 24/7 emergency service and various plumbing services.	Home Improvement → Plumbing ²⁷³³ Maintenance & Repair → Plumbers ⁸⁷⁹	sanitary ware ⁶⁶⁹ plumbing ¹⁷⁶¹ heat ²¹⁸⁸ warranty ⁴⁷⁰¹ quote ¹²⁸⁶³	Krimpenerwaard → Stolwijk ²³²
neetnetworks.nl	Neet Networks B.V.	Neet Networks is a company specializing in datanetworks, prioritizing customer needs and offering services like installation, consulting, design, and certification.	Networking → Network Installation ¹³⁰	data network ⁹⁰ fiber optic ²⁷⁹ measurement ⁷³¹ certification ³³⁸⁰ consulting ³⁶³⁹ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
nebularia.nl	Stichting Vogelringstation Nebularia	The website of Stichting Vogelringstation Nebularia presents information about the foundation, its activities, and projects, primarily focused on scientific bird inventory and protection.	Ornithology → Bird Conservation ¹⁷⁰	protection ⁷²⁸ bird ⁹²² monitor ¹⁰⁶³ research ⁸⁹⁶⁷ news ¹⁵²⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
stravermotoren.nl	Straver Motoren	Straver Motoren is a recognized motor dealer offering motorcycle storage, maintenance, repair, and the sale of used motorcycles.	Motorcycles & Scooters → Motorcycles ²⁴⁷⁶ Automotive Maintenance → Motorcycle Maintenance ¹⁰⁷	motorcycle ²¹¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vdb-funderingstechnieken.nl	VDB Funderingstechnieken B.V.	The website of VDB Funderingstechnieken presents the services and expertise of the company in the field of foundation techniques, with a focus on providing solutions for various construction projects, from new construction to foundation repair.	Construction Technology → Foundation Technology ¹³⁵	foundation techniques ¹² foundation ⁶⁶⁷⁸	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
touwslagerij-schouten.nl	Touwslagerij Gebr. Schouten	Touwslagerij Gebr. Schouten is a rope manufacturer that produces and sells a wide range of ropes, cable lugs, and leguanes.	Engineering → Marine Engineering ¹⁰² Manufacturing → Textile Manufacturing ⁵⁹	fabrication ⁵⁶ rope ¹⁰³ machine ³⁷²⁷ production ⁴⁵⁸²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
portofino-online.nl	Portofino Pizzeria & Grillroom	The Portofino Pizzeria & Grillroom website provides information about its locations in Haastrecht and Spijkenisse, including opening hours and online ordering options.	Grilling & Steaks → Steakhouse ¹⁹⁵ Grilling & Steaks → Grillroom ⁸⁷	grill ⁵⁶² pizza ⁴¹⁵⁸ restaurant ¹¹²¹⁵	Krimpenerwaard → Haastrecht ¹⁹³
mcslootjes.nl	Marc C. Slootjes	This website showcases the work of Dutch artist Marc C. Slootjes and provides information about his exhibitions, publications, and contact options.	Painting → Painters ⁹⁰ Painting → Contemporary Painting ⁴⁵²	gallery ¹⁹⁸³ art ³⁸⁵⁶ exhibition ⁵³³² artist ⁵⁷⁴⁵ book ¹¹³⁹⁶	Krimpenerwaard → Haastrecht ¹⁹³
keesleest.nl	BTSW Groep B.V.	Kees Leest is a method developed by BTSW to assist children struggling with reading and/or spelling difficulties, emphasizing the utilization of their strengths.	Learning Disabilities → Dyslexia ⁴³⁸ Pedagogy & Methods → Learning Methods ¹⁸⁵	dyslexia ⁴⁰⁸	Haarlemmermeer → Hoofddorp ²⁷³⁹
vanderbashoveniers.nl	Van der Bas Hoveniers	Van der Bas Hoveniers is a quality landscaper in the Randstad region offering garden design, landscaping, maintenance, and soil analysis services.	Garden Maintenance → Landscapers ²⁸⁷ Ponds → Pond Maintenance ⁷⁹	pond ⁶⁸⁶ soil ⁹³⁰ landscaping ¹⁵²⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Almere → Almere City ⁹³⁴
devoorhaven.nl	De Voorhaven	Stedenbouwkundig bureau De Voorhaven provides spatial planning and design advice to commercial and public clients.	Planning & Development → Spatial Planning ⁸⁸⁹ Measurement → Geographic Information Systems ²⁰	spatial planning ¹⁹⁰ plan ²⁵⁶⁶ landscape ²⁶⁰⁹ building ³²⁰⁴ space ³⁸⁴⁶ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jointforcegroup.nl	JointForce Group	The website of JointForce Group presents the collaboration between three companies – Pas Panelen, KomCo, and JointForce Development – which focus on sandwich panels, composite constructions, and prefabricated building solutions, respectively.	Sustainable Construction → Materials ¹⁰⁴³ Fabrication & Production → Prefabrication ⁴¹²	sandwich panels ⁷² innovation ⁴⁶⁵⁹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Stolwijk ²³²
luma-drukwerkservice.nl	LUMA Drukwerkservice	LUMA Drukwerkservice is a printing company located in Stolwijk that offers a wide range of printing and printing services to businesses, organizations, and individuals.	Graphic Design → Print Services ²⁷ Digital Media & Design → Graphic Industry ⁶⁵	machine park ⁶⁴² card ¹⁹⁷⁵ coffee ³⁸³⁸ print ⁵⁵¹¹ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
breda-elektricien.nl	RV Elektra	The website of RV Elektra is an online platform offering electrical services in Breda and surrounding areas, specializing in electrical panels, sustainable energy solutions, and certifications.	Lighting & Electrical → Utilities ³⁸⁸	electrical panel ¹⁵³ electrician ⁸¹⁹ inspection ⁴²⁷⁹ solar panels ⁴⁷⁰¹ quote ¹²⁸⁶³ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
osteopathie-krimpenerwaard.nl	Osteopathie Krimpenerwaard	The website of Osteopathie Krimpenerwaard provides general information about osteopathy, treatments, fees, and reimbursement policies.	Physical Therapy → Osteopathy ⁹²² Medical Care & Services → Pediatric & Child Health ²¹²¹	reimbursement ⁴⁶⁵ fee ⁶⁴⁰ osteopathy ⁸⁰⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
elektricienlekkerkerk.nl	Electrician Lekkerkerk	The website of Electrician Lekkerkerk provides electrical services and emergency services to residents and businesses in Lekkerkerk.	Energy → Electricity ⁷¹²	emergency ⁷⁵⁰ electrician ⁸¹⁹ warranty ⁴⁷⁰¹ quote ¹²⁸⁶³	Krimpenerwaard → Lekkerkerk ²⁴⁴
elektricienschoonhoven.nl	Elektricien Schoonhoven	Elektricien Schoonhoven provides 24/7 electrical services, including emergency repairs and installations, with clear rates and extensive experience.	Energy → Electricity ⁷¹²	electricity ⁷⁴⁵ electrician ⁸¹⁹ warranty ⁴⁷⁰¹ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
schoolspullenpas.nl	Hawk Incentive B.V.	The website provides information about the Schoolspullenpas, a program that provides children with extra school supplies.	Child Welfare → Child Support ⁴⁴ Schools → School Supplies ⁹⁴	clothing bank ³⁸	Voorne aan Zee → Hellevoetsluis ⁹⁷²
vooq.nl	Vooq.	Vooq. is a recruitment and assessment agency specializing in connecting skilled engineers and IT professionals with career advancement opportunities.	Online Services → Job Boards ¹⁰³⁶ Manufacturing & Industrial → Engineering ³⁹¹⁹	engineer ¹⁹⁸ assessment ¹²⁰⁵ engineering ¹⁴⁶⁸ it ¹⁵³⁹ career ²⁵¹³ vacancy ⁶⁵⁹⁸	Lansingerland → Bleiswijk ⁵⁷⁹
wesselspoelder.nl	Wessel Spoelder	The website of Wessel Spoelder showcases a portfolio of professional photography, with a focus on event photography, portrait photography, reportage photography, and corporate photography. The site offers services for various events, museums, and companies, and also includes a selection of photos from different projects.	Communication → Visual Communication ⁴⁰⁹	reportage ³²⁷ portrait ³⁶⁸⁵ photography ⁹⁵⁰³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wijnhuisdenboer.nl	Wijnhuis Den Boer	Wijnhuis Den Boer is a spirits shop with an online webshop and a physical store in Krimpen aan de Lek, offering a wide assortment of wines, whiskies, and other distilled beverages.	Coffee & Tea → Beverages ⁴⁴⁵³ Coffee & Tea → Beverage Stores ⁵⁶	whisky ³⁷³ promotion ²⁰⁶² wine ⁴⁴⁷⁶ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
mymove.nl	MyMove Krimpenerwaard	The MyMove Krimpenerwaard website presents a wide range of sports and fitness services, including fitness, group fitness, dancing, personal training, physiotherapy, and a kids club, aimed at people of all ages and levels in the Krimpenerwaard region.	Group Class → Fitness Centers ¹⁰¹⁰ Personal & Household → Fitness Services ¹⁶²	personal training ¹²⁷¹ group classes ¹³⁰⁶ dance ¹⁸³⁴ fitness ²²⁵¹ physiotherapy ⁴⁶⁸⁸	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
klokkenmakerijdetijd.nl	Klokkenmakerij de Tijd	“Klokkenmakerij de Tijd” is a company specializing in the restoration and repair of clocks, both antique and modern.	Crafts → Clockmaking ⁵¹ Home → Antiques & Collectibles ¹⁵²³	dial ¹⁰ clocks ¹⁷⁸ craft ⁵³⁸ technique ²¹⁵⁷ restoration ³⁴¹⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
grjw.nl	Gemeenschappelijke Regeling Jeugd en Wmo Midden-Holland	This website serves as an information resource for the Gemeenschappelijke Regeling Jeugd en Wmo Midden-Holland (GR JW) and its functions within the social domain.	Social Issues & Welfare → Social Affairs ⁶⁰¹	report ⁴⁵⁵¹ municipality ⁶⁸³⁷ care ¹²³³⁸	South-Holland → Zuidplas ¹¹²²
segadicanto.nl	Vocaal Ensemble Sega di Canto Koor	The Vocaal Ensemble Sega di Canto Koor is a mixed choir dedicated to performing classical choral music, with a particular focus on modern choral pieces from the 20th and 21st centuries.	Choir → Mixed Choir ²³¹	conductor ¹²¹⁷ choir ³¹²³ concert ⁴⁴⁰⁹ music ¹³¹⁷⁰	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
stigterinterieur.nl	Stigter Interieur	Stigter Interieur is a home interior specialist based in Schoonhoven offering advice and helping customers furnish their homes with flooring, window coverings, and furniture.	Bedroom → Bedroom Furniture ¹⁵¹ Interior → Window Coverings ¹⁰²⁶	closet ⁹³ window coverings ¹²¹³ bed ¹³⁸⁴ floor ⁴⁷⁸¹ home ⁷⁹⁷⁶ interior ⁸⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
infra-sdo.nl	Infra SDO	The website Infra SDO provides a collaboration between Stedin, Dunea and Oasen, which efficiently organizes infra combi projects, particularly residential construction, commercial spaces and reconstructions, and coordinates the associated meetings.	Relationships → Partnerships ⁴⁸¹ Social Organization → Networking Organizations ⁴⁷⁵	reconstruction ⁸⁹ residential construction ²⁵⁰ meetings ¹⁰¹¹ region ⁵⁴¹² collaboration ¹⁶⁰³⁶	South-Holland → Molenlanden ¹³⁴⁹
buitenkans.nl	Buitenkans Aankoopmakelaars	Buitenkans Aankoopmakelaars is a property purchasing agency specializing in assisting clients with buying homes and land plots in rural areas.	Property Sales → Buying a House ⁸⁷² Property Finance → Buying ²⁵⁴	dream house ⁵⁹ buyer ²³³ plot ¹⁰⁵¹ advisor ¹⁰⁵⁵ property ⁷⁴⁰⁶	Krimpenerwaard → Bergambacht ³⁰³
krimpenerwaardintercultureel.nl	Krimpenerwaard Intercultureel	Krimpenerwaard Intercultureel (KIC) is an organization that helps asylum seekers integrate into the Krimpenerwaard community and feel at home.	Social Organization → Integration Organizations ³⁷ Language Learning → Language Courses ⁷⁶⁹	asylum seekers ⁹⁶ community ⁷⁹³¹	Krimpenerwaard → Bergambacht ³⁰³
crempene.nl	Historical Society Crempene	The website of the Historical Society Crempene aims to promote and maintain the history and culture of the municipality of Krimpen aan de Lek.	Local History → Dutch History ¹⁰⁶⁷ Local Communities → Villages ¹⁰⁰⁵	postcard ²⁷⁸ culture ³⁹²² exhibition ⁵³³² history ⁷²⁸⁶ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
olifantendamesbloot.nl	Olifantendamesbloot	The website presents a book about the ijsselstone industry in the Hollandsche IJssel region, focusing on the historical context, stone quarries, and the families involved in its production.	Local History → Dutch History ¹⁰⁶⁷ Specialized History → History of The Netherlands ⁷⁴	stone oven ¹²	Zuidplas → Moordrecht ³³²
aimcommunication.nl	Aim Communication	The website of Aim Communication offers communication advice, providing creative and decisive solutions for projects of governments and non-profit organizations. Marielle van de Hulst, the communication advisor, focuses on collaboration and motivating action.	Content & Communication → Marketing Communication ³¹⁷ Management & Consulting → Consultants ⁴⁴⁴	communication tool ¹⁵ communication advice ⁶⁰ authenticity ³²³ goal ⁴⁹⁷⁴ collaboration ¹⁶⁰³⁶	Amsterdam → West ⁷⁷⁷
schoonhovenseapotheek.nl	Apotheek Schoonhovense Apotheek	The Schoonhovense Apotheek website provides a range of pharmacy services and information about medications, including repeat prescriptions, delivery, and questions about medication.	Pharmacies → Local Pharmacies ⁵⁹ Legal & Financial & Career → Health Insurance ⁵¹⁹	pharmacy ⁷⁰² medication ¹¹⁶⁴ registration ⁴³⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
crealisation.nl	Crealisation	The Crealisation website describes an architecture firm that supports private and business clients with the construction, renovation, expansion, and sustainable renovation of homes and buildings. The firm offers a wide range of services from permit applications to complete new construction projects.	Architecture → Architectural Services ¹⁰⁰⁶	permits ⁶⁴³ new construction ²⁶⁷² architecture ³²²³ home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	North-Brabant → Roosendaal ²⁶⁷⁷
kostenwebdesigner.nl	kostenwebdesigner.nl	The website presents a list of web designers active in various regions of the Netherlands. It offers an overview of locations and contact information.	Office & Workspace → Business Directories ⁴²¹	webdesigner ⁴⁰ province ⁵¹⁸	Zwartewaterland → Genemuiden ⁴⁰⁵
tandartspraktijk-oudewater.nl	Tandartspraktijk Oudewater	The website of Tandartspraktijk Oudewater provides information about the practice, treatments, opening hours, and contact details for patients in the Oudewater, Haastrecht, Waarder, Linschoten, and Montfoort region. The goal is to inform patients and schedule appointments.	Dentistry → Emergency Dentistry ⁸⁰	teeth ⁶⁸⁰ dentist ²⁵¹⁴ opening hours ²⁹⁵³ patient ⁴⁰⁸² practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Montfoort → Linschoten ¹⁶⁹
felixheuberger.nl	Atelier Felix Heuberger	Atelier Felix Heuberger is a website of a goldsmith who creates personalized jewelry with a story.	Jewelry → Handmade Jewelry ⁸⁶² Crafts → Goldsmithing ¹⁶⁸	angel ¹¹⁰ goldsmith ²²⁴ ring ⁸⁰⁰ gold ⁸⁰⁵ jewelry ⁴⁵⁹⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
muziekfabriekschoonhoven.nl	Stichting Schoonhoven Klassiek	The website of Muziekfabriek presents a musical event featuring a special performance by Lydia and Boudewijn Zwart, offering an interactive show with beiaard music, puppet show and educational elements.	Children’s → Children’s Concerts ¹⁴ Music Education → Children’s Music ²¹	organ ⁶³³ performance ⁷⁵⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
slagerijmarkus.nl	Slagerij Markus	The website of Slagerij Markus presents a traditional butcher shop specializing in high-quality meat, meat products, and various meal options, and is affiliated with the collective De Gildeslager.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	sausage ²⁵⁶ meal ¹⁶³⁸ craftsmanship ¹⁸⁵⁸ meat ²⁰⁵⁵	Krimpenerwaard → Gouderak ¹⁰³
pensionammerstol.nl	Pension Ammerstol	Pension Ammerstol is a pension in Ammerstol, located in the Krimpenerwaard region, offering four apartments for two people. The website provides information about the accommodation, the surroundings, and prices.	Accommodation → Pensions ⁴⁶ Tourism → Regional Tourism ²⁴²	cycling route ⁴⁵¹ apartment ⁵⁰⁸⁸	Krimpenerwaard → Ammerstol ⁴⁹
cesarschoonhoven.nl	Praktijk voor Oefentherapie Cesar Schoonhoven	The website of Praktijk voor Oefentherapie Cesar Schoonhoven provides information about the practice, its therapy offerings, and the background of the practitioner.	Pediatric & Child Health → Sleep Problems ²⁶⁶ Physical Therapy → Exercise Therapy ³⁵⁴	quality register ⁵⁶ sleep therapy ¹⁰¹ haptonomy ¹²¹ exercise therapy ²⁴⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
inulatexla.nl	Praktijk Cocky den Duyf	The website of Inula Texla offers coaching and counseling services, focusing on adults and children, with a particular emphasis on grief processing, burnout, and career coaching, and provides a location in Schoonhoven and a studio rental on Texel.	Therapy → Alternative Therapies ⁸⁶⁵	grief ¹⁵⁷⁷ session ¹⁷⁹¹ creativity ²⁵³¹ therapy ⁷⁴⁴⁸ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
fietsvitaal.nl	FietsVitaal	FietsVitaal is a shop specializing in electric bikes and offers them for sale and service to customers.	Cycling → Electric Bikes ⁴⁴⁵ Bicycles → Electric Bicycles ⁴⁰²	e-bike ⁹⁰⁸ bike ¹⁵⁴¹ battery ¹⁷⁵¹ brand ¹⁷⁷³⁷	Krimpenerwaard → Stolwijk ²³²
jckrimpenerwaard.nl	Judoclub Krimpenerwaard	The website of Judoclub Krimpenerwaard presents the judo club, its services and activities, aimed at offering judo training for all levels and promoting membership.	Martial Art → Judo ³⁸⁹ Combat → Sports Schools ⁸⁶	dojo ²³⁰ judo ³⁷⁵ tournament ²⁴⁷⁶ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴² training ²⁸¹³³	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
kinderopvangnederlek.nl	Stichting kinderopvang Nederlek	Kinderopvang Nederlek is a childcare organization offering daycare and after-school care in Krimpen aan de Lek and Lekkerkerk.	Childcare → After-School Care ⁷⁶⁵	after school care ²⁰² skills ¹¹⁰⁵ daycare ¹³⁶⁵ childcare ³⁵¹²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
pjgberkenwoude.nl	PJG Berkenwoude	The website of Tentfeest PJG Berkenwoude provides information about the annual tent party held in Berkenwoude, including details about the date, time, location, ticket prices, and rules.	Festivals → Music Festivals ¹⁰²⁰	tent party ¹⁰ rules ⁵⁹³ ticket ²⁷⁸⁵	Krimpenerwaard → Berkenwoude ⁶²
yourflowers.nl	Your Flowers	Your Flowers is a florist in Stolwijk offering bouquets, houseplants, and accessories, as well as services for weddings, funerals, and subscriptions.	Flowers → Florists ¹⁴¹⁰ Trade → Trading Companies ¹⁷⁹	houseplant ¹¹¹ corporate ¹²⁰ bouquet ¹¹⁴⁷ flowers ³²⁴⁸ wedding ⁴²⁵⁸ accessories ¹²⁹⁷⁵	Krimpenerwaard → Stolwijk ²³²
mshv.nl	Meubelstoffeerderij Hans Verhoeven	Meubelstoffeerderij Hans Verhoeven offers upholstery and repair services for furniture, vehicles, and accessories.	Furniture → Upholstery & Fabrics ¹⁰⁴⁵	seat ²¹⁸ caravan ¹³⁹⁴ fabric ¹⁶⁴⁴ furniture ⁸⁷⁵¹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶	Lopik → Polsbroek ⁴⁹
vonkkaas.nl	Vonk Kaashandel	Vonk Kaashandel is a cheese trading company specializing in the sale and distribution of cheese.	Local & Regional Products → Agricultural Products ¹⁴¹	ripen ²⁶ wholesale ²⁸⁰ retail ⁵⁸⁶ cheese ¹²⁰⁵	Krimpenerwaard → Stolwijk ²³²
ehboouderkerk.nl	EHBO vereniging ‘Hulp in Nood’	The website of the ‘Hulp in Nood’ EHBO (First Aid) Association from Ouderkerk aan den IJssel provides information about EHBO courses, practice evenings, and the deployment of AEDs in the area. The aim is to inform citizens and to register for training sessions and to present the association's services.	Prevention → First Aid ¹⁰⁷⁰	practice evening ¹³ ehbo ¹⁵⁸ aed ⁴⁹⁰ course ¹⁴⁷²⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
beekbouw.nl	BeekBouw Krimpenerwaard	BeekBouw Krimpenerwaard is a construction company specializing in renovation, interior construction, new construction, and restoration, with a focus on sustainability.	Construction Companies → Residential Construction ¹⁰¹³ Construction Industry & Methods → Sustainable Construction ¹³⁹¹	sustainable ⁷³⁹ restoration ³⁴¹⁷ interior ⁸⁰⁹³ renovation ¹³⁸⁴⁹
blonk.nl	BLONK	The website aims to present BLONK.NL as a steel company specializing in custom steel products and constructions.	Garden → Fences ⁸²⁴ Manufacturing → Metals & Fabrication ¹²²⁴	stair ⁸¹⁵ steel ¹¹⁷⁷ structure ¹³⁰⁵ fence ¹⁸¹⁴ window ²⁰³⁰ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rijschoolkalai.nl	Rijschool Kalai	Rijschool Kalai is an auto and motorcycle driving school offering driving lessons and motorcycle lessons.	Driver & Vehicle → Continuing Education ⁴⁵⁴ Driving & Lessons → Motorcycle Lessons ³⁵¹	motorcycle school ¹⁶ driving lesson ⁷¹² license ¹²⁸⁸ instructor ³¹²⁶ package ⁶¹¹² course ¹⁴⁷²⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
frietmanvanvugt.nl	Frietman & Van Vugt Bedrijfsadvies	Frietman & Van Vugt Bedrijfsadvies provides a wide range of business advice, including financial, tax, legal, and HR services, aimed at helping entrepreneurs realize their ambitions.	Human Resources → Payroll ⁵¹⁵ Business Services → Finance & Accounting ⁶⁶¹³	business advice ¹⁷⁹ financial ⁸⁵⁵ hr ⁸⁸⁴ legal ⁹³⁷ tax ²¹⁰⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
molendijkschilt.nl	Molendijk Schilt B.V.	Molendijk Schilt B.V. is a distributor of cutting tools and machines, primarily for the construction and steel industries, offering a wide range and professional service.	Garden Maintenance → Pruning ³⁰	steel ¹¹⁷⁷ industry ¹⁷⁸⁰ machine ³⁷²⁷ tool ³⁹⁰⁷ construction ⁷⁴²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tulsadvocatuur.nl	Tuls Advocatuur en Mediation	The website of Tuls Advocatuur en Mediation presents the services of Mirjam Tuls, a lawyer and mediator specializing in family law in the Krimpenerwaard, and offers legal support for separations and other family matters.	Family Law → Divorce ⁸⁹⁴	family matters ¹² parenting plan ¹⁹⁴ alimony ³¹⁴ divorce ⁹⁰² mediation ²⁷⁸⁷
lekgoed.nl	Lekgoed BV	The website showcases real estate projects and services, with a focus on new construction and the renovation of existing properties.	Commercial Property → Commercial Space ⁴⁸⁹ Commercial Property → Industrial Space ¹⁸	unit ⁴⁰⁵ real estate ⁴⁹⁸¹	Krimpenerwaard → Bergambacht ³⁰³
vrekadesign.nl	Vrekadesign	The website Vrekadesign offers professional and eye-catching advertising and styling solutions, primarily focused on automotive advertising, window film, car wrapping, and corporate clothing.	Advertising → Lettering ⁵⁶⁹	automotive advertising ¹¹ corporate clothing ¹⁰³ carwrapping ¹²⁷ window film ¹³⁵ online shop ¹³¹⁰ advertising ²³⁰²	Krimpenerwaard → Stolwijk ²³²
abcontainers.nl	AB Containers B.V.	AB Containers is a company that provides container rental, waste removal, and demolition services.	Building & Materials → Demolition Services ³¹⁷ Waste Management → Container Rental ³⁶⁸	roll container ⁴⁵ demolition ¹¹⁴⁴ waste ¹³¹² groundwork ¹³⁴⁸ container ¹⁷⁰⁹	Krimpenerwaard → Bergambacht ³⁰³
wijzijnoogst.nl	Oogst	Oogst’s aim is to help people eat healthily every day by offering 100% natural and traditionally made food products.	Fish & Seafood → Fresh Food ⁵²	food products ⁵⁶ sales points ⁸⁸ online store ⁹⁰⁵ soup ¹⁰⁴³	Wijdemeren → Nederhorst den Berg ²⁰⁷
ziejulliezo.nl	Ziezo kinderopvang	Ziezo Kinderopvang offers BSO, VSO, and Peuteropvang services in Schoonhoven and Ammerstol, prioritizing children’s development and well-being.	Childcare → After-School Care ⁷⁶⁵	bso ³³⁵ childcare ³⁵¹² parent ⁴³¹⁸	Krimpenerwaard → Ammerstol ⁴⁹
privesaunametkorting.nl	Privé Sauna with discount	The website of Privé Sauna with discount offers exclusive private sauna experiences in various locations across the Netherlands, emphasizing luxury, privacy, and special offers.	Spa → Saunas ⁹²⁰ Spa → Wellness Centers ²³⁸	private ¹⁶⁸ luxury ³⁷⁵ sauna ¹¹⁷⁵ pool ¹⁵³² facility ²⁶¹⁶	Krimpenerwaard → Stolwijk ²³²
veerpoortcatering.nl	De Veerpoort Catering	The website of Catering De Veerpoort showcases the catering services and product range of a catering company that specializes in buffets and BBQ's, emphasizing quality, value for money, and the use of fresh ingredients.	Catering → Buffets ²⁷⁷	bbq ⁹⁰⁸ buffet ¹⁷⁴⁷ dish ⁵⁹³⁶ assortment ⁷⁷⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
snackpointdesticht.nl	Snackpoint de Sticht	Snackpoint de Sticht is an online shop and restaurant with a snack truck in Ammerstol, offering delivery and pick-up options.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	snack truck ³⁵ prize wheel ⁴⁰² pickup ⁷³⁶ menu ¹³⁸⁵⁶	Krimpenerwaard → Ammerstol ⁴⁹
rodenburgbeauty.nl	Rodenburg Beauty Schoonheidssalon Bergambacht	Rodenburg Beauty Schoonheidssalon Bergambacht is a multi-faceted beauty and wellness salon offering a wide range of products and services, including perfumes, cosmetics, pharmacy items, wellness treatments, and accessories.	Household & Cleaning → Household Goods ¹⁶⁴² Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵	perfume ⁵³⁴ cosmetics ⁶⁴⁸ wellness ¹⁵⁶¹ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
riensoptiek.nl	Riens Optiek by Alain	Riens Optiek by Alain is an optician in Schoonhoven that sells eyeglasses, lenses, and sunglasses, and provides eye measurements.	Accessories → Eyeglasses ¹⁰⁵ Services → Opticians ⁵⁵¹	eye measurement ²³² eyeglasses ⁴³⁷ lenses ⁴³⁸ sunglasses ⁵¹⁶ diabetes ⁷⁵⁰ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ollotiek.nl	Outlet Schoonhoven	The website of Outlet Schoonhoven presents a wide assortment of fashion, including evening and gala dresses, design fashion, and suit rental, and offers an online shop with related accessories.	Property Rentals → Rental ¹¹⁶⁹ Accessories → Hats ¹⁷⁷	suit ²⁵¹ hat ³⁴⁹ fashion ²²¹² shop ⁶⁴⁸³ accessories ¹²⁹⁷⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vreeken-groep.nl	Vreeken Groep	Vreeken Groep is a real estate management agency in the Netherlands that focuses on the development, realization, and management of buildings for various clients.	Architecture → Historical Buildings ²⁶⁶ Monuments → Monument Conservation ²⁶	buildings ⁸⁹⁸ real estate ⁴⁹⁸¹ school ⁷⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
adeleck.nl	ADELECK	ADELECK offers independent living with care in apartments and a care hotel.	Senior Housing → Care Homes ²⁸ Senior & Assisted Living → Care Housing ²³	residence ²⁵¹ river ³¹² housing ⁴³⁷⁸ apartment ⁵⁰⁸⁸ care ¹²³³⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
moostassen.nl	MoosTassen	The MoosTassen website presents an online shop and an event calendar offering unique, handcrafted leather bags made from recycled leather sourced from old sofas and leftover pieces from furniture makers.	Crafts → Handmade ¹¹⁴⁷ Accessories → Bags ¹⁰⁰¹	leather ⁷⁸⁵ bag ²³⁹⁹ event ⁴⁵¹⁹⁹	Kaag en Braassem → Rijnsaterwoude ⁸⁶
mooimakertotaalonderhoud.nl	Mooimaker Totaalonderhoud	Mooimaker Totaalonderhoud is a company specializing in window and door repair, renovation, and replacement services in South Holland.	Windows & Doors → Windows ²⁹⁹⁹ Interior → Doors ¹²⁹⁷	window ²⁰³⁰ carpentry ²²¹⁸ glass ²⁹¹⁹ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
kwali-tech.nl	Kwali-tech Elektrotechniek	Kwali-tech Elektrotechniek is an electrical service provider offering a range of electrical services.	Lighting & Electrical → Utilities ³⁸⁸ Energy → Electricity ⁷¹²	electrical ¹⁴¹⁴ job ²⁷⁹⁵ light ⁵¹⁴⁸ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶	Krimpenerwaard → Ammerstol ⁴⁹
vodavi.nl	Vodavi	The website of Vodavi is an online platform for a specialized installation company based in Bergambacht, focusing on providing installation services and products in the areas of security, telephony, audio, and WiFi networks.	Security Systems → Security Technology ³⁹⁹ Radio & Communication → Telecommunications ¹³⁶¹	alarm ³⁷⁷ telephony ⁴⁹⁴ audio ⁹³⁴ wifi ¹³⁷² security ⁶⁶⁵⁵ network ¹¹¹²³	Krimpenerwaard → Bergambacht ³⁰³
kalmeijermakelaars.nl	Kalmeijer Makelaars	Kalmeijer Makelaars is a real estate agency located in Haastrecht offering services related to real estate, including sales, purchase, appraisals and mortgages.	Real Estate → Immobilien ²⁸⁴	purchase ²²¹² valuation ²⁶⁹⁷ mortgage ⁴⁵⁶⁴ sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
pncnc.nl	Petra& Coaching& Counseling	The website of Petra& Coaching& Counseling offers well-being coaching and grief counseling in Schoonhoven, aimed at helping individuals to solve problems, gain self-awareness, and improve their life situation.	Personal Development → Self-Awareness ¹⁰⁵ Mental & Emotional Well-Being → Grief Counseling ⁶⁶³	grief counseling ⁷⁶ self-awareness ⁷⁵¹ problem ²²¹⁴ wellbeing ²⁶²⁰ collaboration ¹⁶⁰³⁶ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bakkerijblanken.nl	Bakkerij Blanken	Bakkerij Blanken is a family-run bakery located in Bergambacht, Stolwijk, and Lopik, selling a variety of breads and pastries, as well as lunch and catering for special occasions.	Bakery & Food Production → Bread ⁷⁶⁵ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	pastries ⁹⁴⁶ bread ¹⁶²² history ⁷²⁸⁶	Krimpenerwaard → Bergambacht ³⁰³
casteleijnbroodenbanket.nl	Casteleijn Brood en Banket	The website of Casteleijn Brood en Banket presents a bakery and tearoom in Bergambacht that offers artisan bread, pastries, and chocolates, as well as seasonal products, with a focus on tradition and family history.	Pastry → Cakes ⁸²⁶ Chocolate → Chocolatiers ⁹⁶	seasonal products ²⁶ tea room ⁵⁸ bakery ⁷¹⁸ chocolate ⁹¹¹ pastries ⁹⁴⁶ bread ¹⁶²²	Krimpenerwaard → Bergambacht ³⁰³
hairandmorebergambacht.nl	HAIR & more Bergambacht	The website of HAIR & more Bergambacht showcases a hair salon and make-up artist offering personal styling, color services, and make-up services.	Makeup → Makeup Artists ⁷³³	stylist ⁴⁷⁶ makeup ¹⁴⁷⁷ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Krimpenerwaard → Bergambacht ³⁰³
svfbergambacht.nl	SVF Bergambacht	The SVF Bergambacht website provides financial support and advice to individuals and diaconies, primarily focused on addressing financial problems and offering stability.	Financial Assistance → Debt Support ⁷⁶	debt ⁷¹⁷ financial ⁸⁵⁵ administration ⁶⁵⁸⁷ education ¹³⁴⁷¹	Krimpenerwaard → Bergambacht ³⁰³
hospicekrimpenerwaard.nl	Stichting Hospice Krimpenerwaard	Hospice Krimpenerwaard is a foundation aiming to create a ‘near-home’ environment for people in the Krimpenerwaard who cannot spend their final days at home, providing loving and caring support.	Palliative & End-Of-Life Care → Hospice ¹²³	hospice ¹⁶⁸ foundation ⁶⁶⁷⁸ construction ⁷⁴²¹ house ⁸¹²¹ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
torecatoneel.nl	TORECA	The website of TORECA presents the theatrical piece 'Little Cottage by the Sea', which will be performed on November 16, 22, and 23, 2024, in Stolwijk, providing details about the cast, director, and the background of the play.	Theater → Theater Groups ⁶⁷³ Theater → Play ⁴⁵	cast ²⁶³ play ⁶³¹ camp ²⁴⁶⁶ theater ²⁵⁴⁴ ticket ²⁷⁸⁵ vacation ⁴²³⁴	Noordwijk → Noordwijk-Binnen ³⁹
ml2vastgoed.nl	ML2 Vastgoed	ML2 Vastgoed is a real estate agency offering property listings and developing projects, including transforming a water tower in Lopik into a luxury residential concept with a B&B.	Context ¹⁶¹³⁹⁴	water tower ³³ b&b ¹⁰⁶⁰ agent ¹²⁵³ property ⁷⁴⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bodyartjewelry.nl	Bodyartjewelry Dick van de Lagemaat	The Bodyartjewelry website offers handcrafted, romantic, and erotic silver jewelry, including various themed series and a range of piercing jewelry and accessories.	Jewelry → Silver Jewelry ¹²¹	earrings ⁵⁷⁸ extension ¹⁹⁴¹ theme ⁴⁰¹⁵ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
exxther.nl	Exxther \| Esther van Vliet Goldsmith	The website of Exxther \| Esther van Vliet Goldsmith presents the work of goldsmith Esther van Vliet, who is based in Schoonhoven and has 30 years of experience in her field.	Jewelry → Goldsmiths ³¹⁹	goldsmith ²²⁴ silver ⁴⁷⁹ commission ⁶⁰⁹ gold ⁸⁰⁵ portfolio ⁶⁸⁵⁴ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wilcolingerie.nl	Wilco Day & Night Lingerie	The website of Wilco Day & Night Lingerie is an online store and brick-and-mortar shop offering women’s, men’s, children’s, and basic underwear, lingerie, nightwear, swimwear, and sportswear, with a focus on personalized service and expert advice.	Underwear → Lingerie ⁴⁷¹ Context ¹⁶¹³⁹⁴	nightwear ¹⁶⁰ underwear ²⁸¹ swimwear ³⁴⁵ lingerie ⁴⁸⁸ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
erfgoedkrimpenerwaard.nl	Stichting Cultuur Historisch Overleg Krimpenerwaard (SCHOK)	The website ‘Erfgoed & Historie’ is a platform for registering and sharing the heritage and history of the Krimpenerwaard. It aims to raise awareness of the local culture and history.	Websites → Cultural Websites ³⁴ Monuments → Heritage ⁵²⁶	heritage ⁸¹⁸ foundation ⁶⁶⁷⁸ history ⁷²⁸⁶ association ⁸⁵⁶²
duhenjuwelier.nl	Duhen Juwelier en Goudsmid	Duhen Juwelier en Goudsmid is a jeweler and goldsmith in Schoonhoven that sells jewelry and watches and offers repair services.	Precious Metals → Gold ¹⁷⁴ Watches → Watchmakers ¹⁶³	goldsmith ²²⁴ ring ⁸⁰⁰ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kimsbloembinderij.nl	Kim's Bloembinderij Haastrecht	Kim's Bloembinderij Haastrecht is an online flower shop and florist that delivers and sells flowers, plants, and other products.	Florists → Online Flower Shops ²⁹³ Gifts & Occasions → Flower Shops ⁷⁷⁶	funeral flowers ¹⁹⁹ flowers ³²⁴⁸ subscription ³²⁸⁷ webshop ⁸⁶⁴⁸	Krimpenerwaard → Haastrecht ¹⁹³
barbershopknippenz.nl	Barbershop Knippenz	Barbershop Knippenz is a barbershop in Schoonhoven specializing in haircuts, shaves, beard trims, and facial contouring for men and boys.	Men’s Grooming → Barbershops ¹⁰¹²	punch card ²⁰ shave ¹⁷⁹ beard ⁴⁶⁸ barbershop ⁵¹² haircut ¹¹⁵⁸ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
barbershopmike.nl	Barbershop Mike	The website of Barbershop Mike offers an overview of barber services, including haircuts, styling, and beard care, with various options and special treatments for children and seniors.	Men’s Grooming → Barbers ³⁹³	tondeuse ²⁵ kids ⁸⁴ beard ⁴⁶⁸ haircut ¹¹⁵⁸ styling ²³³¹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
cafedeblauweduif.nl	Café de Blauwe Duif	Café de Blauwe Duif is a brown café located in the center of Schoonhoven, offering lunch, drinks, and events, and boasting a terrace.	Beer → Breweries ³³⁷ Cafes → Brown Cafés ⁵⁹⁹	pea soup ¹⁰ lunch ¹⁵³⁴ cafe ¹⁶²² beer ²⁸⁸⁷ terrace ⁴⁸⁴⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
evangelisatiehaastrecht.nl	Nederlands Hervormde Evangelisatie op Gereformeerde Grondslag Haastrecht	The website of Evangelisatie Haastrecht provides information about the Nederlands Hervormde Evangelisatie op Gereformeerde Grondslag in Haastrecht, including details about the church's history, beliefs, activities, and contact information.	Reformed → Dutch Reformed Church ²¹⁹ Social Support → Community Life ¹⁰⁷	pastoral care ¹²² belief ³²⁸ church ³⁴³⁹ event ⁴⁵¹⁹⁹	Krimpenerwaard → Haastrecht ¹⁹³
feestcomite.nl	Feestcomité Ammerstol	The Feestcomité Ammerstol organizes and manages the events of King's Day and the Christmas Market in the village of Ammerstol.	Local Events → Village Events ⁷⁵ Village Focus → Village Organizations ⁶⁸³	king's day ⁸⁸ christmas market ¹⁶³ village ⁸⁰⁸	Krimpenerwaard → Ammerstol ⁴⁹
fietsverhuurkrimpenerwaard.nl	Fietsverhuur Krimpenerwaard	Fietsverhuur Krimpenerwaard offers bike rentals and electric bikes to visitors in the Krimpenerwaard.	Cycling → Bicycle Rental ⁶⁴³	bike rental ⁷¹ bike ¹⁵⁴¹ cycle ¹⁹⁰⁶
groenehartmaaltijdservice.nl	Groene Hart Maaltijdservice	Groene Hart Maaltijdservice is a meal delivery service that provides fresh, warm meals directly to customers’ homes, focusing on convenience and freshness in the Krimpenerwaard and Gouda regions.	Delivery → Meal Services ⁷¹ Logistics & Transportation → B2B Services ³⁴	soup ¹⁰⁴³ meal ¹⁶³⁸ region ⁵⁴¹² menu ¹³⁸⁵⁶	South-Holland → Gouda ³⁵²¹
haarstudiojanna.nl	Haarstudio Janna	Haarstudio Janna is a hair salon in Krimpen aan de Lek offering hair styling and makeup services to women, men, and children.	Salons → Mobile Hair Salons ⁷⁸	hair salon ⁷¹⁷ makeup ¹⁴⁷⁷ hair ³⁰¹⁴ subscription ³²⁸⁷ appointment ¹³⁵¹⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
ijsclubammerstol.nl	IJsclub Ammerstol	The website of IJsclub Ammerstol provides information about the club, opening hours, events, membership, and contact details. It is a natural ice skating club that focuses on skating and speed skating.	Winter Sports → Skating ⁸⁴¹	opening hours ²⁹⁵³ club ⁴²²⁵ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴²	Krimpenerwaard → Ammerstol ⁴⁹
opstolk.nl	Op Stolk	The website of Op Stolk is an online presentation of a bed and breakfast (b&b) located in Stolwijk, offering accommodation to guests.	Accommodation → Guesthouses ⁷²⁶	stable ⁷⁶⁸ b&b ¹⁰⁶⁰ living room ¹³²⁵ guest ¹³³⁴ accommodation ⁴⁹²¹ kitchen ⁶⁴⁴³	Alkmaar → Oudorp ³⁴⁵
oranjeboven-schoonhoven.nl	Oranje Boven Association	The website of Oranje Boven is an information platform for members and interested parties, detailing the activities of the association, including celebrations around King's Day and Liberation Day, the annual Remembrance Day, and the history of the location.	National Holidays → King’s Day ³⁸⁹	remembrance day ¹⁵ history ⁷²⁸⁶ association ⁸⁵⁶² member ¹⁰¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
oranjehaastrecht.nl	Oranjevereniging Koningin Juliana Haastrecht	The website of the Oranjevereniging Haastrecht provides information about the association, its activities, membership, volunteer work, and sponsorship packages. The aim is to recruit members, find volunteers, and support the association.	National Holidays → King’s Day ³⁸⁹	oranjevereniging ¹⁶ king's day ⁸⁸ sponsor ¹¹⁵⁹ volunteer ⁸³⁶⁷ membership ¹⁰⁴⁴²	Krimpenerwaard → Haastrecht ¹⁹³
oranjeverenigingstolwijk.nl	Oranjevereniging Stolwijk	The Oranjevereniging Stolwijk organizes events and activities around King's Day, Memorial Day, and Liberation Day.	Associations → Village Associations ¹⁵² National Holidays → King’s Day ³⁸⁹	king's day ⁸⁸ flag ⁵²⁹ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Stolwijk ²³²
pizzerialekker.nl	Lekker Pizzeria & Grillroom	The website Lekker Pizzeria & Grillroom offers an online webstore where customers can order pizzas, meat dishes, and other snacks for delivery or pickup.	Online Services → Ordering ¹²¹ Grilling & Steaks → Grillroom ⁸⁷	meat dishes ⁶⁶ promotion ²⁰⁶² snack ²⁹¹⁶ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Stolwijk ²³²
plein19.nl	Plein19	The website of Plein19 in Schoonhoven is an online restaurant where visitors can order food and pick it up or have it delivered.	Cafes → Dutch Restaurants ¹⁰³¹ Quick Bites → Online Restaurant ¹⁰⁹	drink ⁵¹⁹¹ order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
snacksonskrimpen.nl	Snacksons Krimpen	Snacksons Krimpen is an online shop and restaurant offering delivery and takeaway services in Krimpen aan de Lek.	Cafeteria → Dutch Cafeteria ¹²² Food Delivery → Delivery ²²²⁷	prize wheel ⁴⁰² gift ⁶⁴⁴² order ⁶⁹¹² restaurant ¹¹²¹⁵ menu ¹³⁸⁵⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
sultanpizzeria.nl	Sultan Pizzeria Krimpen aan de Lek	The website of Sultan Pizzeria Krimpen aan de Lek offers online pizza ordering and information about the restaurant, including the menu, reviews, and newsletters.	Italian Restaurant → Pizza Restaurant ³⁵¹	reviews ³¹⁷² pizza ⁴¹⁵⁸ app ⁴⁵⁹⁵ newsletter ⁶⁵⁰⁴ order ⁶⁹¹² menu ¹³⁸⁵⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vandergraafbloemenkado.nl	Van der Graaf Bloem en Kado	Van der Graaf Bloem en Kado is a flower shop offering online flower ordering and delivery, both locally in Krimpen aan de Lek and internationally.	Flowers → Florists ¹⁴¹⁰ Flowers → Bouquets ⁹⁸	flower arrangement ¹⁰⁷ bouquet ¹¹⁴⁷ occasion ²⁰³⁶ flowers ³²⁴⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
wendyvanburen.nl	Atelier Wens Schoonhoven	The website of Wendy van Buren is a workshop where personalized jewelry is designed and created based on the emotions and stories of clients. It also offers repair services and courses.	Jewelry → Goldsmiths ³¹⁹ Crafts → Goldsmithing ¹⁶⁸	precious metal ⁷⁸ gold ⁸⁰⁵ craftsmanship ¹⁸⁵⁸ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vaneijkbergambacht.nl	J. Van Eijk Constructie	J. Van Eijk Constructie is a steel construction company that manufactures and installs various metal structures, fences, and accessories.	Garden → Fences ⁸²⁴ Construction → Building & Materials ¹⁹⁴⁴⁹	gate ⁴⁹⁹ stair ⁸¹⁵ metal ¹⁰⁹⁰ steel ¹¹⁷⁷ fence ¹⁸¹⁴ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
vanherkbouw.nl	Van Herk Bouw B.V.	Van Herk Bouw is a construction company specializing in new construction, renovation, and commercial housing.	Business → Construction ⁷²⁶⁹⁹	construction ⁷⁴²¹ renovation ¹³⁸⁴⁹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
xplended.nl	Xplended	The website of Xplended machinebouw showcases the company’s services and expertise in metalworking, stainless steel construction, and welding, with a focus on custom solutions and waterjet cutting.	Manufacturing & Production → Manufacturing Equipment ¹⁴ Business → Industry ³⁶⁹⁷⁷	waterjet cutting ²⁸ sheet metal processing ³¹ machine building ²⁷⁹ metalworking ⁵⁶⁵ stainless steel ⁷³⁷ welding ¹⁰⁵¹	Krimpenerwaard → Stolwijk ²³²
blankenafbouw.nl	Blanken Afbouw	Blanken Afbouw is a company specializing in finishing and plastering work, focusing on renovation projects and new construction.	Construction Companies → Plasterers ⁸⁴³ Finishing & Trades → Interior Finishing ⁹⁸	finish ⁷⁴⁷ plaster ²¹⁷⁵ new construction ²⁶⁷² renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
dekindertherapie.nl	Twinkels kindertherapie Schoonhoven	Twinkels kindertherapie Schoonhoven is a child therapy practice that helps children and young people to resolve issues they are struggling with, so they can function independently again.	Dog Training → Behavioral Therapy ⁷⁰⁸ Mental & Emotional Well-Being → Youth Therapy ⁵³²	anger ²¹ sadness ⁵² child therapy ⁸⁰ hypnotherapy ⁷⁸⁰ anxiety ¹⁵⁹⁶ child ¹¹⁵⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kdo-lekkerkerk.nl	Turnvereniging KdO Lekkerkerk	The website of Turnvereniging KdO Lekkerkerk presents information about the association, its activities and members, with a focus on gymnastics, movement on music and other sporting and recreational programs for all ages.	Sports Clubs → Gymnastics ⁴⁸¹	gymnastics ⁵⁰² supervision ¹¹⁸⁴ member ¹⁰¹⁵⁴	Krimpenerwaard → Lekkerkerk ²⁴⁴
punthoveniers.nl	Punt Hoveniers	Punt Hoveniers is a landscaping company specializing in the design, installation, and maintenance of gardens, with a focus on projects in the region of Krimpen aan den Lek, Krimpen aan den IJssel, Schoonhoven, and The Hague. The company offers a range of services, including garden design, landscaping, maintenance, fence construction, and shoreline reinforcement.	Garden Maintenance → Landscapers ²⁸⁷ Garden Design → Garden Designers ⁹⁶	lawn ⁴²⁷ landscaping ¹⁵²⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
visspecialistjaapstruik.nl	Visspecialist Jaap Struik	Visspecialist Jaap Struik is a fish specialist offering sustainable fish and fish dishes for sale and delivery from a mobile sales van in the Werkendam region.	Fish & Seafood → Fish ³⁸⁸	fish ¹¹²¹ recipe ⁵¹⁴² sustainability ¹⁸⁴⁵¹	Hardinxveld-Giessendam → Boven-Hardinxveld ⁸³
2date.nl	Commercive B.V.	The 2Date.nl website is a comparison site that enables users to compare dating websites in the Netherlands based on various criteria, including target audience, wishes, and locations.	Social Media → Dating ¹⁶⁴⁴ Websites → Comparison Sites ⁸⁶⁹	preference ⁶⁶	Krimpenerwaard → Bergambacht ³⁰³
miniopslagkrimpenerwaard.nl	Miniopslag Krimpenerwaard	The website of Miniopslag Krimpenerwaard offers temporary storage space and storage boxes for rent, targeting both private and business customers in the Krimpenerwaard region.	Logistics → Storage ¹¹⁷⁰	storage space ³⁸⁸ box ¹⁹⁸² storage ²⁴⁴⁶ space ³⁸⁴⁶ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
vanoosteromvanleeuwen.nl	Van Oosterom & Van Leeuwen Administratieve Dienstverlening	Van Oosterom & Van Leeuwen Administratieve Dienstverlening is an administrative office based in Bergambacht that provides financial administration, accounting, and tax filing services.	Accounting → Administrative Offices ⁹⁶ Administrative Support → Business Operations ¹¹⁵⁶	tax ²¹⁰⁰ account ⁵⁷⁸¹ administration ⁶⁵⁸⁷	Krimpenerwaard → Bergambacht ³⁰³
tpphagen.nl	Tandprothetische Praktijk Hagen B.V.	The website of Tandprothetische Praktijk Hagen B.V. presents a dental prosthesis practice with locations in Krimpen aan den IJssel, Schoonhoven, and Rotterdam, specializing in the fitting and repair of dentures, dental implants, and partial dentures.	Dentistry → Prosthodontics ³⁷⁰	click denture ³⁵ prosthesis ³⁹³ denture ⁴⁶² implant ⁶¹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kerroum.nl	Kerroum Gym	The Kerroum Gym website promotes a kickboxing school offering classes for young and old in the Utrecht, Gouda, Woerden, Nieuwegein, and Rotterdam regions. The site provides information on kickboxing, Muay Thai, training schedules, locations, and a free trial lesson.	Martial Art → Combat Sports ⁵⁴⁸ Sports & Fitness → Sports Training ⁷¹¹	muay thai ⁵⁸ kickboxing ⁴³³ certification ³³⁸⁰ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
opslagwaddinxveen.nl	Opslag Waddinxveen	Opslag Waddinxveen offers self-storage rental for individuals and businesses, emphasizing competitive prices and convenient access.	Logistics → Storage ¹¹⁷⁰	unit ⁴⁰⁵ storage ²⁴⁴⁶ security ⁶⁶⁵⁵ rental ⁷²⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
zaallocaties.nl	Zaallocaties	Zaallocaties is a website that provides an overview of various hall rental locations and party locations in the Netherlands.	Venues & Rentals → Party Locations ²⁸	hall ¹⁷⁸⁶ party ⁵⁹²⁸ restaurant ¹¹²¹⁵ event ⁴⁵¹⁹⁹	The Hague → Scheveningen ¹⁶²⁵
leonluijksedelsmid.nl	Leon Luijks Edelsmid	The website of Leon Luijks Edelsmid presents the activities of a goldsmith and silversmith based in Bergen op Zoom, specializing in the design, creation, and repair of jewelry and gemstones, including wedding rings and emotional jewelry.	Jewelry → Goldsmiths ³¹⁹	wedding rings ²⁸¹ silver ⁴⁷⁹ ring ⁸⁰⁰ gold ⁸⁰⁵ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹	Arnhem → Stationsplein ³⁸
bkibouw.nl	Berkouwer Keuken & Interieur	Berkouwer Keuken & Interieur (BKI Bouw) is an interior and furniture company specializing in custom-made interiors.	Project & Custom Work → Interior Furniture ⁹⁶ Kitchen → Kitchen Suppliers ⁴³⁷	showroom ⁴⁸⁸³ kitchen ⁶⁴⁴³ interior ⁸⁰⁹³ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
dietistkrimpen.nl	Dietist Krimpen	The Dietist Krimpen website offers nutrition and health advice to individuals and businesses, with expertise in various conditions such as diabetes, obesity and digestive problems.	Nutrition → Dietetics ⁸¹⁶	cooperation ⁴³³ diet ⁷⁴⁷ diabetes ⁷⁵⁰ nutrition ⁴⁹³⁵ health ⁶³⁶⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
damesmodeplus.nl	Elenora’s XL Fashion	Eleonora’s XL Fashion is a women’s clothing store in Bergambacht specializing in fashionable clothing and accessories for women in sizes 42 to 56 (often referred to as ‘plus size’ or ‘large sizes’).	Women’s Clothing → Plus Size ¹²¹	plus size ²⁹ store ³⁹⁰¹ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵	Krimpenerwaard → Bergambacht ³⁰³
dejonginterieurbouw.nl	Jan de Jong Interieurbouw B.V.	Jan de Jong Interieurbouw is a company based in Bergambacht that designs and manufactures custom furniture and interiors.	Interior → Furniture ⁷⁴⁵⁴ Finishing & Trades → Interior Construction ⁵⁰²	cabinet ¹⁷³⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
hondenschoolrotterdam-usv-vop.nl	Hondenschool Rotterdam USV-VOP	Hondenschool Rotterdam USV-VOP offers various dog training courses and activities, focusing on puppies, beginners, advanced dogs, and specific disciplines like agility and hoopers.	Dog Training → Dog School ⁹³ Competitive Activity → Dog Sports ²²⁵	obedience ⁶⁸ agility ¹⁷⁰ course ¹⁴⁷²⁸	Nieuwkoop → North ¹¹⁷
mevrouwlingerie.nl	Mevrouw Lingerie	Mevrouw Lingerie is a lingerie boutique and online shop offering a wide range of lingerie, nightwear, swimwear, and undergarments for women and men.	Retailers → Specialty Stores ¹¹ Underwear → Lingerie ⁴⁷¹	nightwear ¹⁶⁰ lingerie ⁴⁸⁸ online shop ¹³¹⁰ store ³⁹⁰¹ sale ⁵⁹³⁰ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
wovenwithlove.nl	Woven With Love	The website Woven With Love is a women's clothing boutique located in Bergambacht, offering exclusive clothing focused on quality, style, sustainability, and fair fashion.	Women’s Clothing → Boutique ¹³⁹ Clothing → Second-Hand Clothing ⁷⁴	styling advice ⁹⁶ women's clothing ¹⁰⁸ boutique ¹³³ webshop ⁸⁶⁴⁸ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
cafeensuite.nl	Cafe en Suite	Cafe en Suite is a combination of a lunchroom and a fashion store, located in Bergambacht, where visitors can have lunch, enjoy coffee and pastries, and simultaneously shop.	Cafes & Lunch → Lunch Spots ²³⁷ Economy → Retail & Commerce ⁹⁹⁴¹	lunchroom ³¹² staff ³⁴⁰⁵ coffee ³⁸³⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
basta-coffee.nl	Basta Coffee	The Basta Coffee website introduces the company, its location, the range of products and services offered, and the opening hours of the coffee shop located in Schoonhoven.	Commerce → Shopping Centers ¹⁰⁰¹ Context ¹⁶¹³⁹⁴	lunch menu ²⁰ coffeeshop ¹⁴⁷ cake ¹⁷³⁰ coffee ³⁸³⁸ drink ⁵¹⁹¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
benecom.nl	Benecom B.V.	Benecom B.V. is a trading company specializing in high-tech sealing systems, leveraging over 50 years of experience.	Manufacturing → Industrial Equipment & Services ¹²⁷¹ Manufacturing & Industrial → Engineering ³⁹¹⁹	industry ¹⁷⁸⁰ certification ³³⁸⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
littel-interieur.nl	Littel Interieurbouw	Littel Interieurbouw is an interior construction company that designs, produces, and installs custom interiors.	Wood & Timber → Wood ¹⁰³⁵ Finishing & Trades → Interior Construction ⁵⁰²	interior construction ²⁴⁰ wood ⁴¹⁵³ interior ⁸⁰⁹³ renovation ¹³⁸⁴⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bubblefresh.nl	Bubble Fresh Cleaning Company	BubbleFresh Cleaning Company is a cleaning company offering various services, including cleaning of homes, offices, and schools.	Relationships → Partnerships ⁴⁸¹ Supply Chain & Logistics → International Trade ¹¹⁵⁶	partnership ¹⁴⁰⁷ cleaning ⁴⁵⁶⁷ quote ¹²⁸⁶³	Utrecht → Overvecht ¹²⁰
deknegtkaasennoten.nl	De Knegt Kaasspeciaalzaak	De Knegt Kaasspeciaalzaak is a shop in Bergambacht that sells nuts, fresh cheese, and wine.	Dairy → Cheese ⁵³⁰ Dairy & Cheese → Delicatessens ⁶¹⁷	dip ⁴⁹ nuts ⁴¹⁷ cheese ¹²⁰⁵ wine ⁴⁴⁷⁶ assortment ⁷⁷⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
poldertransport.nl	PolderTransport	Poldertransport.nl is a transport company specializing in logistics services, including building transport, container storage, and furniture logistics, and providing advice for projects.	Transportation Services → Container Transportation ¹⁸¹	transport ⁶¹⁰⁵ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vandenakkerfonds.nl	Stichting van den Akkerfonds	The Stichting van den Akkerfonds is a foundation supporting arts, culture, and sports in Haastrecht.	Municipal Services → Grants ¹⁹³ Associations → Sports Associations ¹⁰⁸²	anbi ¹²⁰ subsidy ²⁶⁴⁹ art ³⁸⁵⁶ culture ³⁹²² sport ⁴²²⁸	Krimpenerwaard → Haastrecht ¹⁹³
vandriel-nl.nl	Van Driel Transport	Van Driel Transport is a transportation company specializing in one-way container transport and offers logistics solutions for container transport across Europe.	Transportation Services → Container Transportation ¹⁸¹ Freight & Logistics → International Transportation ⁵⁷⁶	chassis ⁷² europe ²⁸⁹ truck ¹⁴¹² container ¹⁷⁰⁹ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
dedeellopik.nl	De Deel Om Te Delen	De Deel Om Te Delen is a festive venue located in Lopik, Lopikerkapel, and Uitweg, offering a cozy and homely setting for various events.	Venues → Party Venues ³⁶³ Venues → Event Spaces ⁴³²	venue ⁸⁷⁹ occasion ²⁰³⁶ space ³⁸⁴⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ash-hoveniers.nl	A.S.H. Hoveniersbedrijf	A.S.H. Hoveniersbedrijf is a landscaping company based in Lekkerkerk offering services for garden design, installation, and maintenance.	Exterior Works → Excavation ³¹⁶	groundwork ¹³⁴⁸ paving ¹⁹⁴² garden ¹³¹²⁹ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Lekkerkerk ²⁴⁴
yogakrimpenerwaard.nl	Yoga Krimpenerwaard	Yoga Krimpenerwaard is a yoga studio offering group classes, private lessons, and on-location yoga, focusing on Iyengar Yoga to increase participants' flexibility, strength, and endurance.	Yoga → Yoga Studios ³⁵⁸	asana ²⁶ class ²⁰⁷⁶ schedule ²⁶²⁴ yoga ³⁷⁰⁴
broerelekkerkerk.nl	Broere Lekkerkerk V.O.F.	Broere Lekkerkerk is a company offering earthmoving and related services to various sectors.	Land Development & Earthworks → Earthmoving ⁶⁴³ Civil & Infrastructure → Earthworks ³⁷⁰	earthmoving ²³³ machinery ⁵¹⁹ soil ⁹³⁰ drainage ¹³²²	Krimpenerwaard → Lekkerkerk ²⁴⁴
verstopping-gouda.nl	Rioleringsbedrijf Gouda	The website of Rioleringsbedrijf Gouda offers rioolservice (drainage services), unclogging services, and other pipe repair services in Gouda and surrounding areas.	Water Management → Sewers ²⁵ Personal & Household → Service Industry ³⁷⁶	unclogging ²⁴⁴ sewer ²⁴⁶ drainage ¹³²² region ⁵⁴¹²	Krimpenerwaard → Bergambacht ³⁰³
nieuwerkerkaandenijsselkrant.nl	Municipality of Nieuwerkerk aan den IJssel	The website Nieuwerkerk aan den IJssel Nieuws provides local news updates, property information, and 112 emergency reports for the municipality of Nieuwerkerk aan den IJssel.	Apartment Living → For Sale ¹⁰⁰⁷	112 reports ²⁷ job postings ⁶⁷⁶ property ⁷⁴⁰⁶ news ¹⁵²⁹³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
klussenierfredkruit.nl	Klusbedrijf Gouda	Klusbedrijf Gouda offers a variety of handyman and renovation services in the Gouda region and surrounding areas.	Roofing → Skylights ⁴⁷¹ Renovation → Extensions ⁶⁵¹	skylight ⁹⁶⁶ carpentry ²²¹⁸ work ³¹²² kitchen ⁶⁴⁴³ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
majelpieterse.nl	Majel Pieterse Fotografie	The website of Majel Pieterse Fotografie showcases a photographer specializing in family, newborn, and business photography, with the option for in-home and on-location shoots in South Holland and beyond.	Imaging & Photography → Family & Newborn ¹²⁸⁵	gallery ¹⁹⁸³ pregnancy ²⁷³⁹ studio ⁵⁴⁶⁵ family ⁶⁴⁶² photography ⁹⁵⁰³	Krimpenerwaard → Stolwijk ²³²
icselhoeda.nl	El Hoeda	The website of the El Hoeda Islamic Center in Schoonhoven is a cultural and information center aimed at meeting the needs of Muslims and providing information about Islam.	Islam → Centers ⁸⁰ Islam → Mosques ²³⁵	islam ¹⁷² faith ¹⁰⁹³ center ¹¹¹⁵ tournament ²⁴⁷⁶ sponsorship ²⁶⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sorandstad.nl	Stichting Reformatorisch Speciaal Onderwijs Randstad	The website of Stichting Reformatorisch Speciaal Onderwijs Randstad (SO Randstad) provides information about the organization and its five schools, located across eleven locations in the Randstad region. It also publishes job vacancies for teachers and support staff.	Education → Special Needs & Support ⁶³⁷²	job vacancies ¹²⁴¹ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Molenlanden → Bleskensgraaf ca ¹³¹
kindercoaches.nl	Kindercoaches B.V.	The website provides an overview of various childcare coaches and helps parents find the right coach for their child.	Directories → Portals ³⁶⁹ Childcare → Child Coaching ³⁴³	parenting coach ¹² sleep coach ⁹¹ child ¹¹⁵⁶⁶ coach ²⁵⁸¹⁰	Purmerend → Middenbeemster ³⁶⁷
centimeterkeramiek.nl	CentiMeter Keramiek	CentiMeter Keramiek is a workshop and webshop that offers pottery courses and workshops, as well as unique ceramic products.	Kitchenware → Tableware ⁴²⁶ Ceramics → Pottery ²⁹²	glaze ⁹⁷ pottery ¹⁵² urn ⁴¹¹ clay ⁴⁹⁵ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bosware.nl	Bosware Computerservice	Bosware Computerservice is a computer service company that provides delivery, repair, and maintenance of computers, notebooks, and peripherals.	Computer → Computer Repair ⁸⁹⁸ Computer → Computer Maintenance ⁶³³	projector ¹⁴⁹ notebook ²¹² computer ¹⁹⁶⁹ network ¹¹¹²³ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
vermeulenheiwerken.nl	Vermeulen Heiwerken	Vermeulen Heiwerken is a heimbedrijf specializing in the supply and installation of pile foundations.	Construction Technology → Foundation Technology ¹³⁵	machine ³⁷²⁷ foundation ⁶⁶⁷⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
guc-gouda.nl	GUC Retired Association	The website of the GUC Retired Association serves as an information source and communication platform for its members.	Family Activities → Outings ⁷⁶³ Family Activities → Day Trips ⁴¹⁹	alv ⁷⁹ outing ⁹⁸² pension ¹⁶⁸² museum ²⁰⁰²	Krimpenerwaard → Haastrecht ¹⁹³
theatrique.nl	Theatrique	Theatrique is an amateur theater school for children, young people, and adults in Schoonhoven, offering various forms of theatrical performances and lessons.	Activities → Group Outings ¹³³ Youth Development → Youth ¹⁰³³	theaterschool ¹⁸ team building ⁷²⁰ lesson ⁵¹⁵⁴ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jet-power.nl	Jet-Power	The website of Jet-Power in Schoonhoven is an online platform for the repair, tuning, maintenance, sale, and storage of waterscooters, jetboats, and jet skis from brands such as Seadoo, Yamaha, and Kawasaki.	Water Activity → Water Sports ²⁹⁴⁴ Marine & Watercraft → Watercraft ⁴⁴	jetski ¹³ watersport ⁵⁴⁰ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vandewalenpartners.nl	Belastingadvieskantoor Van de Wal & Partners	Belastingadvieskantoor Van de Wal & Partners is a tax advisory firm providing advice to entrepreneurs and wealthy individuals.	Investing → Wealth Management ⁴³⁵ Finance & Insurance → Administrative Agencies ¹⁰¹	tax advice ¹⁵²² app ⁴⁵⁹⁵ article ⁶⁰⁰⁰ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
sanzoe.nl	Sanzoe	Sanzoe.nl offers complementary health and relaxation services, including massages, pilates, and aromatherapy, aimed at promoting a healthy and stress-free lifestyle.	Fitness → Pilates ⁵⁹⁸ Health → Spiritual Wellness ¹³⁷	essential oil ⁴²⁸ pilates ⁵⁴⁵ massage ⁷⁶⁴⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
nhschroefpalen.nl	NH Schroefpalen	The website of NH Schroefpalen presents a specialized service in the field of foundation technology, specifically focused on the use of screw piles for stable and vibration-free construction projects.	Construction Technology → Foundation Technology ¹³⁵	screw piles ¹⁰ groundwork ¹³⁴⁸ machine ³⁷²⁷ foundation ⁶⁶⁷⁸ garden ¹³¹²⁹
blomzonweringen.nl	Blom Zonweringen	Blom Zonwering is a specialized sun shading company providing custom shading solutions and installation services.	Interior → Window Coverings ¹⁰²⁶ Household & Cleaning → Home Services ¹³²¹	sunshade ³⁵⁶ showroom ⁴⁸⁸³ installation ¹³⁷⁴²	Krimpenerwaard → Bergambacht ³⁰³
marjanpolsdepee.nl	Marjan Pols-de Pee	The website of Marjan Pols-de Pee presents a practice offering psychosocial support and herbal therapy, employing a nature-based and holistic approach.	Alternative Medicine → Naturopathy ¹⁰⁹⁷ Special Needs & Support → Support ²⁰⁰⁶	psychosocial support ²⁰ herbal therapy ²⁵ holistic approach ⁵⁸ access bars ¹³²	South-Holland → Rotterdam ²⁵⁰⁴⁸
volleylekenijssel.nl	Volley Lek en IJssel	The website of Volley Lek en IJssel provides information for members regarding the volleyball association, its teams, activities, membership terms, and contact details.	Team Sports → Volleyball ⁸⁴²	volleyball association ⁴² training schedule ¹⁴¹ sponsorship ²⁶⁸⁶ membership ¹⁰⁴⁴²	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
maartjesadvies.nl	Maartje	Maartjes Advies is a consultancy bureau that provides guidance to individuals in obtaining aids, home modifications, and care pathways, with expertise in the field of aids, home improvement, and the WMO.	Rehabilitation → Aids ²⁸⁷ Rehabilitation → Occupational Therapy ³⁸⁰	home modification ¹² aid ⁴²⁷ application ³³⁷⁷ care ¹²³³⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
2r-sports.nl	2R-Sports Tennis Academy	The website of 2R-Sports Tennis Academy offers tennis lessons, clinics, tournament support, school tennis, and tennis travel packages, aiming to promote tennis sports at various tennis clubs and provide socially responsible education.	Tennis → Tennis Lessons ⁹⁸ Education → Sports Education ²⁴⁷	tennis lesson ¹⁷⁷ racket ¹⁸⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
silvercity.nl	SilverCity.nl	SilverCity.nl is an online webshop specializing in silver jewelry, watches, and accessories.	Jewelry → Silver Jewelry ¹²¹	wishlist ¹³⁵ watch ¹¹⁶⁶ shopping cart ¹⁵²¹ jewelry ⁴⁵⁹⁹ accessories ¹²⁹⁷⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bouwvastpartners.nl	BouwVast Partners	BouwVast Partners is a company specializing in construction projects, real estate maintenance, and tailored solutions for various client groups.	Real Estate & Investment → Real Estate ²¹⁴⁷¹ Business & Finance → Construction Cost Consulting ¹⁹⁸	real estate maintenance ⁴⁰ developer ⁴⁰⁶ construction project ⁷⁰¹ contractor ¹⁰³⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hvandam.nl	Hans van Dam Projectmanagement & Advies	The website of Hans van Dam Projectmanagement & Advies presents the services of a project manager and advisor specializing in the design and realization of technical installations in buildings.	Business → Business Services ¹¹⁵³⁷⁹	project management ³⁴²³ consulting ³⁶³⁹ installation ¹³⁷⁴² news ¹⁵²⁹³	Amsterdam → South ¹⁴⁸⁸
werkenbijpolderbedrijven.nl	PolderBedrijven.nl	The website of PolderBedrijven.nl is a job board and information source for work within the company, focusing on moving and green services.	Moving → Moving Companies ⁸³⁵ Services → International Moving ³⁰	green service ²³ move ¹⁴⁴¹ driver ¹⁸³² administration ⁶⁵⁸⁷ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
opencoffee-krimpenerwaard.nl	Open Coffee Krimpenerwaard	The website describes the activities of the Open Coffee Krimpenerwaard, an initiative focused on informal networking among entrepreneurs in the Krimpenerwaard and surrounding area.	Business Events → Networking Events ²³⁵ Entrepreneurship & Business → Entrepreneurship Initiatives ³⁸	networking ⁸⁴² idea ²³⁶⁷ meeting ²³⁸¹ coffee ³⁸³⁸ region ⁵⁴¹²
kabelaringtouw.nl	Touwfabriek Schouten	The website of Touwfabriek Schouten presents and sells durable cable rings and leguanen (maritime ropes), high-quality ropes traditionally used in maritime applications.	Textile Arts → Crafts ⁹¹¹⁷ Marine & Shipping → Maritime ¹⁰²²	rope ¹⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
atctveldje.nl	Tennis Vereniging ATC ’t Veldje	The website of Tennis Vereniging ATC ’t Veldje Ammerstol provides information about the club, its activities, membership, and news.	Municipalities → Municipality of Alphen Aan Den Rijn ¹⁶ Tennis → Tennis Clubs ⁷²⁰	tennis club ³³⁷ tournament ²⁴⁷⁶ lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Krimpenerwaard → Ammerstol ⁴⁹
tennisschoolmatch.nl	Match Match	Match Match is a tennis and padel school offering lessons for all levels.	Martial Art → Racket Sports ¹⁷ Sport Facility → Tennis ²⁰⁷⁸	sportsmanship ²⁰ padel ⁶⁰² tennis ⁸³⁶ lesson ⁵¹⁵⁴ school ⁷⁸⁵⁶ coach ²⁵⁸¹⁰	Utrecht → Woerden ²⁶⁴²
krielhok.nl	‘t Krielhok	‘t Krielhok is a preschool offering a safe and stimulating environment for children aged 2 to 4 to play and develop.	Childcare → Preschool ⁵¹²	preschool ⁴⁹⁵ playground ¹⁰⁸⁸ parent ⁴³¹⁸ child ¹¹⁵⁶⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
laluna-huidverzorging.nl	La Luna Skin Care & Yoga	La Luna Skin Care & Yoga is a salon offering skin care treatments, hair removal treatments, and yoga classes, with a focus on personalized care and the use of luxury top brands.	Essential → Wellness ⁴¹⁴¹¹	hair removal ³¹⁶ skincare ¹⁹⁷² yoga ³⁷⁰⁴ massage ⁷⁶⁴⁶ brand ¹⁷⁷³⁷ treatment ²¹²⁰³	Krimpenerwaard → Lekkerkerk ²⁴⁴
pedicuresalonvanwoerkom.nl	Pedicuresalon Van Woerkom	The website of Pedicuresalon Van Woerkom presents the services of a certified medical podiatrist, Mieke van Woerkom-Lever, who offers specialized treatments for various foot problems, including rheumatic feet and diabetic feet, and emphasizes the importance of regular foot care.	Orthopedics → Foot Problems ⁹⁷⁷ Household & Cleaning → Home Services ¹³²¹	foot problems ³²⁰ podiatrist ³²⁶ foot ¹⁹²⁹ treatment ²¹²⁰³	Krimpenerwaard → Lekkerkerk ²⁴⁴
trend-taste.nl	Trend & Taste	The website of Trend & Taste is an online shop selling handmade silver and glass jewelry, focusing on the creative background of the maker.	Jewelry → Handmade Jewelry ⁸⁶² Jewelry → Goldsmiths ³¹⁹	beads ⁴²⁷ silver ⁴⁷⁹ atelier ¹⁴¹⁷ glass ²⁹¹⁹ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mamsa.nl	MAMSA	MAMSA Guidance and Advice provides coaching and advisory services focused on vitality and personal/team development, utilizing various methods and techniques.	Personal Care & Services → Vitality ⁵⁶⁵	setup ³³⁰ vitality ¹⁷²⁶ coach ²⁵⁸¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
goudcentrum.nl	't Goudcentrum	't Goudcentrum is a jeweler and gold acquisition business located in Tilburg that buys and sells gold, silver, jewelry, and watches.	Accessories → Jewelry ³⁵¹⁷ Visual Arts → Art History ⁴⁴⁹	antique ⁴³² silver ⁴⁷⁹ vintage ⁶⁸⁹ gold ⁸⁰⁵ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ateliernatuurschatten.nl	Atelier Natuurschatten	Atelier Natuurschatten is a flower shop in Haastrecht offering floral arrangements for various occasions, including funerals, weddings, and workshops.	Crafts → Floral Design ²⁴¹ Gifts & Occasions → Flower Shops ⁷⁷⁶	funeral bouquet ¹² bridal bouquet ⁴⁷ calendar ¹⁵⁵⁶ flowers ³²⁴⁸ workshop ¹⁹³²⁵	Krimpenerwaard → Haastrecht ¹⁹³
stalling198.nl	Stalling 198	The website Stalling 198 offers various storage solutions for different vehicles and objects in the Utrecht region.	Car Care & Detailing → Automotive Accessories ⁵⁶⁸ Logistics → Storage ¹¹⁷⁰	winter tires ¹¹³ temperature ³⁹⁵ storage ²⁴⁴⁶ boat ²⁹⁸⁰ vehicle ³⁷⁴³ security ⁶⁶⁵⁵	Vijfheerenlanden → Vianen ⁷⁰⁷
viavestaopen.nl	Tennis- en Padelvereniging Bergvliet	The website of Tennis and Padel Vereniging Bergvliet presents the open tennis and padel tournament of H.T.P.C. Bergvliet, including a program, matches, photos, and information about the organization.	Property Advice & Guidance → Real Estate Advice ¹³⁵ Real Estate → Agencies ²⁴³	tennis park ²⁰ real estate agency ¹⁸⁹ tournament ²⁴⁷⁶ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Haastrecht ¹⁹³
capelleaandenijssel-loodgieter.nl	Folstra B.V.	The website of Folstra B.V. presents the company as a plumbing and installation service provider operating in Capelle Aan Den IJssel and surrounding areas.	Home Improvement → Plumbing ²⁷³³	pipework ⁸⁴ sewer ²⁴⁶ installer ⁶⁷⁷ sanitary ⁷⁵⁰ leak ¹²⁰⁴ heat ²¹⁸⁸	Lansingerland → Bergschenhoek ⁵⁶⁸
jorhanstamps.nl	Jorhanstamps	The Jorhanstamps website offers an online store and a separate store for stamps, featuring an extensive collection of philatelic materials, including forerunners and classic FDCs (franked stamps) from various historical Dutch territories and stamps from other countries.	Collectibles → Stamps ¹⁵⁹	stamps ³³⁴ collection ⁷⁵⁶⁶	The Hague → Haagse Hout ³⁴⁷
focustechnical.nl	Krimpenerwaard Football School	The website of the Krimpenerwaard Football School provides information about the football school, its schedule, rates, and registration procedures. The aim is to inform potential members and register them.	Football → Youth Football ²⁰²	football school ⁵⁰ rate ²⁶⁰⁶ schedule ²⁶²⁴ registration ⁴³⁶⁶ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
padelunlimited.nl	Padel Unlimited	Padel Unlimited is a professional padel school in the Randstad region offering padel lessons and activities.	Tennis → Padel ⁸⁸⁰	lesson series ²⁰ padel ⁶⁰² lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴²	Haarlemmermeer → Nieuw-Vennep ⁸⁶⁹
firma-omon.nl	Fa. A. Omon and Zn.	Firma Omon is a traditional construction company with over 100 years of experience, specializing in tailored solutions and quality workmanship.	Construction Companies → Construction Contractors ⁵³⁶ Civil & Infrastructure → Infrastructure ¹⁰³³	stabilization ³⁶ new construction ²⁶⁷² construction ⁷⁴²¹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
hetbakengouderak.nl	Reformed Church of Gouderak	The website of Het Baken Gouderak provides information about the activities and facilities available at the building, including rental options for various events and activities.	Institutions → Cultural Institutions ⁴⁷⁵ Context → Community ⁵⁷⁴¹⁰	church ³⁴³⁹ space ³⁸⁴⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Gouderak ¹⁰³
onderwijsopvangvoorziening.nl	OnderwijsOpvangVoorziening	The OnderwijsOpvangVoorziening (OOV) provides temporary support and guidance to students, aimed at improving their academic performance and personal development.	Educational Support → Student Guidance ¹³⁴ Social Services → Youth Support ⁵³⁰	curriculum ²⁷⁷ problem ²²¹⁴ wellbeing ²⁶²⁰ student ⁷⁶²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
nlclubsdata.nl	NK Clubs Ranking	The website provides a ranking of Dutch ice clubs and hard ride clubs.	Team → Speed Skating ¹²² Sport Organization → Hockey ⁵⁵⁰	ranking ¹⁴⁹ club ⁴²²⁵ performance ⁷⁵⁸⁶	De Fryske Marren → Sint Nicolaasga ¹⁴⁶
woneninhoogtij.nl	HoogTij	The website showcases a new construction project consisting of seven luxurious villas located on the Hollandsche IJssel, focusing on a unique location and sustainability.	Property Development & Redevelopment → Real Estate Projects ¹³ Accommodation → Villas ¹⁰¹⁸	villa ¹³⁵¹ sustainability ¹⁸⁴⁵¹	Almere → Almere City ⁹³⁴
keetkado.nl	KeetKado	KeetKado is an online shop offering a wide assortment of gifts, gift wrapping supplies, and home accessories, with a focus on personalized gifts, cards, and specific gifts for babies and children.	Graphic Design → Cards ⁴⁴² Commerce → Greeting Cards ⁴³⁰	personalized gifts ¹² gift wrap ³⁵ baby ¹⁸⁹⁵ card ¹⁹⁷⁵ decoration ⁴⁰⁸⁵ gift ⁶⁴⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
yogawerk.nl	Yogawerk	Yogawerk is a yoga studio located in the Krimpenerwaard offering a variety of yoga classes.	Yoga → Yoga Studios ³⁵⁸	breathing ⁹⁷⁶ flexibility ⁹⁹⁶ class ²⁰⁷⁶ rate ²⁶⁰⁶ yoga ³⁷⁰⁴ studio ⁵⁴⁶⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
londeneye.nl	Hollandia	This website provides information about the London Eye, an iconic attraction in London.	United Kingdom → London ⁵² Context ¹⁶¹³⁹⁴	ferris wheel ¹⁶ netherlands ¹³⁷⁶ construction ⁷⁴²¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
mtsolutions.nl	MT Solutions	MT Solutions provides custom interior solutions, including lighting plans, floors, window coverings, and steel doors.	Agriculture → Agricultural Technology & Innovation ⁷⁴³ Technology → Smart Home & Automation ¹¹⁴⁶	steel door ⁸⁵ lighting plan ²⁰⁰ led lighting ³³² window coverings ¹²¹³ floor ⁴⁷⁸¹	Krimpenerwaard → Bergambacht ³⁰³
w-style.nl	W-Style	W-style graphic design is a advertising agency that designs various communication media and guides the entire process.	Creative & Design Services → Creative Agencies ⁸⁹⁸ Design → Graphic Design ²⁴³³	digital design ⁴⁸ brand identity ¹⁴⁵⁷ advertisement ¹⁷⁰⁷ logo ⁴⁶⁶⁰	Alkmaar → Oudorp ³⁴⁵
competenttandtechniek.nl	Competent Tandtechniek	Competent Tandtechniek is a dental technology company located in Stolwijk that manufactures dental prosthetics on behalf of dentists.	Dentistry → Dental Technology ³³⁹ Technical Services → Technical ⁹⁵⁷	cad/cam ⁴¹ prosthetics ⁴⁵ position ⁸⁷⁵ dentist ²⁵¹⁴	Krimpenerwaard → Stolwijk ²³²
totalbootcamp.nl	Total Bootcamp	The website of Total Bootcamp presents and promotes the organization of bootcamp classes in the Schoonhoven region and surrounding areas, aimed at improving participants' fitness, strength, and endurance.	Group Class → Bootcamp ²⁰⁸	bootcamp ⁴⁹⁷ exercise ⁷⁰⁶ participant ¹⁹³⁴ class ²⁰⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
sonhuizen.nl	Stichting Ouderenvoorzieningen Nederlek	The website of Stichting Ouderenvoorzieningen Nederlek presents rental housing and commercial spaces available in Krimpen aan de Lek, aimed at seniors and other tenants.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Office Space → Rental Space ⁵³⁷	waiting ²⁷ unit ⁴⁰⁵ space ³⁸⁴⁶ housing ⁴³⁷⁸ apartment ⁵⁰⁸⁸ rental ⁷²⁵⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
brandned.nl	Brandned b.v.	Brandned is a company specializing in certified custom-made fire-resistant cladding for supporting (steel) structures.	Marketing & Advertising → Business Information ²⁹⁴ Construction → Building & Materials ¹⁹⁴⁴⁹	flash ⁴⁸ fire prevention ¹³³ steel structure ²⁰⁸ timberwork ⁴⁰²	Krimpenerwaard → Gouderak ¹⁰³
paardensportcentrum-zilverstad.nl	Paardensportcentrum Zilverstad	Paardensportcentrum Zilverstad is a stable and riding center offering services and lessons for horse enthusiasts.	Equestrian → Stables ⁶²⁹	equestrian ¹³⁸ ride ¹⁰⁷⁵ board ³⁴³⁸ horse ⁴³³⁷ lesson ⁵¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
woongoedmakelaars.nl	Woongoed Makelaars Capelle aan den IJssel	The website of Woongoed Makelaars Capelle aan den IJssel offers a portfolio of properties for sale and for sale, as well as services for purchase assistance, valuations, and mortgage advice. The goal is to support potential buyers and sellers in their real estate transactions.	Property Sales → Selling Property ³⁷	purchase ²²¹² valuation ²⁶⁹⁷ office ²⁸⁹⁸ sale ⁵⁹³⁰ property ⁷⁴⁰⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
studiofloralyn.nl	Studio Floralyn	Studio Floralyn is an goldsmith and jeweler located in Workum, Netherlands, offering jewelry repair, design, sales, and custom-made pieces.	Crafts → Goldsmithing ¹⁶⁸ Watches → Watchmakers ¹⁶³	engagement ring ⁵⁵ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
lekvergunning.nl	Hengelsportverenigingen Groot-Ammers e.o. and De Karper	This website offers the possibility to apply for a Lek permit to fish on the Lek river, in the area managed by the Hengelsportverenigingen Groot-Ammers e.o. and De Karper, located between Schoonhoven and Jaarsveld.	Water Activity → Fishing ¹⁰⁵⁵	fishing club ²⁰ permit ⁷⁴⁴ member ¹⁰¹⁵⁴	Molenlanden → Langerak ⁵²
loonbedrijfdenboer.nl	Loonbedrijf den Boer	Loonbedrijf den Boer is a construction company specializing in groundwork, demolition, pile driving, paving, and drainage services.	Land Development & Earthworks → Site Preparation ²³ Building & Materials → Demolition ⁶⁸⁷	pile driving ¹⁵ demolition ¹¹⁴⁴ groundwork ¹³⁴⁸ paving ¹⁹⁴² equipment ⁴¹⁴³	Krimpenerwaard → Bergambacht ³⁰³
wsvopstap.nl	WSV Op stap	The website of WSV Op stap is an online platform for members and potential members of the Wandelsportvereniging Op stap, providing information about hiking activities, the Avond4Daagse, membership details, and contact information.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Sport Organization → Municipal Sports Organizations ²⁹	avond4daagse ⁷⁸ hiking ⁸⁴¹ newsletter ⁶⁵⁰⁴ volunteer ⁸³⁶⁷ membership ¹⁰⁴⁴²	Krimpenerwaard → Lekkerkerk ²⁴⁴
muziekvereniginglekkerkerk.nl	Muziekvereniging Lekkerkerk	Muziekvereniging Lekkerkerk offers musical activities for everyone interested in making music together.	Associations & Societies → Music Associations ¹⁰⁰³ Institutions → Cultural Institutions ⁴⁷⁵	harmony ²¹⁸ music association ²⁹³ orchestra ¹³¹⁵ agenda ⁴³⁷⁴ concert ⁴⁴⁰⁹ photo ⁷⁷⁷⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
vanreeuwijkuitvaartzorg.nl	J.C. van Reeuwijk	The website of Begrafenisonderneming J.C. van Reeuwijk offers complete funeral arrangements within the Krimpenerwaard area and Krimpen aan den IJssel, providing personalized support and careful execution of the deceased’s wishes.	Family → Funeral Services ²⁰⁸⁴	funeral ²⁴⁷⁷ wishes ²⁷¹⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
ardkorevaar.nl	Ard Korevaar personenschade	The website of Ard Korevaar personenschade and letselschade is an online platform providing expert advice and guidance on personal injury claims to clients in various regions. It aims to provide customer satisfaction and a personalized approach.	Criminal Law → Personal Injury ⁷⁷¹	dossier ²⁴⁸ personal injury ⁴²⁸ legal assistance ⁵³⁷ charity ⁷⁰⁰ claim ⁷⁰²	Krimpenerwaard → Bergambacht ³⁰³
autorijschooldunnewold.nl	Autorijschool Dunnewold	The website of Autorijschool Dunnewold from Stolwijk offers information and services for obtaining a driving license B, including driving lessons, driver training courses, theory exam materials, and an online shop.	Driving & Vehicle → Vehicle Training ⁵⁵³	driver training ²⁰ ris method ²¹ theory exam ⁹⁷ driving license ⁴⁰² online shop ¹³¹⁰ driving lessons ²⁴⁵³	Krimpenerwaard → Bergambacht ³⁰³
eagleslegacy.nl	Eagles Tribute Band – The Eagles Legacy	The website of The Eagles Legacy is an online platform for a Dutch tribute band that reinterprets the music of The Eagles from the 1970s and 80s and organizes live performances.	Rock → Tribute Bands ²³⁰	band ²⁹⁷⁷ performance ⁷⁵⁸⁶	Twenterand → Vriezenveen ⁴⁸⁷
by-joost.nl	BY-JOOST	BY-JOOST is a company specializing in the creation of high-quality maquettes in various scales and formats.	Hobbies → Model Building ¹⁰⁰⁷ Manufacturing → 3D Printing ⁵⁶⁵	maquette ³⁷ 3d printing ³³² construction ⁷⁴²¹	Amsterdam → North ⁶⁵⁷
peltenburgmakelaardij.nl	Peltenburg Makelaardij	Peltenburg Makelaardij is a real estate agency and valuation office located in Schoonhoven that helps individuals and companies with the sale and purchase of homes.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Property Agents & Brokers → Regional Agents ³⁵²	purchase ²²¹² valuation ²⁶⁹⁷ mortgage ⁴⁵⁶⁴ sale ⁵⁹³⁰ home ⁷⁹⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vijfsparren.nl	Vijf Sparren Lifestyle and Living	Vijf Sparren Lifestyle and Living is an online store offering unique home accessories and vintage items, with a focus on Art Deco and contemporary interior styles.	Decor & Furnishings → Home Stores ⁹³² Antiques & Collectibles → Vintage ⁶²³	bowl ⁴⁸² vintage ⁶⁸⁹ accessories ¹²⁹⁷⁵ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
a-vastgoedzorg.nl	A-vastgoed Zorg	A-vastgoed Zorg is a company specializing in the management of real estate specifically geared towards residential care facilities.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Physiotherapy → Geriatric Physiotherapy ³⁰	elderly care ¹²⁸ seniors ⁹⁰⁴ housing ⁴³⁷⁸ real estate ⁴⁹⁸¹	Krimpenerwaard → Bergambacht ³⁰³
oudnieuwswonen.nl	Oud Nieuws Wonen	The website of Oud Nieuws Wonen offers interior design advice, sells (chalk) paint and stylish furniture, and organizes workshops.	Interior → Wallpaper ¹⁰⁰¹	store ³⁹⁰¹ color ⁴¹⁵⁹ paint ⁸⁷⁴⁷ furniture ⁸⁷⁵¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
verstoeps-bt.nl	Verstoep's Bouw en Timmerwerk	Verstoep's Bouw en Timmerwerk is a company specializing in construction and carpentry, offering services ranging from minor repairs to large projects.	Building & Materials → Carpentry & Joinery ⁸³⁰	carpentry ²²¹⁸ construction ⁷⁴²¹ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
cesarcentraal.nl	CesarCentraal	The website CesarCentraal.nl offers information and treatments for muscle and posture-related complaints, with a focus on improving lifestyle, posture and movement patterns.	Physical Therapy → Exercise Therapy ³⁵⁴ Pregnancy & Childbirth → Obstetrics ²⁴⁰	posture ⁵⁴⁸ movement ²³⁰⁴ lifestyle ²⁹¹⁸ complaint ⁶⁴⁷⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bromfietsshow.nl	Bromfietsshow.nl	The website documents the annual Bromfietsshow, an event focused on classic mopeds and provides a retrospective on previous editions.	Motorcycles → Mopeds ⁶⁶	mopeds ³⁹ jury ³²² visitors ¹⁰⁴⁸ brand ¹⁷⁷³⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
zilverhosting.nl	Zilverhosting.nl	Zilverhosting.nl is a hosting provider based in Schoonhoven, Netherlands, offering domain registration, SSL certificates, and web hosting, with a focus on WordPress and webshops.	Web Hosting → Hosting Providers ¹⁰⁷⁵	ssl ¹³² monitor ¹⁰⁶³ domain ¹⁸¹¹ hosting ³¹²⁵ wordpress ³⁵⁵¹ package ⁶¹¹²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
juweliervanhoff.nl	Juwelier Van Hoff	Juwelier Van Hoff is a jeweler and watchmaker located in Putten that offers a wide range of services and products, including repairs, appraisals, and the sale of new jewelry and watches.	Jewelry → Goldsmiths ³¹⁹ Watches → Watchmakers ¹⁶³	diamond ¹⁹⁸ ring ⁸⁰⁰ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ambachtisdekunst.nl	N/A	The website ‘Ambacht is de Kunst’ showcases the work of traditional craft artists and their exhibitions, with a focus on the ‘Ambacht is de Kunst 2021’ exhibition in Ezinge.	Regional News → North Groningen ⁵⁹ Decorative Arts & Crafts → Craft Art ²⁵	sculptor ¹⁴⁶ goldsmith ²²⁴ painter ⁷⁴⁰ jewelry ⁴⁵⁹⁹ exhibition ⁵³³² artist ⁵⁷⁴⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gravelandenmolenaarbouw.nl	Graveland & Molenaar Bouw BV	Graveland & Molenaar Bouw BV is a timber and construction company that specializes in new construction, renovations, and building maintenance.	Building & Construction → Renovation ⁴⁴⁰³ Building & Materials → Demolition ⁶⁸⁷	work ³¹²² construction ⁷⁴²¹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Lopik → Benschop ¹²⁶
hoefblok.nl	Hoefblok	Hoefblok is a block adhesive company specializing in the gluing of various block types, including sand-lime brick and concrete blocks, and offering services to clients for over 30 years.	Materials → Composites ⁵¹	adhesive ²⁴⁴ blocks ²⁹⁰ concrete ⁹⁷³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rdrie.nl	Rdrie B.V.	Rdrie B.V. is a company specializing in the restoration, renovation, and reproduction of cultural heritage.	Masonry & Plastering → Masonry ⁵⁷⁶ Construction → Building Science & Analysis ⁵³¹	reproduction ⁶⁰ injection ¹¹¹ sculpting ¹⁷¹ masonry ⁴⁶⁰ restoration ³⁴¹⁷ renovation ¹³⁸⁴⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
cleanwatersystems.nl	Clean Water Systems B.V.	Clean Water Systems is a consultancy office specializing in drinking water systems with a focus on water safety and legionella prevention.	Hygiene & Environmental Factors → Environmental Health ²⁵ Civil & Infrastructure → Water Works ¹⁶⁸	water safety ³⁷ legionella ⁷³ cleaning ⁴⁵⁶⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
schoonheidssalonexclusief.nl	Exclusief Skinstore & Salon	Exclusief Skinstore & Salon is a beauty salon in Bergambacht specializing in personalized skincare and treatments.	Science → Medical Sciences ⁹⁷ Medical Care & Services → Cosmetic Medicine ¹⁰⁶⁵	scan ⁷⁹⁰ skin ²⁵¹⁸ plan ²⁵⁶⁶ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
volleybalclubreeuwijk.nl	Volleybalclub Reeuwijk	The website of Volleybalclub Reeuwijk provides information about the club, its activities, and events.	Team Sports → Volleyball ⁸⁴²	volleyball club ⁵⁵ sports hall ²⁷⁰ match ³⁴⁷¹ club ⁴²²⁵ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
infra-techniek.nl	Infra-Techniek B.V.	Infra Techniek is a pavement and concrete milling company that offers support for the maintenance of infrastructure and provides pavement processing sets and cleaning services.	Civil & Infrastructure → & Waterways ⁹⁶ Civil & Infrastructure → Road Construction ⁴⁸¹	infrastructure ¹⁴⁶⁰ equipment ⁴¹⁴³	Krimpenerwaard → Bergambacht ³⁰³
roodsnavel.nl	Professor Roodsnavel Goochelaar	The website of Professor Roodsnavel Goochelaar presents his services as a magician and entertainer, with a focus on performances for children, seniors, and other groups.	Family Activities → Children’s Entertainment ⁵⁷¹	magic show ¹⁰ seniors ⁹⁰⁴ reviews ³¹⁷² child ¹¹⁵⁶⁶ event ⁴⁵¹⁹⁹	Westland → Wateringen ⁵³⁶
asiancare.nl	Stichting Asian Care	The website of Stichting Asian Care presents the activities of this mission organization, primarily focused on providing assistance to those in need, particularly in Pakistan and with interchurch partnerships.	Protestant Churches → Missions ⁸² Social Issues → Humanitarian Aid ⁶²¹	family support ²³ aid ⁴²⁷ mission ¹⁰⁰⁰ donation ⁵¹¹⁰ school ⁷⁸⁵⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
krimpen112.nl	Krimpen 112	The website provides the latest emergency news from Krimpen 112.	Emergency Services → Fire Department ¹³⁸ News & Journalism → Regional News ⁹⁴⁸	accident ³³⁰ fire ⁴²⁹ traffic ⁹¹⁶ scooter ¹²³⁶ building ³²⁰⁴ body ³⁴⁹⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
rouwbloemen-xl.nl	RouwbloemenXL	The website RouwbloemenXL is an online webshop that delivers sympathy arrangements in the Gouda region and surrounding areas. It offers an overview of various arrangements with different price categories and styles.	Essential → Home ⁷⁰⁷⁰⁸	sympathy arrangement ⁵⁴ flowers ³²⁴⁸ webshop ⁸⁶⁴⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
andreadogterom.nl	Andrea Dogterom	The website of Andrea Dogterom presents her work as a visual artist, specializing in clay sculpting, and provides insights into her artistic processes and exhibitions.	Artists & Studios → Notable Artists ⁴⁷ Painting → Individual Artists ⁶⁶⁸	sketch design ¹⁹ sculpting ¹⁷¹ clay ⁴⁹⁵ woman ¹⁴¹⁹ exhibition ⁵³³²	Krimpenerwaard → Stolwijk ²³²
wivon.nl	WIVON	The WIVON website provides information about the services of a certified chimney sweep in Oosterhout and the surrounding area.	Home Maintenance → Chimney Services ⁴⁰	chimney sweep ¹¹¹	Zundert → Wernhout ⁷⁷
meubelmakerijbram.nl	Meubelmakerij Bram.	The website of Meubelmakerij Bram. is a furniture maker located in Schoonhoven offering custom-made furniture, focusing on quality and individuality.	Interior → Furniture ⁷⁴⁵⁴	furniture piece ¹⁹ bed ¹³⁸⁴ cabinet ¹⁷³⁰ table ¹⁷⁷⁸ wood ⁴¹⁵³ furniture ⁸⁷⁵¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hc-krimpenerwaard.nl	Stal de Waal	The website of Stal de Waal presents the stable, its facilities, lesson offerings, and current coronavirus-related measures.	Animals → Animal Welfare ¹³⁷²	stable ⁷⁶⁸ facility ²⁶¹⁶ horse ⁴³³⁷ lesson ⁵¹⁵⁴	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
cityconsult.nl	City Consult	City Consult is a professional network organization that supports cities and regions with urban challenges through consulting and project management.	Urban Planning → Urban Development ³⁷⁸	knowledge ³⁵²⁸ partner ⁴²⁷² research ⁸⁹⁶⁷ strategy ⁹³⁷⁹	Gelderland → Ermelo ¹²⁰⁷
vidagarden.nl	Vidagarden	Vidagarden is a company that designs and realizes garden and terrace improvement projects.	Garden Maintenance → Gardeners ⁶⁸⁵ Garden Maintenance → Garden Landscaping ⁷¹¹	outdoor space ²⁴⁶ quotation ²⁵³ terrace ⁴⁸⁴⁷ garden ¹³¹²⁹ design ²⁷²⁰²	Bodegraven-Reeuwijk → Bodegraven ⁷⁴⁹
kantoorkaas.nl	Jacob van Schaik	The website of Jacob van Schaik is a connector who stimulates value research and collaboration, particularly in the Krimpenerwaard region. The goal is to help individuals and companies harness their potential and work together.	Self-Help → Life Questions ⁸²⁴ Education → Career & Guidance ¹¹⁵⁷	potential ⁶⁴² value ¹³⁵² conversation ¹⁸²⁸ recruitment ²⁰¹⁵ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Stolwijk ²³²
goudserak.nl	Huisartsenpraktijk Goudse Rak 2.0	The website of Huisartsenpraktijk Goudse Rak 2.0 provides patients with information about the practice, opening hours, team, appointments, repeat prescriptions, and other relevant healthcare information.	Digital & Telehealth → Patient Portals ³²⁹	prescription ⁸⁵⁹ patient ⁴⁰⁸² practice ⁹⁰⁸⁹ appointment ¹³⁵¹⁰ news ¹⁵²⁹³	Garmerwolde → Lageweg ¹²
houtvisiebv.nl	Houtvisie B.V.	Houtvisie is a specialist in sustainable woodworking, providing wood import, processing, construction, and execution for various projects.	Garden → Decking ⁴⁴ Wood & Timber → Wood ¹⁰³⁵	processing ³³⁴ sustainable ⁷³⁹ wood ⁴¹⁵³ construction ⁷⁴²¹	Krimpenerwaard → Bergambacht ³⁰³
speelgoedsteentjes.nl	Speelgoedsteentjes.nl	Speelgoedsteentjes.nl is an online shop selling Lego and Duplo building blocks and offers a wide variety of themes.	Toys → LEGO ¹⁹⁵	duplo ²¹ lego ³⁴¹ theme ⁴⁰¹⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
devriesinterieurprojecten.nl	De Vries Interieurprojecten	De Vries Interieurprojecten is an interior project company offering services from design to realization for both private and corporate clients.	Urban Planning → Area Development ⁷⁶ Project Management → Interior Projects ¹⁹	interior project ³⁰ execution ⁴²⁶ wishes ²⁷¹⁷ interior ⁸⁰⁹³ design ²⁷²⁰²	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
kruiswijkcontainer.nl	Kruiswijk Groep BV	The Kruiswijk Container website in Bergambacht offers the possibility to quickly and easily rent containers for various types of waste, with a focus on good service and competitive prices.	Waste Management → Waste Processing ⁹⁶ Waste Management → Container Rental ³⁶⁸	rent ⁹⁸¹ waste ¹³¹² container ¹⁷⁰⁹ price ⁸³²⁸	Krimpenerwaard → Bergambacht ³⁰³
metselbedrijf-dejong.nl	Metselwerken R & F de Jong	Metselwerken R & F de Jong is a bricklaying and pointing company that offers a range of services.	Masonry & Plastering → Masonry ⁵⁷⁶	bricklaying ⁵⁰ point ²¹⁷ masonry ⁴⁶⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
frietonwheels.nl	Frietonwheels	The Frietonwheels website is an organization that rents out mobile fry carts and related services for various events, including weddings, corporate parties, open days, schools, and private occasions.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Food Trucks ⁶²³	fry cart ¹⁹ truck ¹⁴¹² fries ²⁷⁵³ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	De Ronde Venen → Mijdrecht ⁷⁰⁰
enjoypilates.nl	Enjoy Pilates	The website of Enjoy Pilates offers various Pilates programs, including general Pilates, pregnancy Pilates, Pilates for men, and a specific program for people with complaints such as scoliosis, arthritis, and rheumatism, and Running.	Fitness → Pilates ⁵⁹⁸	pilates ⁵⁴⁵ pregnancy ²⁷³⁹ results ³⁹⁵⁴ lesson ⁵¹⁵⁴	Krimpenerwaard → Stolwijk ²³²
computer-reparatie-gouda.nl	Groene Computershop Gouda	The website Computer repair Gouda is an online platform of the Groene Computershop Gouda, offering computer repairs, sales of new and second-hand computers, and computer support.	Computer → Computer Repair ⁸⁹⁸ Computer Hardware & Peripherals → Computer Stores ²⁸¹	laptop ¹³²⁰ computer ¹⁹⁶⁹ part ⁵⁰⁴⁴ repair ¹⁴⁵⁷⁶	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
my-precious.nl	My Precious	My Precious is a design atelier specializing in the design and creation of handcrafted jewelry.	Jewelry → Handmade Jewelry ⁸⁶² Crafts → Goldsmithing ¹⁶⁸	pearl ¹¹⁰ silver ⁴⁷⁹ gold ⁸⁰⁵ gemstone ⁸⁵⁶ jewelry ⁴⁵⁹⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vignoble.nl	Huidverzorgingsinstituut Vignoble	Huidverzorgingsinstituut Vignoble offers personalized and natural skincare treatments and massages.	Cosmetics → Natural Cosmetics ²⁵⁴	skin type ²²⁹ natural ²³⁵ skincare ¹⁹⁷² relaxation ³⁹⁶⁸ massage ⁷⁶⁴⁶ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
baraq.nl	Baraq	The website of BARAQ presents an event location and organizes various events in the Schoonhoven and Krimpenerwaard region, focusing on parties, gatherings, and creative events.	Venues → Party Venues ³⁶³ Venues → Wedding Venues ²³²	venue ⁸⁷⁹ arrangement ³¹⁰⁴ agenda ⁴³⁷⁴ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
rost-schildersbedrijf.nl	Schildersbedrijf J.J. Rost	Schildersbedrijf J.J. Rost provides advice and execution of sustainable painting and wall finishing, based on 90 years of experience.	Home Improvement & Services → Home Maintenance ¹⁰⁰² Installation & Repair → Tradespeople ⁴⁰⁹	sustainable ⁷³⁹ paint ⁸⁷⁴⁷	Krimpenerwaard → Haastrecht ¹⁹³
toneelverenigingkdo.nl	Toneelvereniging KDO	The website of Toneelvereniging KDO presents information about the theater group, its activities, and upcoming performances, aiming to inform visitors and promote the group.	Theater → Theater Groups ⁶⁷³	cultuurhuis ¹¹ theater group ²²³ donor ⁷⁵⁷ performance ⁷⁵⁸⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
steinhoeveshop.nl	SteinHoeve Reclame & Media	The website of SteinHoeve Reclame & Media offers a wide range of advertising products and solutions, including flags, banners, signage, and lettering.	Graphic Design → Stickers ²⁷⁷ Office Supplies → Labels ¹⁹⁹	banner ⁵¹⁸ flag ⁵²⁹ letter ⁸³⁴ signage ⁸³⁸ advertising ²³⁰²	Krimpenerwaard → Haastrecht ¹⁹³
mariaflach.nl	Villa Joep	The website of Maria Flach showcases her artwork, primarily portraits, birds, and landscapes, created in oil paint, acrylics, and pastels. She also produces sculptures for Villa Joep.	Painting → Abstract Painting ⁵⁹⁴ Painting → Figurative Art ¹⁷⁷	angel ¹¹⁰ bird ⁹²² sculpture ¹⁴⁴⁰ landscape ²⁶⁰⁹ portrait ³⁶⁸⁵ paintings ³⁹⁰⁷	Krimpenerwaard → Ammerstol ⁴⁹
lentefairouderkerk.nl	Kerkvoogdij HHG activiteitencommissie	The website of the Lentefair in Ouderkerk aan den IJssel presents information about the annual market and the lookbacks of previous editions.	Local Events → Markets ¹⁰⁹⁷ Outdoor & Recreation → Outdoor Events ¹¹⁰	vendor ¹²⁸ sponsors ²⁶⁴² church ³⁴³⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
hetpolderland.nl	Vann Wijnen	The website presents the new construction project 'Het Polderland' in Krimpen aan de Lek, where residents and potential homeowners can contribute to the planning and future of the location.	Apartment Living → New Construction ¹³⁶² Local Economy & Development → Regional Development ²⁹⁶	housing ⁴³⁷⁸ municipality ⁶⁸³⁷ construction ⁷⁴²¹ nature ⁹⁰⁹⁴	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
fysio-wise.nl	Fysio Wise	Fysio Wise is a physiotherapy practice that offers specialized treatments using modern techniques.	Medicine → Physiotherapy ²³⁷²	shockwave ⁹⁸ fascia ¹⁴⁷ physiotherapist ⁴⁵³ ultrasound ⁷⁶⁹ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bartschouten.nl	Bart Schouten	The website of Bart Schouten presents his activities as a storyteller and organizer of ‘StoryTrail’ city walks in various provinces of the Netherlands, as well as educational projects and children’s performances.	Communication → Storytelling ²⁹⁷ Walking → City Walks ⁸⁰	storytrail ¹⁰ educational projects ¹² storyteller ⁷⁴ city walk ¹³⁰ performance ⁷⁵⁸⁶	Aa en Hunze → Spijkerboor ³²
fotohuismedia.nl	FotoHuis Media	FotoHuis Media is a media supplier specializing in photography and videography services for real estate agents.	Property Styling & Presentation → Photography ³⁹ Creative → Video ⁷⁷⁷	floor plan ³⁹⁴ drone ⁹³⁶ agent ¹²⁵³ styling ²³³¹ video ⁶⁷¹⁴ photography ⁹⁵⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jongbloedkeukenseninterieur.nl	Jongbloed Keukens & Interieurbouw	Jongbloed Keukens & Interieurbouw is a company specializing in the design and construction of kitchens and interiors, focusing on creating custom spaces that reflect the client’s wishes.	Kitchen → Kitchen Manufacturers ¹²⁰	kitchen ⁶⁴⁴³ interior ⁸⁰⁹³ installation ¹³⁷⁴² design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stefanderuitervof.nl	Hoveniersbedrijf Stefan de Ruiter VOF	Hoveniersbedrijf Stefan de Ruiter VOF offers garden design, landscaping, maintenance, and renovation services in the Netherlands, with a focus on creating a pleasant and attractive garden for the client.	Garden Maintenance → Gardeners ⁶⁸⁵ Agriculture → Horticulture & Floristry ¹⁴⁰⁴	landscaping ¹⁵²⁹ paving ¹⁹⁴² plant ⁴⁵⁰⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
de-laan.nl	Imkerij De Laan	Imkerij De Laan is a hobby beekeeping operation located in Lopikerkapel that keeps bees and produces honey.	Biodiversity → Pollinators ³¹ Agriculture → Beekeeping ²²⁹	hive ¹⁹ queen ⁵⁷ grassland ⁷¹ bees ³⁷³	Vijfheerenlanden → Everdingen ⁶⁴
vdbtechniek.nl	VDB Techniek	VDB Techniek is a company that provides solutions for technical problems, from design to construction of machines and equipment parts.	Business → Industry ³⁶⁹⁷⁷	machine ³⁷²⁷ construction ⁷⁴²¹ repair ¹⁴⁵⁷⁶ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
actuabewind.nl	Actua Bewind en Support	Actua Bewind en Support is a firm specializing in protective supervision (bewindvoering), aimed at assisting individuals with financial difficulties.	Debt Relief → Debt Assistance ²⁶⁸ Services → Personal Services ¹⁰⁶²	protective supervision ⁴³ bill ¹⁶³ income ⁶⁶⁰ debt ⁷¹⁷ financial ⁸⁵⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
garagestoppelenburg.nl	Garage Stoppelenburg	Garage Stoppelenburg is an auto garage located in Lekkerkerk, serving customers in the Krimpenerwaard and surrounding areas, offering services such as car maintenance, repair and vehicle inspection.	Repair → Garage ¹⁷⁷⁹ Automotive → Car Dealerships ¹⁶⁴⁷	customer friendliness ⁸⁰ garage ¹²¹⁰ inspection ⁴²⁷⁹ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
natuurlijksyl.nl	Natuurlijk Syl	Natuurlijk Syl is an organic hair salon specializing in treatments for hair, located in the Krimpenerwaard.	Wellness → Stylists ²⁴⁴	cut ⁹²⁶ hair ³⁰¹⁴ color ⁴¹⁵⁹ sustainability ¹⁸⁴⁵¹ treatment ²¹²⁰³
vitanimo.nl	Vitanimo	The Vitanimo website provides expert guidance for professionals, focusing on personal and professional development, team development, and professionalization.	Business Software → HR Management ³⁰ Professional Development → Supervision ⁷⁸⁸	team development ²⁷⁷ supervision ¹¹⁸⁴ sector ¹³³² professionals ¹⁹⁶⁶ coach ²⁵⁸¹⁰	Katwijk → Katwijk aan Zee ⁶¹⁶
kvoekraine.nl	Krimpenerwaard for Ukraine Committee (KvO)	The website of KvO (Krimpenerwaard for Ukraine Committee) provides information about the reception of Ukrainians in the Krimpenerwaard region and offers details on the organization’s activities and volunteer opportunities.	Social Issues → Humanitarian Aid ⁶²¹ Government & Administration → Municipal Services ⁸³⁴	residence ²⁵¹ volunteer ⁸³⁶⁷	Krimpenerwaard → Stolwijk ²³²
kcdeschakel.nl	Kerkelijk Centrum ‘De Schakel”	Kerkelijk Centrum ‘De Schakel’ is an event location in Bergambacht, Krimpenerwaard, offering rental of halls for various occasions, from business meetings to family gatherings and events.	Venues → Halls ⁴¹⁹ Culture → Religion ⁸³²⁷	hall ¹⁷⁸⁶ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
poeliersbedrijfwildewit.nl	Poeliersbedrijf Wil de Wit	Poelier Wil de Wit Nieuwerbrug is a wholesale business specializing in the processing and supply of chicken and chicken specialties.	Supermarkets & Grocery → Butchers ⁷⁴⁷ Food → Meat ¹¹²³	poultry ¹⁸⁰ market ²⁷⁷² assortment ⁷⁷⁹⁹	Westland → Monster ³⁶⁰
remcodijkstragoudsmederij.nl	Remco Dijkstra Goldsmith	The website of Remco Dijkstra Goldsmith showcases a goldsmith in Emmeloord who designs and manufactures unique, handcrafted jewelry based on personal wishes and stories.	Crafts → Goldsmithing ¹⁶⁸	goldsmith ²²⁴ jewelry ⁴⁵⁹⁹ story ⁸²⁸⁵ workshop ¹⁹³²⁵ design ²⁷²⁰²	Noordoostpolder → Emmeloord ¹⁶⁴⁹
fysiotherapiezilverstad.nl	Fysiotherapeut Schoonhoven	The website of Fysiotherapeut Schoonhoven provides information about physiotherapy and related treatments, specializations, partnerships, and opening hours.	Physiotherapy → Pediatric Physiotherapy ³²⁷	pediatric physiotherapist ¹⁴ manual therapy ¹³²⁰ physiotherapy ⁴⁶⁸⁸ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
izi-cijfers.nl	ZI!	ZI! provides administrative and financial services to entrepreneurs, SMEs, and individuals.	Company & Business → Individuals ⁸²⁷ Finance & Insurance → Tax Systems ⁸³³	payroll ¹⁸²³ tax ²¹⁰⁰ administration ⁶⁵⁸⁷ network ¹¹¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
knappekat.nl	Knappe Kat Trimsalon	Knappe Kat Trimsalon is a grooming salon specializing in cat coat care.	Dogs → Grooming ¹⁶⁰	coat ⁴⁶⁰ grooming ⁸⁹⁶ cat ¹⁵⁷⁸ salon ⁵⁵⁴¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
hofvanlangerak.nl	Hof van Langerak	Hof van Langerak is a small-scale senior housing complex focused on community and adaptability for all ages.	Social Housing → Small-Scale Housing ⁴⁴ Water Transportation → Ferries ¹²⁹	courtyard ²⁰⁶ unit ⁴⁰⁵ housing ⁴³⁷⁸ environment ⁴⁸⁷³ community ⁷⁹³¹	Molenlanden → Langerak ⁵²
sterkers.nl	Sterkers	Sterkers offers coaching and counseling, including relationship therapy and EMDR, in Schoonhoven.	Relationships → Relationship Problems ⁶⁴³	boundaries ⁵⁴⁶ relationship ⁴²⁰⁵ therapy ⁷⁴⁴⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
galajurken-in.nl	Galajurk Winkel	The website presents a gala dress shop and offers information about the location, opening hours, and customer base.	Fashion → Evening Wear ¹⁶ Context ¹⁶¹³⁹⁴	gala dresses ¹⁷ accessories ¹²⁹⁷⁵	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
denederlandsezoutbank.nl	The Nederlandse Zoutbank	The Nederlandse Zoutbank is a specialist in the procurement, transport, storage, and delivery of salt, aiming to ensure the safety and continuity of salt supplies.	Logistics → Storage ¹¹⁷⁰ Construction → Civil & Infrastructure ³⁴⁵³	salt ¹⁵⁰ packaging ²²³⁶ storage ²⁴⁴⁶ network ¹¹¹²³	Krimpenerwaard → Bergambacht ³⁰³
qualituin.nl	Qualituin	The Qualituin website presents a landscaping company specializing in garden design, construction, and maintenance for both private homes and businesses.	Plants → Garden Plants ²²⁰ Outdoor & Garden → Horticulture Companies ²⁹	photo album ⁶⁸⁶ landscaping ¹⁵²⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Haastrecht ¹⁹³
uitlaatservicekrimpenerwaard.nl	Hondenuitlaatservice Krimpenerwaard	Hondenuitlaatservice Krimpenerwaard offers a dog walking and dog snack service in the Gouda, Krimpenerwaard, and Krimpen a/d IJssel region.	Dog Care → Dog Walking Service ³⁵⁶ Family → Pet Services ⁵⁴	field ⁵²⁷ game ²⁸⁰⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Bergambacht ³⁰³
svdesign.nl	SV Design	SV Design is an all-round internet agency based in Schoonhoven that helps businesses develop their own online identity and promote their company.	Branding & Identity → Brand Strategy ⁴⁶¹	identity ¹⁰²⁸ promotion ²⁰⁶² webdesign ⁴⁰⁹²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jachtservicedeijssel.nl	Jachtservice De IJssel	The Jachtservice De IJssel website offers professional maintenance, repair, and refit services for yachts, boats, and sloops, with a focus on the Capelle aan den IJssel region and surrounding areas, and is also active nationwide.	Boating → Boat Maintenance ¹⁸³ Water Activity → Water Sports ²⁹⁴⁴	sticker ²²¹ yacht ⁶⁴⁷ engine ⁷⁵⁸ boat ²⁹⁸⁰ part ⁵⁰⁴⁴ maintenance ²⁰⁰⁹³	Stichtse Vecht → Breukelen ⁶³²
vuik-logistics.nl	Vuik Logistics	The website of Vuik Logistics presents logistics services, including transport, loading and unloading, express transport, distribution, and home delivery, with a focus on customer satisfaction and family business values.	Transport Companies → General Transportation ⁶¹ Logistics & Transport → Logistics ⁷⁴⁴⁴	loading and unloading ¹¹ home delivery ²³ transport ⁶¹⁰⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
geleijntransport.nl	Geleijn Transport	Geleijn Transport is a transportation company with a long history specializing in the transport of various goods, including shipping containers and loose bulk products.	Transportation Services → Refrigerated Transport ²²⁶	container ¹⁷⁰⁹ driver ¹⁸³² route ³⁴²⁵ relationship ⁴²⁰⁵ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
hoogendijktransport.nl	Hoogendijk Transport	Hoogendijk Transport is a transport company specializing in the transportation of shipping containers.	Transport Companies → General Transportation ⁶¹	load ¹³⁶ container ¹⁷⁰⁹ vehicle ³⁷⁴³ transport ⁶¹⁰⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
barthugooptiek.nl	Bart-Hugo Optiek	Bart-Hugo Optiek is an optician located in Lopik that sells eyeglasses, contact lenses, and sunglasses, and offers fitting services.	Eye & Vision → Vision Care ¹⁹ Services → Opticians ⁵⁵¹	eyeglasses ⁴³⁷ lenses ⁴³⁸ sunglasses ⁵¹⁶ contact lenses ⁵³⁸ frames ²⁵⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
verburgcapital.nl	Verburg Capital	The website of Verburg Capital presents the organization, its mission and investment strategies, with a focus on sustainability and ensuring the continuity of businesses and charities.	Investing → Asset Management ³¹⁸	asset management ³¹⁵ charity ⁷⁰⁰ investment ²⁰⁷⁰ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Stolwijk ²³²
nieuwveldschilders.nl	Nieuwveld Schilders	Nieuwveld Schilders is a painting company based in Bergambacht offering painting, wall finishing, and glazing services to individuals, businesses, and government organizations.	Insulation → Glazing ¹⁸⁸ Maintenance & Repair → Facility Services ⁶⁷¹	glazing ⁴⁸² painter ⁷⁴⁰ paint ⁸⁷⁴⁷ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
trimsalonchicolien.nl	Trimsalon Chicolien	Trimsalon Chicolien is a personal grooming salon in Berkenwoude that offers professional grooming services for dogs.	Dog Care → Grooming Salons ⁶⁵¹ Local Communities → Villages ¹⁰⁰⁵	coat ⁴⁶⁰ grooming ⁸⁹⁶ dog ⁵⁴⁸³ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Krimpenerwaard → Berkenwoude ⁶²
verkuilbouw.nl	Verkuil Bouw	Verkuil Bouw is a construction company specializing in woodworking and renovations in the Alblasserwaard, Krimpenerwaard and Lopikerwaard regions.	Wood & Timber → Timber ³³⁵ Exterior Works → Outdoor Living ¹²	outdoor living ⁶² dormer ⁹⁹ extension ¹⁹⁴¹ wood ⁴¹⁵³ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	Molenlanden → Groot-Ammers ¹⁵⁸
installatiebedrijfgardenier.nl	Installatiebedrijf Gardenier	Installatiebedrijf Gardenier is an installation company based in Krimpen aan den IJssel that offers a variety of installation services.	Personal & Household → Service Industry ³⁷⁶ Installation & Mounting → Installers ¹⁰⁰⁷	zinc ³⁶⁷ sanitary ⁷⁵⁰ boiler ¹²⁴⁰ plumbing ¹⁷⁶¹ heat ²¹⁸⁸ roof ³⁶⁶²	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
hanic-projecten.nl	Vloerenbedrijf Hanic	Vloerenbedrijf Hanic is a flooring company offering a wide range of flooring coverings and window decorations, as well as project covering.	Flooring → Carpets ²⁹⁶	linoleum ²⁹ carpet ⁸⁴⁰ assortment ⁷⁷⁹⁹ interior ⁸⁰⁹³	Krimpenerwaard → Ammerstol ⁴⁹
zorgboerderijhetboereerf.nl	Het Boere Erf	Het Boere Erf offers day activities for adults with dementia in a peaceful, green environment.	Neurology → Dementia ⁵⁰⁹ Outdoor Adventures → Walking ¹²⁶⁰	food forest ²²⁹ ipad ⁴⁰⁴ dementia ⁶⁷⁴ farm ²⁶²²	Oudewater → Hekendorp ²⁸
bredeschoolgrotewaal.nl	Brede School Grote Waal	The website of Brede School Grote Waal describes the activities and projects of a school that focuses on creating a livable neighborhood and developing children's talents, in collaboration with parents and partners.	Primary Education → Comprehensive School ¹³ Neighborhood Focus → Neighborhood Residents ¹³	kindcentrum ⁷⁴ library ⁹⁸⁸	Krimpenerwaard → Gouderak ¹⁰³
plienas.nl	pliena	The website of Paulina Verzijden showcases her artwork as an artist, focusing on the use of vibrant colors, diverse materials and techniques including enameling, glassblowing, and ceramics. The site also provides information about her education and artistic inspiration.	Jewelry → Handmade Jewelry ⁸⁶² Decorative Arts & Crafts → Glass Art ¹²⁸	enamel ³⁸ weave ¹¹⁸ ceramics ¹²⁷¹ glass ²⁹¹⁹ studio ⁵⁴⁶⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gospelkoorelim.nl	Gospelkoor Elim	The website of Gospelkoor Elim provides information about the gospel choir, including the agenda, members, contact details, and a registration form.	Choir → Gospel Choir ¹⁵⁰ Social Organization → Religious Organizations ¹⁰⁶⁹	choir ³¹²³ agenda ⁴³⁷⁴ concert ⁴⁴⁰⁹ member ¹⁰¹⁵⁴ music ¹³¹⁷⁰	Krimpenerwaard → Bergambacht ³⁰³
lindaskraamzorg.nl	Linda Verweij	Linda's Kraamzorg Schoonhoven and surroundings is a website offering maternity care services in the Krimpenerwaard region.	Health → Travel Needs ¹⁰ Health → Medical Care & Services ²⁹⁴⁶¹	aftercare ²²⁴ maternity care ²³⁰ breastfeeding ³⁹⁸ baby ¹⁸⁹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
drenthschilderwerken.nl	Drenth Schilderwerken	Drenth Schilderwerken is a painting company that provides services in the Krimpenerwaard and surrounding areas.	Painting → Professional Painting ¹⁵³ Finishing & Trades → Painting Contractor ¹⁶⁸	painting company ³⁰⁶ home ⁷⁹⁷⁶ paint ⁸⁷⁴⁷	Flevoland → Almere ⁷⁷⁶⁵
vba-belastingadvies.nl	Veenstra Tax Advisory Bureau	Veenstra Tax Advisory Bureau is a tax advisory firm specializing in tax issues for national and international clients.	Company & Business → Individuals ⁸²⁷	tax issues ¹³ business succession ⁴³ mergers and acquisitions ⁵¹ tax advice ¹⁵²²	Krimpenerwaard → Berkenwoude ⁶²
de-melkfabriek-schoonhoven.nl	De Melkfabriek Schoonhoven	The Melkfabriek Schoonhoven is a flexible location offered for various activities, including coaching, co-working, events, and workshops.	Venues → Event Spaces ⁴³² Office & Workspace → Coworking ¹²⁷	facility ²⁶¹⁶ space ³⁸⁴⁶ coach ²⁵⁸¹⁰ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
voorhuisaandelek.nl	Cees and Lydia vd Wal	The website of Bed & Breakfast 't Voorhuis aan de Lek presents a charming B&B located on the Lek River, near the Kinderdijk windmills, and provides information on reservations, prices, and the surrounding area.	Accommodation → Beds ²²⁸ Nature → Estates ⁷⁷¹	windmill ²⁴⁹ bed & breakfast ³¹⁹ fireplace ⁷⁵² breakfast ¹⁸²² cycle ¹⁹⁰⁶	Molenlanden → Kinderdijk ¹⁵⁸
caminohulp.nl	Peter Prins	The Camino website offers home-based psychological support to clients in the Krimpenerwaard, Gouda, and Moordrecht regions, utilizing methods from positive psychology and other approaches.	Professional Development → Supervision ⁷⁸⁸ Mental & Emotional Well-Being → Youth Therapy ⁵³²	walk therapy ²⁶ positive psychology ⁴² counseling ⁷⁴¹	Zuidplas → Moordrecht ³³²
mevrouwmond.nl	Annemarie Frederiks	The website of Mevrouw Mond offers scented candles with humorous themes around oral hygiene and dental care, emphasizing a fresh and playful appearance.	Gifts → Gift Ideas ³⁹⁷	oral hygiene ²⁵⁶ humor ³⁵³ name ⁶⁸³ candle ⁷⁹² gift ⁶⁴⁴²	Krimpenerwaard → Haastrecht ¹⁹³
richardcasteleijn.nl	Richard Casteleijn	The website of Richard Casteleijn showcases the services of an experienced carpenter specializing in attic renovations and Velux roof windows installation.	Roofing → Skylights ⁴⁷¹ Roofing → Roof Windows ¹⁰¹	attic renovation ²¹ roof window ¹⁶⁷ wall ¹³⁷⁸ plaster ²¹⁷⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
tvstolwijk.nl	Tennisvereniging Stolwijk	Tennisvereniging Stolwijk is a tennis club with a gravel court, a children's area, and a clubhouse that organizes events and tournaments.	Tennis → Tennis Clubs ⁷²⁰	clubhouse ⁷⁸⁴ court ⁹⁹⁹ tournament ²⁴⁷⁶ reservation ³³⁷³ member ¹⁰¹⁵⁴	Krimpenerwaard → Stolwijk ²³²
vandervoetrotterdam.nl	Van der Voet Rotterdam B.V.	Van der Voet Rotterdam B.V. is a new company that started a new location in Rotterdam on January 1, 2021, focusing on advice and entrepreneurship within an automated working environment.	Government & Legal → Tax ¹³²²	salary ⁵¹³ financial ⁸⁵⁵ tax ²¹⁰⁰ office ²⁸⁹⁸ technology ⁶⁸¹⁶	Krimpenerwaard → Haastrecht ¹⁹³
koudstaalblanken.nl	KOUDSTAAL & BLANKEN	The website of KOUDSTAAL & BLANKEN describes ergotherapy, a paramedical profession focused on improving the functional skills of patients in their daily lives.	Rehabilitation → Ergotherapy ²²³ Rehabilitation & Therapy → Paramedical Care ⁷⁵	function ²²¹ ergotherapy ²²¹ environment ⁴⁸⁷³ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hethuisvannu.nl	The House of (N)U	The House of (N)U is a location in Capelle a/d IJssel that helps residents maintain independence for as long as possible, by showcasing aids, promoting social activities, and offering personalized solutions.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	residence ²⁵¹ aid ⁴²⁷ independence ⁴³⁵	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
werkenbijdevierwindstreken.nl	Stichting PCPO De Vier Windstreken	The website of De Vier Windstreken presents job vacancies for various positions within the team of primary schools and special needs primary schools.	Municipalities → Maas ²⁶	position ⁸⁷⁵ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸ school ⁷⁸⁵⁶	Zuidplas → Moordrecht ³³²
panoramaview.nl	IMAGEDRUM Fotografie	The website 'Rotterdam in 360°' provides 360° panoramic views of Rotterdam and other cities, allowing visitors to virtually explore the city.	Virtual & Augmented Reality → Virtual Reality ³⁶¹ Context ¹⁶¹³⁹⁴	panorama ⁸⁴ bridge ⁵⁵⁷ map ⁸⁰¹ city ¹⁸⁷⁵ category ²³¹⁶	West-Betuwe → Neerijnen ⁶¹
overeemarchitecten.nl	Overeem Architecten	Overeem Architecten is an architecture firm based in The Hague specializing in residential development projects, renovations, transformations and restorations.	Architecture → Architectural Services ¹⁰⁰⁶ Architecture & Design → Building Consulting ³¹⁴	housing corporation ⁴²⁴ architect ⁶⁰⁹ renovation ¹³⁸⁴⁹	Hollands Kroon → Anna Paulowna ²⁹¹
hovenierstolwijk.nl	Hoveniersbedrijf van Leeuwen	The website of Hoveniersbedrijf van Leeuwen showcases the services and expertise of the company, focusing on garden maintenance, landscaping, and street work.	Garden → Paving ¹⁰⁰³	streetwork ¹¹² garden maintenance ⁴⁶² family business ⁷⁹³ landscaping ¹⁵²⁹ paving ¹⁹⁴²	Krimpenerwaard → Vlist ³⁷
gsmlekkerkerk.nl	GSM Lekkerkerk	The website GSM Lekkerkerk provides maintenance, repair, sales, and service for smartphones and tablets, with a focus on Apple and Samsung products. They also offer business solutions and a guarantee period.	Mobile Phones → Smartphone Repair ⁷⁹ Mobile Phones → Smartphones ⁴¹²	phone ¹¹⁶³ smartphone ¹³⁴⁴ warranty ⁴⁷⁰¹ part ⁵⁰⁴⁴ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
petrashairstyle.nl	Petra's Hairstyle	The website of Petra's Hairstyle in Schoonhoven provides information about hairdressing services, prices, opening hours, and products, and facilitates making appointments by phone.	Services → Hairdressers ¹⁰²¹	wash ²⁵⁴ cut ⁹²⁶ hairdresser ¹³⁷² hair ³⁰¹⁴ price ⁸³²⁸ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
post-groep.nl	Post-Group	The Post-Group website is a facility management service provider offering a range of services.	Transportation Services → Car Transport ⁹³	car cleaning ⁴⁶ garage ¹²¹⁰ logistics ³²⁵⁷ certification ³³⁸⁰ cleaning ⁴⁵⁶⁷ real estate ⁴⁹⁸¹	Krimpenerwaard → Haastrecht ¹⁹³
siamshalommassage.nl	Siam Shalom	Siam Shalom offers Traditional Thai massage in Stolwijk, with a focus on relaxation and well-being.	Massage → Thai Massage ⁴⁸⁹ Culture → Asian Culture ⁴⁰	aromatherapy ³⁰⁵ ambiance ⁴⁵⁴ therapist ¹⁸⁹⁰ foot ¹⁹²⁹ relaxation ³⁹⁶⁸ massage ⁷⁶⁴⁶	Krimpenerwaard → Stolwijk ²³²
fysiotherapiemsc.nl	Fysiotherapie MSC	The Fysiotherapie MSC website offers physiotherapy treatments for various painful conditions and rehabilitation, with a focus on the Krimpenerwaard region.	Pain → Chronic Pain ²⁴⁰	rehabilitation ¹⁵¹² pain ¹⁹¹⁹ physiotherapy ⁴⁶⁸⁸ appointment ¹³⁵¹⁰	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
svoc.nl	Stolwijk & Van Onselen Consultancy	The website of Stolwijk & Van Onselen Consultancy is an independent security consulting firm providing risk analysis, security plans, specification writing, supplier selection, and implementation of security concepts for private and business clients.	Information Technology → IT Security ⁹⁸⁰ Security & Surveillance → Security ³²⁵¹	security plan ¹⁹ risk analysis ²¹⁷ specification ²²⁵ implementation ¹⁰²⁹ supplier ¹⁷²⁵ security ⁶⁶⁵⁵	Haarlemmermeer → Schiphol-Rijk ⁷²
josgym.nl	JOSGYM	The JOSGYM website offers personal training and nutrition advice in Bergambacht and surrounding areas, aiming to help individuals get fit and enjoy sports.	Personal Development → Motivation ⁴³⁴	fun ²⁴¹ motivation ⁸⁹⁴ nutrition ⁴⁹³⁵ goal ⁴⁹⁷⁴ training ²⁸¹³³	Krimpenerwaard → Bergambacht ³⁰³
spicedfoodies.nl	Spiced Foodies	Spiced Foodies is a world shop in Schoonhoven offering a wide range of Surinamese, Indian and Asian products and ingredients.	Cooking & Recipes → Spices ¹⁴⁴ Supermarkets & Grocery → Food Stores ¹⁰⁵⁸	spices ³⁴⁰ rice ⁶³⁵ herbs ⁹²⁴ webshop ⁸⁶⁴⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
accentdrukkerij.nl	Accent Drukkerij	Accent Drukkerij is a printing company offering a variety of printing products and graphic services in the Lopik region and surrounding areas.	Academic → Dissertations ³⁹	layout ⁸⁹⁹ graphic design ²⁰⁴² branding ⁴⁶¹⁴ print ⁵⁵¹¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hafkampmakelaardij.nl	Hafkamp Makelaardij and Valuations	Hafkamp Makelaardij and Valuations is a real estate agency and valuation firm located in Barendrecht, specializing in property valuations and purchase assistance.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Real Estate → Intangible Services ⁵⁵	purchase assistance ²² property valuation ²⁵ property ⁷⁴⁰⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
elektrischescooterhuren.nl	Cenf	The website offers electric scooters for rent for recreational rides.	Corporate Events → Corporate Outings ⁸⁷⁸ Electric Vehicles → Electric Scooters ¹⁰⁸	freedom ⁸⁴⁸ ride ¹⁰⁷⁵ scooter ¹²³⁶ parking ¹⁹²⁸ route ³⁴²⁵	Lansingerland → Bleiswijk ⁵⁷⁹
boeiereizen.nl	Boeie reizen	Boeie reizen organizes vacations and overnight stays for young people with disabilities.	TravelBrands → Travel Agencies ¹⁸⁴⁰ Events → Special Interest Travel ²¹	overnight stay ⁵⁸ guide ¹³⁶⁴ vacation ⁴²³⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
tintem.nl	Tintem Blinderingen	The website of Tintem Blinderingen offers professional window tinting services for cars, houses, and offices, with a focus on tinting cars. The company is based in Lekkerkerk and provides price quotes and a professional installation.	Transportation → Automotive Care ¹⁸⁵	tinting ⁵⁶ film ³⁰⁰⁷ price ⁸³²⁸ car ¹⁰⁸⁶⁵ appointment ¹³⁵¹⁰ installation ¹³⁷⁴²	Krimpenerwaard → Lekkerkerk ²⁴⁴
mooicrempene.nl	Stichting Mooi Crempene	The website of the ‘Mooi Crempene’ foundation aims to make Krimpen aan de Lek a more beautiful and livable place by developing the IHC/Boogaerdt-site.	Local Governance → Civic Engagement ⁵¹⁵	objective ⁴¹⁵ site ⁴²² plan ²⁵⁶⁶ foundation ⁶⁶⁷⁸ nature ⁹⁰⁹⁴	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hawaii-band.nl	N/A	The website offers Hawaiian-themed workshops and entertainment, including bands, percussion, dancing, and decorations, for various occasions.	Music & Performance → Party Bands ³⁶⁷ Arts & Culture → Dance ²⁶⁸⁷	percussion ¹⁷⁵ dance ¹⁸³⁴ band ²⁹⁷⁷ decoration ⁴⁰⁸⁵ music ¹³¹⁷⁰ workshop ¹⁹³²⁵	Leudal → Haelen ¹³¹
voltigeverenigingkrimpenerwaard.nl	Voltige Vereniging Krimpenerwaard	Voltige Vereniging Krimpenerwaard is a riding club that offers voltige training.	Clothing → Activewear ⁶⁴² Apparel → Equestrian ²³¹⁹	vault ⁴⁵ horse ⁴³³⁷ association ⁸⁵⁶²	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
werkenbijcasteleijn.nl	Casteleijn Stroopwafels B.V.	The website presents job vacancies and provides information about the company and its culture.	Bakery & Food Production → Bread ⁷⁶⁵ Pastry → Waffles ¹⁷	corporate culture ²⁹ stroopwafel ⁷⁶ employee ⁴⁴²⁹ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Bergambacht ³⁰³
maatkappers.nl	Maat Kappers	Maat Kappers is a hair salon with multiple locations offering personalized hair styling to its customers.	Dermatology → Scalp Care ⁴⁰²	hair ³⁰¹⁴ app ⁴⁵⁹⁵ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Rotterdam → Prins Alexander ⁴³²
reformatorischeoppas.nl	Reformatorische Oppas	Reformatorische Oppas is a Christian platform connecting childminders, parents, and childcare agencies.	Childcare → Nanny Agency ⁷³	nanny ²²⁴ parent ⁴³¹⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bcbluesky.nl	Badminton Club Blue Sky Bergambacht	The website of Badminton Club Blue Sky Bergambacht provides information about the association, its activities, members and events, and offers opportunities to become a member or visit the club.	Combat → Badminton ⁷⁰²	badminton ⁴⁵³ youth ³¹²⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴²	Krimpenerwaard → Bergambacht ³⁰³
bclekkerkerk.nl	BC Lekkerkerk	BC Lekkerkerk is a badminton association in the Krimpenerwaard, offering various sports and youth activities.	Associations → Sports Associations ¹⁰⁸² Combat → Badminton ⁷⁰²	badminton ⁴⁵³ competition ⁴⁷⁵⁹ association ⁸⁵⁶² membership ¹⁰⁴⁴² training ²⁸¹³³
smashkc.nl	Smash KC	This website is an online platform for the Smash KC table tennis club in Schoonhoven, South Holland, providing information, news, and archives of the club.	Sports Clubs → Table Tennis ⁴⁹⁵ Combat → Badminton ⁷⁰²	table tennis club ⁸¹ minutes ¹⁶⁹ championship ²¹⁰ archive ²⁰⁶⁷ results ³⁹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
lekkerebroodjes.nl	Lekkere Broodjes	The Lekkere Broodjes website offers online ordering for fresh sandwiches, salads, and beverages, with delivery to the Haastrecht, Gouda, Oudewater, and Stolwijk region.	Lunch → Sandwiches ⁴⁶⁶	salad ²⁴⁴⁴ sandwich ⁴⁰⁹⁸ drink ⁵¹⁹¹ menu ¹³⁸⁵⁶	Krimpenerwaard → Haastrecht ¹⁹³
oomsadministratiekantoor.nl	Ooms Administratiekantoor	Ooms Administratiekantoor is an accounting firm located in Schoonhoven that provides financial and tax services to businesses and individuals.	Accounting → Business Accounting ⁶⁸⁸ Company & Business → Individuals ⁸²⁷	tax returns ⁴²³ annual report ⁸⁷⁷ payroll ¹⁸²³ administration ⁶⁵⁸⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
qualitysteel.nl	Quality Steel	The website of Qualitysteel Lekkerkerk Zuid Holland presents the services of a company specializing in the supply and fabrication of piping and construction work in stainless steel (RVS) and carbon steel (CS), including welding services, skid building and project assistance.	Metalworking → Welding ⁸⁹³ Construction Companies → Construction Contractors ⁵³⁶	construction work ¹²⁸ pipe ⁶⁹⁵ welding ¹⁰⁵¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
creatiesvanclaudia.nl	Creaties van Claudia	The website ‘Creaties van Claudia’ is an online shop selling unique, handmade polymer clay earrings.	Jewelry → Handmade Jewelry ⁸⁶²	coral ³⁶ clay ⁴⁹⁵ earrings ⁵⁷⁸ online shop ¹³¹⁰	Alphen aan den Rijn → Boskoop ⁶⁵²
schipholtaxi-nl.nl	Schipholtaxi-NL	The Schiphol Taxi-NL website provides online taxi bookings to and from Schiphol Airport, offering fixed rates, 24/7 service, and up to 70% discounts.	Taxi & Ride Services → Airport Transportation ³⁶⁵ Transportation → Flights ⁶⁷⁵	aviation ¹⁸⁰ bookings ⁵²³ taxi ²⁰⁹⁰ rate ²⁶⁰⁶	Haarlemmermeer → Schiphol ²¹⁶³
sparta-krimpen.nl	Gymnastiekvereniging Sparta	Gymnastiekvereniging Sparta is a sports club that offers recreational gymnastics and fitness for various age groups.	Sports Clubs → Gymnastics ⁴⁸¹	gymnastics ⁵⁰² fee ⁶⁴⁰ youth ³¹²⁶ insurance ⁶³⁵⁹ membership ¹⁰⁴⁴²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
fysiotherapiepraktijkkorenhof.nl	Fysiotherapiepraktijk Korenhof	The website of Fysiotherapiepraktijk Korenhof in Schoonhoven offers advice and treatment for various complaints, conditions, and injuries, with the goal of promoting patient recovery and mobility.	Medicine → Physiotherapy ²³⁷² Health → Senior & Geriatric ¹⁵⁸⁵	tens ¹⁶ medical taping ⁸⁸ dry needling ⁴²⁴ rehabilitation ¹⁵¹² physiotherapy ⁴⁶⁸⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
waddinxveenloodgieter.nl	Loodgieter Waddinxveen	The website Waddinxveenloodgieter.nl provides emergency service for plumbing work, drain cleaning, and leak repair in Waddinxveen and surrounding areas.	Home Improvement → Plumbing ²⁷³³ Installation & Repair → Sanitation ²⁸⁹	cv boiler ¹⁷³ drain ⁸⁸⁶ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Alphen aan den Rijn → Boskoop ⁶⁵²
loodgietermoordrecht.nl	Loodgietermoordrecht.nl	The website Loodgietermoordrecht.nl provides an emergency service for plumbers in Moordrecht and surrounding areas, including drain cleaning, leak repair, and maintenance.	Home Improvement → Plumbing ²⁷³³	plumbing work ⁶⁹ leak ¹²⁰⁴ plumber ¹²¹⁰ drainage ¹³²² quote ¹²⁸⁶³	Zuidplas → Moerkapelle ²¹³
jsvastgoedmanagement.nl	JS Vastgoedmanagement BV	JS Vastgoedmanagement is a company specializing in property management and consulting, with particular expertise in homeowners associations (VvE’s), churches, and schools, and providing project leadership.	Business → Business Services ¹¹⁵³⁷⁹	maintenance plan ⁸⁷ property ⁷⁴⁰⁶ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Stolwijk ²³²
eigensekaas.nl	Eigense Kaas	Eigense Kaas is a farm cheese maker that produces traditional cheese using milk from its own cows in the Krimpenerwaard region.	Dairy → Cheese ⁵³⁰ Sustainable Practices → Farming ¹³⁸	cheese factory ¹² cow ⁵⁹⁶ tradition ⁷³⁶ cheese ¹²⁰⁵ employee ⁴⁴²⁹ history ⁷²⁸⁶
tandartskrimpen.nl	Tandartsspoedpraktijk Krimpen aan de Lek	The website of Tandartspraktijk Krimpen aan de Lek provides information about the practice, the dentists, opening hours, and the possibility of an emergency service.	Dentistry → Implantology ³⁰⁴	implantologist ¹⁴ assistant ²⁶¹ dentist ²⁵¹⁴ opening hours ²⁹⁵³ practice ⁹⁰⁸⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
edelsmederijtessatiemessen.nl	Edelsmederij Tessa Tiemessen	The website of Edelsmederij Tessa Tiemessen showcases the services of a goldsmith who designs and creates custom rings and jewelry, translating emotions and personal stories into unique, meaningful pieces.	Jewelry → Goldsmiths ³¹⁹ Services → Personal Services ¹⁰⁶²	ring ⁸⁰⁰ gold ⁸⁰⁵ atelier ¹⁴¹⁷ emotion ²¹⁶⁹ jewelry ⁴⁵⁹⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
slobsite.nl	Bouwkundig Tekenburo Slob	The website is a bureau offering architectural drafting and consulting services, primarily for private and business clients.	Architecture → Architectural Services ¹⁰⁰⁶ Architecture & Design → Building Consulting ³¹⁴	architectural ²⁰ drafting ³⁰⁸ drawings ¹³²⁹ application ³³⁷⁷ consulting ³⁶³⁹	Buren → Maurik ¹⁶²
tillytollenaar.nl	Pianodocent	The website of Pianodocent, owned by Tilly Tollenaar, offers piano lessons located in Bergambacht, initially established in 1981. It is a platform where individuals, particularly children, can learn to play the piano.	Instrument → Piano ⁵⁷² Music Education → Piano Lessons ³¹⁷	classical ¹⁶ music school ¹¹⁵ conservatory ²³⁷ piano ⁸²⁰ lesson ⁵¹⁵⁴	Krimpenerwaard → Bergambacht ³⁰³
theaterwandeling.nl	Stadsavonturen	Stadsavonturen is an organization specializing in providing city walks, corporate outings, and theater walks in various Dutch cities.	Family Activities → Outings ⁷⁶³ Corporate Events → Corporate Outings ⁸⁷⁸	city walk ¹³⁰ corporate outing ³⁸⁸ dinner ¹⁵³³ production ⁴⁵⁸²	Bronckhorst → Vorden ⁴¹⁶
provincialewegoost44.nl	Jacob I Makelaars	This website presents a house for sale in Haastrecht, offering detailed information about the location, features, and history of the property.	Houses → Semi-Detached Houses ⁷⁵¹ Traffic Management → Parking ⁵⁰⁸	conservatory ²³⁷ carport ²⁴⁸ solar panels ⁴⁷⁰¹ house ⁸¹²¹	Oudewater → Hekendorp ²⁸
breedijk-hoveniers.nl	Breedijk Hoveniers	Breedijk Hoveniers is a landscaping and garden center that offers garden design, landscaping, maintenance, and the sale of gardening supplies.	Garden Maintenance → Gardeners ⁶⁸⁵ Outdoor & Garden → Garden Shops ⁷⁹⁵	deck ²⁶⁸ garden maintenance ⁴⁶² garden design ⁹⁶⁴ shop ⁶⁴⁸³ quote ¹²⁸⁶³ garden ¹³¹²⁹	Krimpenerwaard → Stolwijk ²³²
dektro.nl	Dektro Elektrotechniek	The website of Dektro Elektrotechniek presents their services as a reliable electrician in the Krimpenerwaard, focused on providing electrical installation work and solutions.	Security → Security Systems ⁹⁷¹ Energy → Electricity ⁷¹²	solar panel ¹⁴¹ meter box ¹⁷⁶ home automation ³⁷⁶ electrician ⁸¹⁹ installation ¹³⁷⁴²	Heerenveen → Oudeschoot ³⁷
ip-onderhoud.nl	IP Onderhoud	IP Onderhoud is a company specializing in painting, renovation, and related services for both interior and exterior work.	Adhesives & Sealants → Sealing ⁸⁷ Building & Construction → Renovation ⁴⁴⁰³	wood repair ⁶⁶ wallpaper ¹⁷⁵⁶ plaster ²¹⁷⁵ paint ⁸⁷⁴⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
logopedieschoonhoven.nl	Logopediepraktijk Schoonhoven and Bergambacht	The website of Logopediepraktijk Schoonhoven and Bergambacht provides information about speech therapy, the offered treatments, and contact details for clients with problems related to voice, speech, language, hearing, and swallowing.	Childcare → Language Development ⁵⁷⁴ Mental & Emotional Well-Being → Speech Disorders ⁸¹	swallowing ¹²⁹ speech ⁵³² speech therapy ⁵⁴⁰ voice ¹⁰⁹⁰ language ²⁰¹⁶ treatment ²¹²⁰³	Krimpenerwaard → Bergambacht ³⁰³
hondenuitlaatserviceyupi.nl	Hondenuitlaatservice YuPi	Hondenuitlaatservice YuPi is a professional dog walking service based in Gorinchem that provides dog walking and social activities for dogs whose owners are unable or unwilling to do so themselves.	Dog Care → Dog Walking Service ³⁵⁶	leash ⁶⁹ dog walking service ¹⁷⁰ walk ²¹⁶¹ dog ⁵⁴⁸³	South-Holland → Gorinchem ¹⁹⁴⁷
hetkwispelaartje.nl	Het Kwispelaartje	Het Kwispelaartje is a dog school offering courses for dogs and their owners in the IJssel- and Lekstreek region.	Dogs → Dog Training ⁸⁸¹	theory ⁹⁵⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
steefocust.nl	Steefocust Fotografie	The Steefocust Fotografie website showcases the portfolio and services of photographer Stefan van der Meer, specializing in weddings, photoshoots, and events.	Hiking → Europe ⁵¹ Arts → Imaging & Photography ⁷⁶⁸⁷	photoshoot ¹⁰¹⁸ emotion ²¹⁶⁹ wedding ⁴²⁵⁸ photography ⁹⁵⁰³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stichtingtanmar.nl	Stichting TanMar Pedagogische Dienstverlening	Stichting TanMar offers pedagogical services, including a livable environment, respite care, and outpatient support, aimed at young people and adults with various challenges.	Social Services → Youth Work ³⁵³ Youth Development → Youth ¹⁰³³	living group ¹⁵ future ⁴⁰⁴ situation ⁶⁵⁵ youth ³¹²⁶ care ¹²³³⁸	Krimpenerwaard → Bergambacht ³⁰³
voersilos.nl	Handelsmaatschappij Highstreet	The website www.voersilos.nl offers used feed silos for sale and provides repair services.	Industrial Services → Cleaning Services ²¹ Logistics → Storage ¹¹⁷⁰	silo ⁹⁶ part ⁵⁰⁴⁴ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Haastrecht ¹⁹³
kattenprofessionals.nl	Kattenprofessionals.nl	The website kattenprofessionals.nl is an online directory for businesses that specialize in cat care and assistance in the Netherlands and Belgium. The goal is to make it easier for potential cat owners to find the right professional.	Animals → Animal Care ¹⁸⁴⁹	cat food ⁹⁸ package ⁶¹¹²	Molenlanden → Wijngaarden ³⁴
loodgieternieuwerkerk.nl	Loodgieternieuwerkerk.nl	The website is a portal offering plumbing services in Nieuwerkerk aan den IJssel and surrounding areas.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	plumbing work ⁶⁹ blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roofing ²⁸⁰⁶	Zuidplas → Moordrecht ³³²
loodgieterouderkerk-aan-den-ijssel.nl	Loodgieter Ouderkerk aan den IJsel	The website is a portal for finding a reliable and skilled plumber in Ouderkerk aan den IJsel and surrounding areas, with a focus on quick service, free quotes, and high quality standards.	Home Improvement → Plumbing ²⁷³³ Maintenance & Repair → Plumbers ⁸⁷⁹	plumbing work ⁶⁹ blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
goudaloodgieter.nl	Goudaloodgieter.nl	The Goudaloodgieter.nl website provides emergency plumbing services, drain cleaning, and roofing work in Gouda and surrounding areas, emphasizing transparent pricing and reliable professionals.	Technical Services → Maintenance Companies ⁵¹⁷ Home Improvement → Plumbing ²⁷³³	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roofing ²⁸⁰⁶ quote ¹²⁸⁶³	Zuidplas → Moordrecht ³³²
loodgieterreeuwijk.nl	Loodgieter Reeuwijk	The website Loodgieterreeuwijk.nl offers emergency plumbing services, drain cleaning, and leak repair in Reeuwijk and surrounding areas, emphasizing reliability, expertise, and transparent pricing.	Commerce → Installation Networks ³⁹ Maintenance & Repair → Plumbers ⁸⁷⁹	clog ¹⁸⁴ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ appointment ¹³⁵¹⁰	Alphen aan den Rijn → Boskoop ⁶⁵²
blaubemiddeling.nl	BLAU Bemiddeling	BLAU Bemiddeling is a platform that connects public sector professionals with organizations seeking assignments.	Jobs → Vacancies ¹⁰⁹⁹ Government & Administration → Public Sector ³¹⁹	duration ⁴⁶ post ¹⁴⁰ advisor ¹⁰⁵⁵ assignment ¹¹²¹ region ⁵⁴¹²	Krimpenerwaard → Bergambacht ³⁰³
jacobskerstbomen.nl	B. Jacobs Kerstbomen	The website of B. Jacobs Kerstbomen offers a selection of Christmas trees and provides information on types, maintenance, and contact details.	Christmas → Christmas Trees ¹⁶²	lights ¹⁵⁵ christmas tree ³²² tree ¹⁸⁷⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
brightlined.nl	B’rightlined Connect	The website of B’rightlined Connect offers procurement advice, project management, and quality research services to organizations, aiming to improve connections and decision-making through implementation and evaluation.	Engineering → Engineering Firms ⁹⁸⁹ Radio & Communication → Telecommunications ¹³⁶¹	implementation ¹⁰²⁹ project management ³⁴²³ connection ⁴⁰⁰⁷	Vijfheerenlanden → Everdingen ⁶⁴
loodgietercapelleaandenijssel.nl	Loodgieter Capelle aan den IJssel	The website provides plumbing services in Capelle aan den IJssel and surrounding areas, focusing on speed, reliability, and transparent pricing.	Repair → Plumbing Repair ⁴⁷ Installation & Repair → Water Installation ⁸¹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
loodgieterkrimpenaandenijssel.nl	Loodgieterkrimpenaandenijssel.nl	This website provides emergency plumbing services, unclogging services, and leak repair services in Krimpen aan den IJssel.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	clogs ⁹⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgieterlekkerkerk.nl	Loodgieter Lekkerkerk	The website Loodgieterlekkerkerk.nl provides emergency service and free quotes for plumbing work, drain cleaning, leak repairs, and roof maintenance in and around Lekkerkerk, aiming to offer a reliable and skilled solution for all plumbing problems.	Home Improvement → Plumbing ²⁷³³	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
loodgieterhaastrecht.nl	Loodgieter Haastrecht	The website Loodgieterhaastrecht.nl provides emergency plumbing services, including unclogging, leak repairs, and maintenance, in and around Haastrecht. The aim is to quickly and reliably assign a plumber to customers.	Maintenance & Repair → Plumbers ⁸⁷⁹	clog ¹⁸⁴ leak ¹²⁰⁴ plumber ¹²¹⁰ boiler ¹²⁴⁰ roof ³⁶⁶²	Krimpenerwaard → Haastrecht ¹⁹³
loodgieterridderkerk.nl	Loodgieter Ridderkerk	The website Loodgieter Ridderkerk provides emergency service for plumbing, drain cleaning, and roofing maintenance in the municipality of Ridderkerk and surrounding areas. The aim is to facilitate the finding and engagement of experienced and certified plumbers.	Maintenance & Repair → Plumbers ⁸⁷⁹ Personal & Household → Household Services ¹⁰⁵⁰	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgieterbergambacht.nl	Loodgieter Bergambacht	The website Loodgieterbergambacht.nl provides emergency plumbing services, blockage removal and roof maintenance in Bergambacht and surrounding municipalities, emphasizing reliability, transparency, and quick response times.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Krimpenerwaard → Bergambacht ³⁰³
loodgieterhendrik-ido-ambacht.nl	Loodgieter Hendrik-Ido-Ambacht	The website Loodgieter Hendrik-Ido-Ambacht provides emergency service and free quotes for plumbing, drain cleaning, and roofing services in the municipality of Hendrik-Ido-Ambacht and surrounding areas.	Maintenance & Repair → Plumbers ⁸⁷⁹ Installation & Repair → Water Installation ⁸¹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ boiler ¹²⁴⁰ roofing ²⁸⁰⁶ quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgieterammerstol.nl	Loodgieter Ammerstol	The website Loodgieter Ammerstol provides emergency service and free quotes for plumbing, drain cleaning, and roofing maintenance in and around Ammerstol. The goal is to be a reliable and fast plumber for the local population.	Repair → Plumbing Repair ⁴⁷ Installation & Repair → Water Installation ⁸¹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roofing ²⁸⁰⁶ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
haven71.nl	Alphamakelaardij	The website presents a house for sale in Schoonhoven, Haven 71, with detailed information about the property, neighborhood, and associated documents.	House Types → Houses ²⁵⁴⁶ Hygiene & Environmental Factors → Living ⁵⁴⁶	wine cellar ⁸³ living area ³⁴⁹ garage ¹²¹⁰ bathroom ³⁷⁸⁴ house ⁸¹²¹ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
loodgieterlopik.nl	Loodgieter Lopik	The website Loodgieterlopik.nl offers emergency plumbing and blockage assistance in Lopik and surrounding areas, with a free price quote and quick service.	Installation & Repair → Water Installation ⁸¹ Context ¹⁶¹³⁹⁴	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ maintenance ²⁰⁰⁹³	Stichtse Vecht → Tienhoven ⁹⁶
autorijschoolvanwijngaarden.nl	Autorijschool Van Wijngaarden	The website of Autorijschool Van Wijngaarden provides driving lessons and preparation for both practical and theory exams, with special attention for students with autism and ADHD. The school is located in the Gouda region.	Driver & Vehicle → Driver’s License ¹⁶²⁵	ris ⁴¹ theory ⁹⁵⁶ module ⁹⁷¹ license ¹²⁸⁸ exam ²¹²⁰ driving lessons ²⁴⁵³	Alphen aan den Rijn → Boskoop ⁶⁵²
afvalcontainers-randstad.nl	Steehouwer Hoveniers	The website Afvalcontainers-Randstad.nl provides specialized waste removal services for soil, green waste, clean rubble, and other waste streams in the Randstad region, with a focus on environmentally friendly processing and customized solutions.	Logistics → Transportation ¹¹⁰² Environment → Waste Management ²⁶⁸⁰	green waste ²² removal ²⁶⁷ soil ⁹³⁰ waste ¹³¹² container ¹⁷⁰⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
bureaucortland.nl	Bureau Cortland B.V.	Bureau Cortland is an accounting and tax advisory firm focused on providing administrative and fiscal services to medium and small businesses.	Administration → Secretarial Services ⁸⁵¹ Human Resources → Payroll ⁵¹⁵	business plan ³⁸⁷ annual report ⁸⁷⁷ payroll administration ⁹⁷⁹ budget ¹³³⁵ tax advice ¹⁵²² account ⁵⁷⁸¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
daansontbijtservice.nl	Daans Catering	Daans Catering is an breakfast service that delivers fresh breakfasts, lunch buffets and snacks to private individuals and businesses in various regions, including Gouda, Alphen aan den Rijn and Nieuwerkerk aan den IJssel.	Accommodation → Breakfast ³⁶⁴ Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
dagbestedingdekajuit.nl	Dagbesteding De Kajuit	The website of Dagbesteding De Kajuit presents the organization and its offerings of developmental day care and education for young adults with intellectual disabilities, autism, or related issues.	Early Years → Childcare ⁶⁰²⁹	intellectual disability ⁷² methodology ³³² autism ⁷⁵⁸ daycare ¹³⁶⁵ education ¹³⁴⁷¹	Krimpenerwaard → Stolwijk ²³²
gids-stadswandeling.nl	gids-stadswandeling.nl	The website provides information about ‘Storytrail’ city walks, theatrical walks through historical cities, which are available for groups and public registrations.	Corporate Events → Corporate Outings ⁸⁷⁸ Tourism → City Tours ⁴⁶⁸	city walk ¹³⁰ outing ⁹⁸² center ¹¹¹⁵ guide ¹³⁶⁴ registration ⁴³⁶⁶	Bronckhorst → Vorden ⁴¹⁶
hankherfkensfotografie.nl	Hank Herfkens fotografie	The website verbindendebeelden.nl by Hank Herfkens showcases photographic work and portraits, with a focus on architecture and urban landscapes.	Food & Drink → Places ¹¹ Sculpture → Statues ¹³	image ²⁶⁰⁵ portrait ³⁶⁸⁵ photography ⁹⁵⁰³	Rotterdam → Prins Alexander ⁴³²
hogendoornadvies.nl	Hogendoorn Advies	Hogendoorn Advies is a consultancy firm offering construction and sustainability advice for both residential and commercial projects.	Legal → Construction Law ¹⁵⁰ Legal & Permits → Construction Advice ²⁸⁹	construction advice ¹⁸⁸ stable ⁷⁶⁸ housing ⁴³⁷⁸ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Bergambacht ³⁰³
iobogaard.nl	Infra Ontwerp Bogaard	The website of Infra Ontwerp Bogaard offers CAD drawings and project management for various infrastructure projects, with a focus on site design and new construction projects.	Engineering → Engineering Firms ⁹⁸⁹ Planning & Development → Spatial Planning ⁸⁸⁹	drawing ¹¹⁰¹ infrastructure ¹⁴⁶⁰ new construction ²⁶⁷² building ³²⁰⁴ project management ³⁴²³ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
jasperbrinkmansportmassage.nl	Sporttherapie & Massage Jasper Brinkman	The website of Sporttherapie & Massage Jasper Brinkman offers a range of sports massage and myofascial triggerpoint therapy, focused on promoting muscle recovery and preventing injuries for athletes and non-athletes.	Massage → Sports Massage ⁶⁴¹	sport therapy ⁴⁵ sport massage ⁶³⁰ treatment ²¹²⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
lunchplus.nl	Lunch+	Lunch+ is a company that delivers fresh and luxurious lunches to businesses, with a focus on high-quality, fresh ingredients and local producers.	Bakery & Food Production → Bread ⁷⁶⁵ Cafes & Lunch → Lunch ⁵⁹¹	fruit ¹¹⁶⁶ cheese ¹²⁰⁵ lunch ¹⁵³⁴ bread ¹⁶²² ingredients ²³⁴⁶ salad ²⁴⁴⁴	Krimpenerwaard → Stolwijk ²³²
mondhygienistenpraktijkschoonhoven.nl	Mondhygiënistenpraktijk Schoonhoven	Mondhygiënistenpraktijk Schoonhoven is a practice focused on providing dental hygiene and gum treatment for various patient groups.	Dentistry → Dental Hygienist ⁶⁵¹	gum ²¹³ dentist ²⁵¹⁴ technology ⁶⁸¹⁶ practice ⁹⁰⁸⁹ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
pedicuredbycarol.nl	PureOhmPublishing	The website of Pedicured by Carol is a pedicure salon located in Krimpen aan de Lek that specializes in professional foot and nail care, including addressing dermatological issues and applying cosmetic treatments.	Orthopedics → Foot Problems ⁹⁷⁷ Clothing & Accessories → Shoe Stores ⁴⁴¹	orthotic ¹⁰ nails ¹⁷¹⁹ foot ¹⁹²⁹ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
puurvers.nl	Puur Vers	Puur Vers is an online shop that sells fresh meat – chicken, beef, pork, and veal – to customers in various regions of the Netherlands. The company values quality, animal welfare, and transparency.	E-Commerce → Pet Supplies ¹⁰¹³ Supermarkets & Grocery → Online Supermarkets ⁵³	meat ²⁰⁵⁵ region ⁵⁴¹² assortment ⁷⁷⁹⁹	Dijk en Waard → Heerhugowaard ²⁰¹¹
schepbv.nl	Gebr. Schep BV	Gebr. Schep BV is a construction company specializing in ground, road, and water construction projects.	Civil & Infrastructure → Water Construction ¹²⁰ Civil & Infrastructure → Water Works ¹⁶⁸	industrial site ¹⁰ dike ¹⁴⁸ locks ⁹⁵³	Wijk bij Duurstede → Cothen ¹⁶⁵
tandartshaastrecht.nl	Circum Dentem	The Circum Dentem website in Haastrecht provides information about the dental practice, including treatments, opening hours, contact details, and general dental information.	Dentistry → Orthodontics ⁴⁶⁹ Health → Medical Care & Services ²⁹⁴⁶¹	emergency assistance ²⁴ orthodontics ²³⁶ dentist ²⁵¹⁴ opening hours ²⁹⁵³ patient ⁴⁰⁸² treatment ²¹²⁰³	Krimpenerwaard → Haastrecht ¹⁹³
trenddoor.nl	Trenddoor B.V.	Trenddoor is a specialist in access technology, providing delivery, installation, repair, and maintenance services for various doors, gates, and access control systems for businesses and private individuals.	Doors → Garage Doors ²⁴⁸ Security → Access Control ²⁵³	access control ³⁵⁰ garage door ³⁶⁵ door ²²¹⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
vogelhout.nl	Vogelhout	Vogelhout.nl is a garden supply company specializing in the delivery of wood and wood products for the garden and home, with a focus on sustainability and advice.	Wood → Hardwood ²⁵ Garden → Overhangs ²⁹⁴	deck ²⁶⁸ posts ²⁸³ fence ¹⁸¹⁴ wood ⁴¹⁵³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
zeepdispensershop.nl	Zeepdispensershop	The website Zeepdispensershop is an online store that sells a wide assortment of soap dispensers, parts, and mounting materials.	Advertising → Lettering ⁵⁶⁹ Household & Cleaning → Household Goods ¹⁶⁴²	soap dispenser ¹⁰ mounting ⁴⁴⁸ part ⁵⁰⁴⁴	Krimpenerwaard → Bergambacht ³⁰³
zps-stolwijk.nl	Zwem en Poloclub Stolwijk	The website of Zwem en Poloclub Stolwijk provides information about the water polo club, its teams, events, and the opportunity to become a member.	Sports Clubs → Water Polo ²¹⁹ Water Activity → Swimming ¹⁴⁰²	water polo ¹⁸⁴ club ⁴²²⁵ membership ¹⁰⁴⁴² training ²⁸¹³³	Krimpenerwaard → Stolwijk ²³²
3dave.nl	3Dave	The website 3Dave offers professional 3D printing services for both individuals and businesses, with a focus on decorative 3D-printed objects and a blog about 3D printing.	Manufacturing → 3D Printing ⁵⁶⁵ Decor & Furnishings → Decorative Objects ¹⁸⁹	decorative objects ¹¹ 3d printing ³³² design ²⁷²⁰²	Krimpenerwaard → Gouderak ¹⁰³
4-het.nl	4HET	The website www.4-het.nl offers the rental of large inflatable Sarah and Abraham dolls, primarily for festive occasions such as birthdays, anniversaries, and weddings.	Party Supplies → Inflatable Items ¹⁸	sarah ²⁹ abraham ³¹ doll ¹⁹⁰ anniversary ⁶⁷⁰ party ⁵⁹²⁸ rental ⁷²⁵⁷	Krimpenerwaard → Stolwijk ²³²
a-transport.nl	A-Transport	The A-Transport website offers courier services and transportation solutions for the transport of goods, with a focus on speed, flexibility, and safety.	Freight & Logistics → ADR Transportation ²⁰¹ Freight & Logistics → Courier Services ⁸³⁹	courier ⁴⁷³ shipment ⁷⁰⁵ fleet ¹³⁵¹ transportation ²⁸⁵¹ transport ⁶¹⁰⁵	Rotterdam → Center ³⁸²
a3s.nl	A3S	A3S.nl is a personal website of Adrie Spruit, showcasing his interests and activities, ranging from environmental and political concerns to cycling, sailing, and creating Joomla websites.	Local Communities → Villages ¹⁰⁰⁵ Internet → Forums & Communities ¹⁵⁹⁹	air traffic ¹⁵ cycling tour ⁶⁵ joomla ¹⁷¹ sail ⁹⁶⁵ politics ¹²⁵⁹ environment ⁴⁸⁷³	Gouda → Goverwelle ¹⁵
aannemingsbedrijfgraveland.nl	Aannemingsbedrijf Graveland vof	The website of Aannemingsbedrijf Graveland showcases their services in the areas of extensions, renovations, skylight installations, and storage.	Wood & Timber → Timber ³³⁵	skylight ⁹⁶⁶ extension ¹⁹⁴¹ storage ²⁴⁴⁶ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	Lansingerland → Bleiswijk ⁵⁷⁹
ankerboerenkaas.nl	Kaashandel Anker	The website of Kaashandel Anker offers a selection of various types of farm cheese, including Stolwijkse cheese, Leidse cheese and Gouda cheese, which is directly purchased from local farmers and distributed. The website also provides information about the storage and aging processes of the cheese.	Dairy → Cheese ⁵³⁰ Dairy & Cheese → Delicatessens ⁶¹⁷	farm cheese ¹⁵ ripen ²⁶ warehouse ¹⁰²⁷ cheese ¹²⁰⁵	Krimpenerwaard → Stolwijk ²³²
annemariescholten.nl	Annemarie Scholten	The website of Annemarie Scholten offers energetic therapy and mental coaching services.	Essential ²⁴¹⁰¹⁶	relaxation ³⁹⁶⁸ balance ⁴⁵⁸² therapy ⁷⁴⁴⁸ coach ²⁵⁸¹⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
arjanevertz.nl	Arjan Evertz	The website of Arjan Evertz showcases the performances and work of Arjan Evertz, a comedian and cabaret artist who presents humorous shows and comedy events.	Theater → Cabaret ³⁵⁸	comedy ⁸⁹ cabaret ²²² jury ³²² show ¹³⁹¹ event ⁴⁵¹⁹⁹	Sittard-Geleen → Sittard ¹⁹⁹⁷
asbbouw.nl	ASB Bouw	The ASB Bouw website presents the company as a specialist in new construction and renovation projects, with a focus on bathroom renovations, tiling, plastering, masonry, and facade renovation.	Masonry & Plastering → Masonry ⁵⁷⁶ Renovation → Bathroom Renovation ⁸³⁴	bathroom renovation ⁴² facade renovation ¹³⁰ masonry ⁴⁶⁰ plaster ²¹⁷⁵ tile ²⁸⁶⁹ renovation ¹³⁸⁴⁹	Krimpenerwaard → Berkenwoude ⁶²
ashlynshairstylz.nl	Ashlyn’s HairstylZ	Ashlyn’s HairstylZ is a hair salon located in Schoonhoven that offers a variety of hairstyles and treatments.	Services → Hairdressers ¹⁰²¹	hairstyle ⁸¹² trend ¹⁸⁶⁵ hair ³⁰¹⁴ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bakkeromdehoek.nl	Bakker om de Hoek	The website Bakker om de Hoek provides addresses of bakeries, particularly in holiday destinations, including campsites.	Bakery & Food Production → Bread ⁷⁶⁵ Dairy & Cheese → Dairy ⁷⁶³	baker ⁹⁰ bread ¹⁶²² campsite ²⁰⁹³ vacation ⁴²³⁴	Schagen → Tuitjenhorn ³⁸²
basvanzetten.nl	Bas van Zetten	This website is a blog and portfolio of Bas van Zetten, showcasing his past and present creative projects. It also contains local news articles and reports about various events and initiatives in the region.	Marketplaces → Advertisements ³⁸ News & Journalism → Regional News ⁹⁴⁸	creative work ¹³ region ⁵⁴¹² portfolio ⁶⁸⁵⁴ blog ¹³³⁹² news ¹⁵²⁹³	Bodegraven-Reeuwijk → Bodegraven ⁷⁴⁹
bbdewaterjuffer.nl	De Waterjuffer	The B&B De Waterjuffer website presents a Bed & Breakfast that opened in July 2019 and is located in the countryside between the villages of Elim, Nieuwlande, and Hollandscheveld. It offers guests a unique atmosphere due to the double bathroom and kitchen, and proximity to nature and recreation.	Hiking → Trails ³⁵⁶ Accommodation → Guesthouses ⁷²⁶	village ⁸⁰⁸ b&b ¹⁰⁶⁰ forest ¹⁴¹⁸ house ⁸¹²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
beautycarepetra.nl	BeautyCare Petra	The website of BeautyCare Petra in Gouda presents the salon, its services, products and the brands used for skin improvement and cosmetic treatments.	Eyelash Services → Eyebrows ⁷⁷⁷	puurr ¹¹ skincare products ¹⁰⁰ wax ⁷¹¹ facial treatment ¹¹⁵² treatment ²¹²⁰³	Zuidplas → Moordrecht ³³²
bedrijfsuitjegorinchem.nl	Bedrijfsuitjegorinchem.nl	The website Bedrijfsuitje Gorinchem offers a wide range of team outings and activities in and around Gorinchem.	Corporate Events → Team Building ¹⁰⁰⁵ Corporate Events → Corporate Outings ⁸⁷⁸	team outing ²²¹ outing ⁹⁸² game ²⁸⁰⁷ arrangement ³¹⁰⁴	The Hague → Scheveningen ¹⁶²⁵
bedrijfsuitjeschoonhoven.nl	Bedrijfsuitjes Schoonhoven	This website offers a wide range of corporate outings and team-building activities in and around Schoonhoven, with over 15 years of experience.	Corporate Events → Team Building ¹⁰⁰⁵ Corporate Events → Corporate Outings ⁸⁷⁸	murder mystery ³⁹ city game ⁸¹ team outing ²²¹ corporate outing ³⁸⁸ hospitality ³⁴⁹¹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
beijerschebuitenplaats.nl	Beijersche Buitenplaats	The Beijersche Buitenplaats website promotes a self-sufficient living and lifestyle concept in harmony with nature, focusing on conscious living, gardening, and appreciating products from their own garden and orchard.	Farm Experiences & Tourism → Orchards ¹⁶ AccommodationTypes → Accommodation ¹²¹³⁰	orchard ²⁴⁰ recreation ⁷⁹⁹ animal ²⁹⁰⁸ food ³⁸⁷² nature ⁹⁰⁹⁴ garden ¹³¹²⁹	Utrecht → Oudewater ⁴⁷⁵
benschopautomotive.nl	Benschop Automotive	The website of Benschop Automotive presents a selection of used and new cars, provides information about services such as financing and trade-in, and offers contact details for potential customers.	Car Dealerships → New Cars ³⁶³	used cars ⁸⁹⁴ model ³⁵⁴⁶ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
besttaxi.nl	E.E Best Taxi Service	The website of E.E Best Taxi Service provides taxi and transportation services, including taxi to Schiphol, business transportation, airport service, and transport to other airports.	Logistics & Transportation → Travel Arrangements ¹³³	airport ⁷⁸⁹ taxi ²⁰⁹⁰ transportation ²⁸⁵¹ reservation ³³⁷³ price ⁸³²⁸ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
bijkerkadministraties.nl	Bijkerk Administraties	Bijkerk Administraties is an accounting firm specializing in self-employed individuals without employees (ZZP) and partnerships under a firm (VOF), helping them with administrative tasks and tax returns.	Finance → Taxation ¹⁵⁶⁷ Government & Legal → Tax ¹³²²	zzp ¹²¹ tax return ⁷⁸⁷ bookkeeping ¹³¹⁹ partnership ¹⁴⁰⁷ tax ²¹⁰⁰ account ⁵⁷⁸¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bloemistservice.nl	Bloemenbezorging.nl	The website offers a service to deliver flowers, bouquets, and flower arrangements in the Netherlands.	Delivery → Flower Delivery ²¹⁰ Gifts & Occasions → Flower Shops ⁷⁷⁶	florist ⁵⁷ roses ²¹⁴ bouquet ¹¹⁴⁷ flowers ³²⁴⁸ shop ⁶⁴⁸³	Vijfheerenlanden → Ameide ⁹⁷
bnbouwbestek.nl	BNbouwbestek	BNbouwbestek is a construction company specializing in writing STABU specifications for residential and commercial building projects.	Technology & Innovation → Construction Technology ⁷⁹⁰ Technology & Innovation → Construction Processes ²⁵	specification ²²⁵ architect ⁶⁰⁹ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	Zutphen → Warnsveld ²⁵⁵
bnbthebarnhouse.nl	Banning Family	The Barnhouse website presents a charming cottage located in Bergambacht, a renovated cow stable converted into a comfortable accommodation for two people.	Hotels → Country Houses ¹⁷² Accommodation → Cottages ²⁹⁸	meadow ⁷⁵ cottage ²⁹⁹ farmhouse ⁸⁷⁸ internet ¹⁶⁷⁸ bedroom ²⁰⁵¹ terrace ⁴⁸⁴⁷	Krimpenerwaard → Bergambacht ³⁰³
bodrum-schoonhoven.nl	Pizzeria Bodrum	The website Pizzeria Bodrum offers online ordering for a wide range of dishes, including Turkish pizzas, sandwiches, and various doner and kapsalon variations, with delivery options available.	Lunch → Sandwiches ⁴⁶⁶ Fast Food → Döner ²³⁸	doner ¹³¹ kapsalon ⁵⁰⁹ pasta ¹³⁸⁹ fries ²⁷⁵³ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
boekenwinkel-gids.nl	Bookshop Guide	The website Bookshop Guide provides an overview of bookstores in various provinces of the Netherlands.	Directories → Websites ³⁴⁷³ Context ¹⁶¹³⁹⁴	town ¹²⁶ bookstore ¹⁴⁹ directory ¹⁷⁶ province ⁵¹⁸	Zwartewaterland → Genemuiden ⁴⁰⁵
boetiekvintique.nl	Boetiek Vintique	Boetiek Vintique is a vintage shop that sells secondhand women's clothing, shoes, and accessories with a focus on sustainability and style.	Context ¹⁶¹³⁹⁴	coffee ³⁸³⁸ atmosphere ⁵⁵⁹¹ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Bergambacht ³⁰³
bos-tuinen.nl	J.J. Bos Tuinen	J.J. Bos Tuinen is a company specializing in the design and realization of gardens based on the client’s wishes and budget.	Landscaping → Garden Installation ⁶¹⁷	realization ²³² fence ¹⁸¹⁴ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Berkenwoude ⁶²
bosbewindvoering.nl	Bos Bewindvoering	Bos Bewindvoering provides protective guardianship services to individuals who are temporarily unable to manage their finances.	Debt Relief → Debt Counseling ²⁸⁸ Legal → Guardianship ⁸⁷⁹	guardian ¹⁷⁸ dossier ²⁴⁸ debt ⁷¹⁷ financial ⁸⁵⁵ payment ¹³⁸⁹	South-Holland → Zuidplas ¹¹²²
bouwburovink.nl	Bouwburo Vink	Bouwburo Vink is an independent construction advice agency based in Gouda that supports various building projects, from new construction to renovation.	Project Management → Construction Supervision ³⁶⁴	construction supervision ¹⁸⁷ construction advice ¹⁸⁸ quote ¹²⁸⁶³ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
boxingfitpoint.nl	Boxing Fit Point	The Boxing Fit Point website in Schoonhoven presents a fitness program based on boxing, aimed at improving condition, strength, and technique for beginners and experienced individuals.	Fitness → Functional Training ²⁰⁴ Combat → Boxing ⁴²²	condition ⁴²⁵ strength ⁷⁸⁹ trial lesson ¹⁴³³ instructor ³¹²⁶ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
brandweerschoonhoven.nl	Brandweer Schoonhoven	The website of Brandweer Schoonhoven provides information about the activities of the fire department in the city of Schoonhoven, including incidents, training exercises, and news.	Crime & Safety → Crime ³⁵⁶ Emergency Services → Fire Department ¹³⁸	incident ³³⁵ fire ⁴²⁹ person ⁴⁴⁸ diving ⁴⁵⁹ house ⁸¹²¹ car ¹⁰⁸⁶⁵	Amsterdam → West ⁷⁷⁷
bruijnbouw.nl	De Bruijn Bouw b.v.	De Bruijn Bouw b.v. is a construction company specializing in concrete work, with a tradition dating back to 1996, offering a range of concrete construction services.	Building & Materials → Concrete Structures ²⁶⁸	basement ¹³⁴ concrete floor ¹⁸⁴ residential construction ²⁵⁰ foundation ⁶⁶⁷⁸	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
buijswerktuigenverhuur.nl	Buijs – Werktuigenverhuur	The website of Buijs – Werktuigenverhuur offers the rental of ground-handling machines, earthwork and demolition machines, with experienced machinists.	Agriculture → Agricultural Services & Contracting ⁷⁰⁸ Land Development & Earthworks → Earthmoving ⁶⁴³	machinist ²⁷ earthwork ⁴³⁵ equipment ⁴¹⁴³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
businessclubvvs.nl	Business Club VV Schoonhoven	The Business Club VV Schoonhoven is an ambitious business club in the Krimpenerwaard, providing a platform for professionals to network, gain knowledge, and share experiences.	Social Organization → Networking Organizations ⁴⁷⁵ Networking → Business Clubs ¹⁶²	networking ⁸⁴² knowledge ³⁵²⁸ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
buurtvereniginghitland.nl	Ver-Hitland Neighborhood and Interests Association	The website of Ver-Hitland Neighborhood and Interests Association provides information about the activities, news, and photos of the Ver-Hitland neighborhood, and promotes the solidarity of the residents.	Neighborhood Organizations → Residents’ Associations ⁹⁶⁵ Nature → Waterways ¹⁶¹	neighborhood ²⁴²⁴ municipality ⁶⁸³⁷ photo ⁷⁷⁷⁸ association ⁸⁵⁶²	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
centrum-voor-fysiotherapie-en-haptonomie.nl	Centrum for Physiotherapy and Haptonomy	The Centrum for Physiotherapy and Haptonomy in Gouda and Haastrecht offers physiotherapy based on a haptonomic approach, focusing on raising awareness of the patient's body sensation and coping with physical complaints.	Professional Development → Supervision ⁷⁸⁸	haptonomy ¹²¹ physiotherapy ⁴⁶⁸⁸ complaint ⁶⁴⁷⁹	Krimpenerwaard → Haastrecht ¹⁹³
claritymanagement.nl	Clarity Management	Clarity Management is a project management and IT consultancy that helps businesses successfully complete their projects.	Digital Media & Design → Digital Transformation ⁹⁵⁴	objective ⁴¹⁵ planning ¹⁹⁶⁹ risk ²⁸⁹⁶ project management ³⁴²³	Krimpenerwaard → Gouderak ¹⁰³
cliffords.nl	Clifford Teunnissen	The website of Cliffords presents the services of Clifford Teunnissen in Haastrecht, specifically focused on antique restoration, furniture making, and laying wooden floors.	Repair → Furniture Repair ²⁵⁹ Interior → Furniture ⁷⁴⁵⁴	training company ⁹⁶ antique ⁴³² restoration ³⁴¹⁷ wood ⁴¹⁵³ floor ⁴⁷⁸¹ furniture ⁸⁷⁵¹	Krimpenerwaard → Haastrecht ¹⁹³
crematoriumgids.nl	crematoriumgids.nl	The website offers an overview of crematoria in the Netherlands.	Social Issues & Welfare → Rights ³⁸⁴	crematorium ⁵⁹ funeral center ⁶⁷ province ⁵¹⁸	Southwest-Friesland → Wommels ¹¹³
customstockparts.nl	Custom Stock Parts B.V.	Custom Stock Parts B.V. is a company that manufactures and maintains inventory of machine components for its customers.	Warehouse Operations → Warehouse Management ¹⁷⁴ Logistics → Inventory Management ¹⁰⁰	inventory ¹⁶¹³ production ⁴⁵⁸² part ⁵⁰⁴⁴	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
dankavond.nl	MAF	The website provides information about the Thank Evening of June 2, 2023, in Dordrecht, a musical and spiritual gathering with singing, music, and a collection to support a family being sent to Suriname.	Church & Religious → Organ Music ²¹² Music & Performance → Music Events ⁷⁵⁸	organ ⁶³³ anniversary ⁶⁷⁰ musician ¹²⁰⁷ choir ³¹²³ collection ⁷⁵⁶⁶	Krimpenerwaard → Berkenwoude ⁶²
dbktrading.nl	DBK Trading	DBK Trading is a company specializing in the sale and trade of classic and exclusive cars, motorcycles, and boats.	Cars → Classic Cars ¹¹⁴⁵ Transportation → Water Transport ⁶⁶	classic ¹⁶⁸ sloop ²⁷² motorcycle ²¹¹⁰ boat ²⁹⁸⁰ vehicle ³⁷⁴³ car ¹⁰⁸⁶⁵	Krimpenerwaard → Haastrecht ¹⁹³
de-smaak-van-schoonhoven.nl	De Smaak van Schoonhoven	The website ‘De Smaak van Schoonhoven’ is an online platform allowing customers to order meals from the restaurant in Schoonhoven.	Turkish Cuisine → Turkish Restaurant ⁴⁵⁸ Turkish Cuisine → Fast Food ³²²²	kapsalon ⁵⁰⁹ fries ²⁷⁵³ snack ²⁹¹⁶ sandwich ⁴⁰⁹⁸ pizza ⁴¹⁵⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
debonuspapa.nl	Tom	The BonusPapa blog is a personal website where an inexperienced bonus father shares his experiences and stories about fatherhood and family outings.	Parenting → Fatherhood ³² Outings → Regional Outings ³⁰	fatherhood ⁴⁸ kids ⁸⁴ outing ⁹⁸² toy ²²⁹⁵ newsletter ⁶⁵⁰⁴	Krimpenerwaard → Stolwijk ²³²
decibelles.nl	Popkoor De Decibelles	The website of Popkoor De Decibelles describes the history of the choir, its current status (the choir has ceased to exist), and provides information for potential choir members and tips for finding other choirs in the area.	Choir → Pop Choir ¹⁹⁶	singing ¹⁰⁵⁶ rehearsal ¹⁶³⁹ choir ³¹²³	Krimpenerwaard → Lekkerkerk ²⁴⁴
degraaffuitvaartverzorging.nl	De Graaff Uitvaartverzorging	De Graaff Uitvaartverzorging provides dignified and personal funeral care in the Krimpenerwaard and Rotterdam regions.	Services → Personal Services ¹⁰⁶² Family → Funeral Services ²⁰⁸⁴	funeral care ¹³⁵ farewell ¹¹⁰⁹ funeral ²⁴⁷⁷ wishes ²⁷¹⁷ insurance ⁶³⁵⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
dejuwelenfabriek.nl	Edelsmeden Frans Penning	The website of Edelsmeden Frans Penning presents jewelry-making courses and workshops, and provides information about the background of the jeweler Frans Penning and the history of his workshop.	Jewelry → Handmade Jewelry ⁸⁶² Jewelry → Goldsmiths ³¹⁹	jeweler ⁷⁰ course ¹⁴⁷²⁸ workshop ¹⁹³²⁵	Leidschendam-Voorburg → Leidschendam ¹⁰⁴⁹
demaenen.nl	De Maenen	The website of Café De Maenen presents the event agenda, menu options, information about the café and the facilities offered, including catering for parties and meetings.	Cafes → Brown Cafés ⁵⁹⁹ Cafes → Grand Cafés ²²⁸	grand café ⁹⁵ café ⁹⁴⁴ room ³⁴¹¹ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶ event ⁴⁵¹⁹⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
demikadvies.nl	De Mik Adviesbureau	De Mik Adviesbureau is a technical consulting agency offering advice, engineering, and execution services for various projects.	Consulting → Technical Consulting ³⁸² Architecture → Architectural Services ¹⁰⁰⁶	execution ⁴²⁶ designer ⁵⁷¹ engineering ¹⁴⁶⁸ installation ¹³⁷⁴²	Krimpenerwaard → Stolwijk ²³²
denzelle.nl	Cosmétique Denz'Elle	The website of Cosmétique Denz'Elle presents a salon specializing in cosmetic care for both men and women, offering a wide range of treatments including nails, pedicures, facials, eyebrows, and eyelashes.	Salon & Treatment Centers → Beauty Centers ⁶³¹ Cosmetics & Aesthetic → Personal Care ¹⁰⁰¹	facials ³⁰² eyelash ³⁵⁴ eyebrows ¹¹²⁷ nails ¹⁷¹⁹ pedicure ²¹⁹⁶ salon ⁵⁵⁴¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
deondernemersfabriek.nl	De Ondernemersfabriek	The Ondernemersfabriek in Schoonhoven offers space for entrepreneurs, providing diverse facilities and flexible workspaces.	Office Space → Flexible Workspaces ²⁵⁰ Venues & Rentals → Spaces ³¹	facility ²⁶¹⁶ space ³⁸⁴⁶ community ⁷⁹³¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
deridderautoschade.nl	De Ridder Autoschade	De Ridder Autoschade is an auto body repair shop focused on quickly and expertly repairing cars, including classic cars and trucks.	Auto Parts & Tires → Wheels ⁵⁴⁵ Business Services → Customer Service ¹⁴⁵¹	rental car ¹⁷⁸ tire service ¹⁸⁰ classic car ⁴⁰⁴ damage ¹⁵⁶²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
dermalika.nl	Dermalika	Dermalika is a practice offering medical-cosmetic dermatology in the Krimpenerwaard.	Dermatology → Skin Therapy ⁶⁶¹	dermatology ¹²⁷ skin ²⁵¹⁸ plan ²⁵⁶⁶ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
dhadvocatuur.nl	De Haas Advocatuur & Mediation	De Haas Advocatuur & Mediation is a law firm specializing in personal and family law.	Family → Alimony ⁷⁰ Law → Family Law ¹⁴¹³	situation ⁶⁵⁵ court ⁹⁹⁹ lawyer ²⁶⁸³ mediation ²⁷⁸⁷ family ⁶⁴⁶²	Krimpenerwaard → Bergambacht ³⁰³
dkhf.nl	Dutch-Kenyan Health Foundation	The Dutch-Kenyan Health Foundation (DKHF) is an organization dedicated to improving public health in semi-nomadic areas of Kenya, primarily through combating infectious diseases and addressing health issues related to environmental factors, local customs, and lifestyles.	Africa → Kenya ³⁸ Vacations → International ²¹³	kenya ⁶² patient ⁴⁰⁸² donation ⁵¹¹⁰	Krimpenerwaard → Stolwijk ²³²
doeldijk22a.nl	Jacobi Makelaars	This website belongs to Jacobi Makelaars and presents real estate objects for sale and rent.	Real Estate → Property Search & Listings ⁵⁰⁶	object ²⁷⁰ agency ⁹⁴⁴ plot ¹⁰⁵¹ property ⁷⁴⁰⁶	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
dokterelectro.nl	Dokter Electro	Dokter Electro is an electrician offering emergency electrical work, installations, repairs, and maintenance.	Lighting & Electrical → Utilities ³⁸⁸	panel ⁸⁶⁸ electrical ¹⁴¹⁴ home ⁷⁹⁷⁶ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
doskovolleybal.nl	Dosko Volleybal Stolwijk	Dosko Volleybal Stolwijk is a volleyball association that offers volleyball activities for various age groups and levels, from youth to seniors and recreational players.	Team Sports → Volleyball ⁸⁴² Combat → Badminton ⁷⁰²	recreational ³² volleyball ⁶¹⁷ youth ³¹²⁶ match ³⁴⁷¹ association ⁸⁵⁶²	Krimpenerwaard → Stolwijk ²³²
draw4u.nl	Draw4U	Draw4U is a construction drafting and consulting bureau that manages projects from design to completion.	Architecture → Architectural Services ¹⁰⁰⁶ Architecture & Design → Building Consulting ³¹⁴	drawings ¹³²⁹ consulting ³⁶³⁹ renovation ¹³⁸⁴⁹ design ²⁷²⁰²	West-Betuwe → Stationswijk ⁶⁴⁹
drone-guy.nl	Drone Guy	The Drone Guy website offers professional drone photographs from various locations, including Zakynthos, Scheveningen, and the Oosterscheldekering, for purchase.	Vacations → Beach Vacations ⁸⁶⁶ Photography → Drone Photography ²³⁷		Krimpenerwaard → Krimpen aan de Lek ¹⁹³
dunantstraat77.nl	Van Rhijn Makelaars	The website of Van Rhijn Makelaars presents a house for sale in Haastrecht, providing detailed information about the property's location, dimensions, features, and history.	Houses → Corner House ²⁸¹ Houses → VVE ⁶⁵	plot ¹⁰⁵¹ agent ¹²⁵³ bedroom ²⁰⁵¹ property ⁷⁴⁰⁶ house ⁸¹²¹	Krimpenerwaard → Haastrecht ¹⁹³
dutchteamsecurity.nl	Dutch Team Security	The website of Dutch Team Security offers security services including surveillance, object security, and event security.	Security & Surveillance → Security ³²⁵¹ Industry → Industrial ¹⁹⁸⁷	surveillance ¹⁹² risk ²⁸⁹⁶ security ⁶⁶⁵⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
eenhandjenodig.nl	DigiWaard	Handje Nodig provides computer assistance, maintenance, and security services to individuals and businesses in the Krimpenerwaard and Gouda region.	Computer Hardware & Peripherals → Computer Stores ²⁸¹	internet ¹⁶⁷⁸ computer ¹⁹⁶⁹ data ⁵⁸⁷² security ⁶⁶⁵⁵ software ⁸²⁹¹	Krimpenerwaard → Bergambacht ³⁰³
elshoflijmwerken.nl	Elshof Lijmwerken BV	Elshof Lijmwerken BV is a company specializing in the gluing of Kalkzandsteen blocks, Elements, and Ytong (gas concrete).	Masonry & Plastering → Masonry ⁵⁷⁶	element ²³⁴ network ¹¹¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
elszuidbroek.nl	Kindercoach Els Zuidbroek	The website of Kindercoach Els Zuidbroek provides information about child coaching, focused on fostering children’s talents and personal development paths, and offering support in facing challenges.	Child & Adolescent Development → Child Psychology ¹⁰⁷⁷ Childcare → Child Coaching ³⁴³	challenge ¹⁶⁹⁷ plan ²⁵⁶⁶ talent ³⁹⁸⁷ gift ⁶⁴⁴² child ¹¹⁵⁶⁶ coach ²⁵⁸¹⁰	Krimpenerwaard → Stolwijk ²³²
fcsbetonstaal.nl	FCS Betonstaal	FCS Betonstaal is a company specializing in the supply and renovation of ironwork and wickerwork, serving residential, commercial, and utility construction projects.	Building & Materials → Steel & Metal ⁷⁷⁹	ironwork ¹⁸ steel ¹¹⁷⁷ construction ⁷⁴²¹	Krimpenerwaard → Stolwijk ²³²
feetcare4u.nl	FeetCare4u	The website of Pedicurepraktijk FeetCare4u offers medical pedicure, reflexology massages and other foot care services in Haastrecht and Bunnik, specializing in diabetic and rheumatic foot care.	Podologists → Foot Care ¹²⁰² Orthopedics → Foot Problems ⁹⁷⁷	rheumatic ²⁵ reflexology ³⁸⁰ diabetes ⁷⁵⁰ footcare ⁷⁶⁷ pedicure ²¹⁹⁶	Krimpenerwaard → Haastrecht ¹⁹³
fiscalistkaart.nl	Fiscalistkaart BV	The website Fiscalistkaart provides an overview of Dutch fiscalists and facilitates finding a suitable fiscalist.	Websites → Professional Websites ¹⁷ Software → Online Services & Platforms ⁷³⁵	fiscalist ¹⁰ compare ⁵⁸² search ¹⁰²⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
floreathoveniers.nl	Floreat Hoveniers	Floreat Hoveniers is a landscaping company in Schoonhoven that offers garden design, landscaping, maintenance, and renovation services.	Outdoor & Garden → Landscape Companies ³³⁹	plan ²⁵⁶⁶ showroom ⁴⁸⁸³ communication ¹⁰¹⁶² quote ¹²⁸⁶³ garden ¹³¹²⁹	Krimpenerwaard → Bergambacht ³⁰³
foretdor.nl	Foret d'Or	The website of Foret d'Or showcases the work of Ina Bos, a goldsmith and silversmith who designs, repairs, and crafts jewelry.	Crafts → Goldsmithing ¹⁶⁸	engraving ⁴¹⁴ silver ⁴⁷⁹ gold ⁸⁰⁵ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
fotoniestadt.nl	Fotostudio Niestadt	Niestadt Photography is a photography studio that offers a variety of photography services, including portraits, corporate photography, wedding reports, and product photography.	Arts → Imaging & Photography ⁷⁶⁸⁷	corporate ¹²⁰ portrait ³⁶⁸⁵ studio ⁵⁴⁶⁵ portfolio ⁶⁸⁵⁴ photography ⁹⁵⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
fraciolato.nl	IJssalon Fraciolato	IJssalon Fraciolato is an ice cream parlor in Haastrecht that serves artisanal ice cream, ice cream sundaes, and coffee.	Ice Cream → Ice Cream Parlors ⁵²¹ Bars & Pubs → Bars ¹⁹³⁸	strawberries ¹⁷² ice cream ¹⁰⁰⁰ coffee ³⁸³⁸	Krimpenerwaard → Haastrecht ¹⁹³
gayned.nl	GayNed	GayNed is a national network for gay professionals focused on personal development, friendly connections, and fostering social and professional ambitions.	Social Organization → LGBTQ Organizations ⁶⁵ Radio & Communication → Networks ³⁴¹	ambition ⁵⁷⁶ connection ⁴⁰⁰⁷ member ¹⁰¹⁵⁴ network ¹¹¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gelderblombouw.nl	Gelderblom Bouw	Gelderblom Bouw is a specialist in concrete construction, focusing on foundations and concrete floors, serving clients throughout the Netherlands.	Building & Materials → Concrete Structures ²⁶⁸ Technology & Innovation → Construction Technology ⁷⁹⁰	pile ³⁹ concrete floor ¹⁸⁴ groundwork ¹³⁴⁸ certification ³³⁸⁰ foundation ⁶⁶⁷⁸	Krimpenerwaard → Stolwijk ²³²
gevobouw.nl	Gevobouw	Gevobouw is a construction company focused on personal involvement, quality, and customer satisfaction, with extensive experience in the construction industry.	Entrepreneurs → Small Businesses ¹²	construction ⁷⁴²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gezinshuiskomaanboord.nl	Gezinshuis Kom aan boord	The website of Gezinshuis Kom aan boord presents their family home care services for children with specific needs.	Specialized Medical Services → Specialized Care ³⁸⁴ Social Issues & Welfare → Youth Services ³¹³	need ⁴⁶⁹ child ¹¹⁵⁶⁶	Krimpenerwaard → Stolwijk ²³²
gezinshuissamenapart.nl	Gezinshuis Samen Apart	Gezinshuis Samen Apart is a website providing information about a family home in Stolwijk and the services it offers to young people who cannot live with their biological parents.	Services → Personal Services ¹⁰⁶² Social Issues & Welfare → Youth Services ³¹³	family home ¹⁵⁸ mission ¹⁰⁰⁰ resilience ¹⁰⁹¹ youth ³¹²⁶ environment ⁴⁸⁷³	Krimpenerwaard → Stolwijk ²³²
gjvn.nl	Graaf Jan van Nassauschool	The website of the Graaf Jan van Nassauschool in Gouda presents the school, its vision, team, programs, and important information for parents and students.	Elementary Schools → Christian Primary Schools ³⁴² Education & Youth → Local Institutions ¹⁰⁶	bible ¹²⁷⁶ student ⁷⁶²³ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Krimpenerwaard → Bergambacht ³⁰³
goprint.nl	GoPrint	GoPrint is a printing company that offers a wide range of printing products for business, private, student, and school purposes.	Printing & Production → Printing ⁶⁹⁰	manual ⁹⁶ sticker ²²¹ flyer ²⁷⁴ promotion ²⁰⁶² magazine ²¹⁸² print ⁵⁵¹¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gouda-glaszetter.nl	Glaspunt B.V.	Glaspunt B.V. is a glass fitter company based in Gouda that provides 24-hour glass repair and glass installation services.	Insulation → Glazing ¹⁸⁸ Exterior Works → Glass Fitting ¹¹²	glass fitter ³² glass damage ¹³⁵ window ²⁰³⁰ glass ²⁹¹⁹ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
goudmakelaardij.nl	GOUD Makelaardij	GOUD Makelaardij is a real estate agency offering homes for sale and rent in Midden-Brabant.	Property Agents & Brokers → Regional Agents ³⁵²	plot ¹⁰⁵¹ agent ¹²⁵³ result ¹⁹⁰² bedroom ²⁰⁵¹ property ⁷⁴⁰⁶	Altena → Hank ¹¹³
grillroompizzeriaamon-bergambacht.nl	Eetcafé Amon Bergambacht	Eetcafé Amon Bergambacht is an online restaurant where customers can view the menu and place online orders.	Fast Food → Fries ⁹⁴⁹ Quick Bites → Snack Bar ⁵⁸⁰	salad ²⁴⁴⁴ fries ²⁷⁵³ drink ⁵¹⁹¹ dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
groothandel-nederland.nl	groothandel-nederland.nl	This website provides information about wholesalers, including their function and activities.	Commerce → Wholesale ¹⁸⁵⁵	enterprise ¹⁰¹ wholesaler ²²⁵ flow ²⁶³ goods ⁶⁶⁶ supplier ¹⁷²⁵	Achtkarspelen → Harkema ¹¹³
haagsmatrading.nl	Haagsma Trading Company	Haagsma Trading Company is a company specializing in the supply of heavy-duty wheels and wheels for various industrial applications.	Tools & Equipment → Industrial Tools ²⁴⁴ Bicycles & Wheels → Wheels ¹⁹	wheel ⁷⁴⁶	Krimpenerwaard → Bergambacht ³⁰³
heijkoopsloopwerken.nl	Heijkoop Sloopwerken B.V.	Heijkoop Sloopwerken B.V. is a demolition company located in Ammerstol, near Rotterdam and Gouda, offering demolition services, bore and sawing operations.	Building & Materials → Demolition ⁶⁸⁷	demolition ¹¹⁴⁴	Krimpenerwaard → Ammerstol ⁴⁹
herbalistenregister.nl	SBTCG	The website aims to establish an herbalist registry and create a quality mark for herbalists of all disciplines, with the goal of fostering recognition and developing appropriate herbal legislation.	Dentistry → Specialties ³⁷⁸ Government & Administration → Legislation ⁴³²	professional association ³¹ discipline ¹²¹ criteria ¹³⁶ education ¹³⁴⁷¹	Overbetuwe → Valburg ⁷³
hetkaaspakhuis.nl	The Kaaspakhuis	The Kaaspakhuis is a shop that sells delicacies such as cheese, nuts, wine, and chocolates.	Dairy & Cheese → Delicatessens ⁶¹⁷	gift basket ⁷² nuts ⁴¹⁷ cow ⁵⁹⁶ chocolate ⁹¹¹ cheese ¹²⁰⁵ wine ⁴⁴⁷⁶	Krimpenerwaard → Stolwijk ²³²
hippischwonen.nl	Hippisch Vastgoed	This website provides an overview of equestrian properties in the Netherlands and Belgium.	Property Finance → Buying ²⁵⁴ Office & Workspace → Business Directories ⁴²¹	objects ⁴²⁶ province ⁵¹⁸ listings ⁵²⁵ real estate ⁴⁹⁸¹ property ⁷⁴⁰⁶ price ⁸³²⁸	Krimpenerwaard → Bergambacht ³⁰³
hjki.nl	HJ-KI B.V.	The website of HJKI-service offers an independent insemination service and fertility guidance, focusing on flexible service delivery and a wide range of bulls.	Livestock → Animal Husbandry ¹¹⁰⁶	insemination ¹⁹ bull ⁴⁷ supplier ¹⁷²⁵	Molenlanden → Streefkerk ⁷⁸
hoengaerde.nl	Hoengaerde	The website of Hoengaerde presents a charming group accommodation in the Groene Hart region, suitable for groups of up to 12 people, with a focus on relaxation, conviviality, and exploring the surrounding area.	Accommodation → Group Accommodation ⁸⁴⁴ Conferences & Meetings → Meeting Venues ⁷²⁹	sunroom ⁹⁶ cottage ²⁹⁹ surroundings ⁴⁶³ living room ¹³²⁵ accommodation ⁴⁹²¹ garden ¹³¹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hoflandschoonhoven.nl	Gemeente Schoonhoven	This website provides information regarding the feasibility study of developing the Hofland-Noord area in Schoonhoven into a green residential area.	Research → Social Research ¹¹⁵ Sustainable Construction → Biobased Construction ¹¹	housing construction ¹²⁵ panel ⁸⁶⁸ resident ³²⁴⁵ newsletter ⁶⁵⁰⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
holbestratingen.nl	P.M. Hol Bestratingen	The website of P.M. Hol Bestratingen presents a construction company that has been active for almost 30 years in the field of ground and road construction, specializing in paving work.	Civil & Infrastructure → Infrastructure Management ¹⁴ Civil & Infrastructure → Road Construction ⁴⁸¹	reconstruction ⁸⁹ paving ¹⁹⁴² installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Stolwijk ²³²
hollandhandicrafts.nl	Holland Handicrafts	Holland Handicrafts is a shop specializing in handcrafted items, antiques, and collectibles located in Krimpen a/d Lek, Netherlands.	Hobbies → Collectibles ⁷⁷³ Antiques & Collectibles → Vintage ⁶²³	antique ⁴³²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
hondensportverenigingschoonhoven.nl	Hondensport Vereniging Schoonhoven	The website of Hondensport Vereniging Schoonhoven provides information about courses, activities, and membership opportunities for dogs and their owners.	Competitive Activity → Dog Sports ²²⁵ Martial Art → Brazilian Jiu-Jitsu ⁸⁴	privacy ¹²⁸⁶ instructor ³¹²⁶ dog ⁵⁴⁸³ membership ¹⁰⁴⁴² course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hoogstraat106.nl	Boer Makelaardij	The website of Boer Makelaardij presents an apartment for sale in Haastrecht, providing detailed information about the location, characteristics, and renovations.	Apartment Living → Luxury Apartments ³⁰⁴	feature ³⁰⁰ cost ¹⁹⁹⁰ apartment ⁵⁰⁸⁸ renovation ¹³⁸⁴⁹	Krimpenerwaard → Haastrecht ¹⁹³
hovenierverkade.nl	Hovenier Verkade	Hovenier Verkade is a landscaping company that offers garden design, maintenance, and renovation services.	Garden Maintenance → Garden Improvement ³³	quote ¹²⁸⁶³ garden ¹³¹²⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
hummelschilderwerken.nl	Hummel Schilderwerken	Hummel Schilderwerken is a one-man business providing painting and wallpaper services in Lekkerkerk.	Design & Projects → Self-Employed Entrepreneurs ⁵⁰⁵ Maintenance & Repair → Sole Proprietorships ¹²⁹	availability ²⁵⁶ painter ⁷⁴⁰ wallpaper ¹⁷⁵⁶ job ²⁷⁹⁵ quote ¹²⁸⁶³	Krimpenerwaard → Lekkerkerk ²⁴⁴
ikwileenmuurschildering.nl	Jacq Design	The website of Jacq Design Muurschilderingen showcases the services of Jacqueline Govers de Hon, an artist creating custom wall paintings, portraits, and paintings for individuals and businesses.	Painting → Murals ¹²⁵ Graphic Design & Printing → Graphic Arts ¹⁰³⁴	interior style ²⁵ wall painting ³² idea ²³⁶⁷ portrait ³⁶⁸⁵ paint ⁸⁷⁴⁷ design ²⁷²⁰²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
itprove.nl	ITPROVE	The website of ITPROVE focuses on optimizing business processes through custom Power Apps and advice on the use of Microsoft 365.	Information Technology → IT Security ⁹⁸⁰ Software Development & Engineering → App Development ¹⁰⁸⁴	cloud migration ²¹ power apps ²³ it management ¹⁵⁰ microsoft 365 ⁴³⁰	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
jdu-installatiebedrijf.nl	JDU Installatiebedrijf	JDU Installatiebedrijf is a technical service company offering installation, maintenance, and repair services for various installations for individuals, businesses, and housing corporations.	Installation & Repair → General Installation ⁷²⁷ Installation & Mounting → Construction Installation ¹⁷⁵	plumbing ¹⁷⁶¹ heat ²¹⁸⁸ energy ⁹⁰⁷⁵ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
jobofo.nl	Johann Borst	The website of Johann Borst showcases a portfolio of photography focusing on nature and animals, with a particular emphasis on birds and raptors.	Nature & Landscape → Nature Photography ⁴⁸² Animals → Birds ⁴⁷⁰	bird ⁹²² album ¹⁴⁹⁵ animal ²⁹⁰⁸ nature ⁹⁰⁹⁴ photography ⁹⁵⁰³	Krimpenerwaard → Bergambacht ³⁰³
johanbartels.nl	Johan Bartels	The website of Johan Bartels presents his services as a recognized career advisor, focused on guiding individuals towards the job market.	Work → Unemployment ⁶²	job market ⁷⁸ reintegration ¹¹⁵⁷ coach ²⁵⁸¹⁰	South-Holland → The Hague ¹⁹⁸⁹⁸
jsb-design.nl	JSB-design	The JSB-design website showcases the workshop of goldsmith and silversmith Jan Sjoerd van den Berg, who designs and creates exclusive jewelry and objects based on client requests.	Jewelry → Goldsmiths ³¹⁹	silver ⁴⁷⁹ gold ⁸⁰⁵ atelier ¹⁴¹⁷ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jse-engineering.nl	JSE Engineering	JSE Engineering is a technical bureau that provides integral technical designs, modeling, and drafting services.	Construction & Engineering → CAD ¹¹¹ Engineering → Engineering Firms ⁹⁸⁹	modeling ¹²⁸ technical ²⁹¹ drafting ³⁰⁸ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
jsip.nl	JSIP Jansen Schoonhoven	The website of JSIP Jansen Schoonhoven is an intellectual property advisory firm that helps businesses register and protect their trademarks, trade names, logos, and inventions.	Intellectual Property → Trademarks ²⁴ Financial Services → Advisory Firms ²²²	ip ²² trademark ⁹⁷ policy ²¹⁴⁹ registration ⁴³⁶⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kaasboersterk.nl	Kaasboer Sterk	The Kaasboer Sterk website is an online shop where authentic, self-aged cheese can be ordered. The site offers a wide selection of cheeses, gift packages, and information about the traditional cheesemaking process.	Dairy → Cheese ⁵³⁰	gift package ⁵³⁰ cheese ¹²⁰⁵ shop ⁶⁴⁸³	Krimpenerwaard → Stolwijk ²³²
kaashandelmarkus.nl	Markus Kaashandel	The website of Markus Kaashandel is an information page about cheese sales at various markets in the Krimpenerwaard region, providing information about locations, opening hours, and product offerings.	Local Events → Markets ¹⁰⁹⁷ Online Retail → Food Retail ³⁴⁰	ripen ²⁶ dairy products ⁴¹ cheese ¹²⁰⁵ market ²⁷⁷²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kaaskaas.nl	trdmrck	Kaaskaas.nl is an online store selling a variety of cheeses, with a focus on high-quality cheeses such as Gouda, Stolwijker, Old Cheese, and Leiden Cheese, delivered directly to the door.	Dairy → Cheese ⁵³⁰	nuts ⁴¹⁷ cheese ¹²⁰⁵	Krimpenerwaard → Stolwijk ²³²
kerkelijkdrukwerk.nl	Kerkelijkdrukwerk.nl	Kerkelijkdrukwerk.nl is an online printing company specializing in the printing of religious and community-oriented materials, such as church bulletins, liturgies, and promotional materials.	Performances & Entertainment → Celebrations ⁵⁶⁰ News & Journalism → Local Media ²⁰⁸	bulletin ⁵⁴ liturgy ²³⁸ flyer ²⁷⁴ greeting card ³³⁵ magazine ²¹⁸²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kermisagenda.nl	Kermisagenda.nl	The website provides an agenda of fairs (kermissen) in the Netherlands.	Local Events → Fairs ⁷⁰⁷	province ⁵¹⁸ fair ⁵⁸³ date ¹¹¹² agenda ⁴³⁷⁴ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
klantfocus.nl	KlantFocus	The website of Rutger Bol – KlantFocus presents the services of an experienced internet programmer who develops and implements solutions to improve business processes.	Computer Science → Software Engineering ⁴⁰⁴ Software Development & Engineering → Freelance Developers ¹⁴⁴	programming ⁵⁷⁵ technology ⁶⁸¹⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
klokkenton.nl	Klokkenmakerij KlokkenTon	The website of Klokkenmakerij KlokkenTon presents the services of a clockmaker specializing in the repair, restoration, and overhaul of clocks, including antique models.	Crafts → Clockmaking ⁵¹ Trade → Watchmaking ²⁹	clockmaker ²⁴ clocks ¹⁷⁸ movement ²³⁰⁴ restoration ³⁴¹⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
konijnenkolder.nl	Konijnenkolder	Konijnenkolder is a pension and grooming salon dedicated to the care of rabbits and guinea pigs.	Animals → Animal Care ¹⁸⁴⁹ Family → Pet Services ⁵⁴	guinea pig ⁶² grooming salon ²⁶³ rabbit ²⁹¹ pension ¹⁶⁸² food ³⁸⁷² accommodation ⁴⁹²¹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
kostentuinman.nl	Kosten Tuinman	The website ‘Kosten Tuinman’ provides an overview of gardening services in various regions of the Netherlands.	Office & Workspace → Business Directories ⁴²¹	gardener ²⁹⁹	Emmen → Nieuw-Amsterdam ¹⁴⁹
krimpenerwaardbusinessplaza.nl	Business Plaza Nederland	The Krimpenerwaard Business Plaza platform is a communication platform for entrepreneurs in the municipality of Krimpenerwaard.	Websites → Business Websites ¹⁸⁸ Business Associations → Local Business Associations ¹⁹²	partner ⁴²⁷² newsletter ⁶⁵⁰⁴ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
kruidenboterkruiden.nl	kruidenboterkruiden.nl	The website describes the history, ingredients, and sales channels of a unique herb butter mix, originally started in a café and now sold in supermarkets and online.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷ Sandwiches & Salads → Appetizers ⁴⁰	packaging ²²³⁶ store ³⁹⁰¹ vacation ⁴²³⁴ recipe ⁵¹⁴²	Krimpenerwaard → Bergambacht ³⁰³
kussens4u.nl	KUSSENS4U.NL	KUSSENS4U.NL is a workshop specializing in creating custom-made cushions, with a focus on quality and timely delivery. Joanna Naaiatelier offers advice and assistance in material selection, as well as the production of cushions for businesses and individuals.	Crafts → Textiles ¹²⁸⁰ Architecture & Design → Craft Businesses ⁷⁷	faux leather ²⁴ invoice ⁷⁹⁵ cushion ⁸²³ fabric ¹⁶⁴⁴ gallery ¹⁹⁸³ workshop ¹⁹³²⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
lifecoach4u.nl	lifecoach4u	The website lifecoach4u offers coaching services to help individuals address work and life questions, overcome problems, and achieve personal goals.	Mental & Emotional Well-Being → Youth Therapy ⁵³²	problem ²²¹⁴ question ²²⁶¹ goal ⁴⁹⁷⁴ coach ²⁵⁸¹⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
lizasbeautysalon.nl	Liza’s beautysalon	Liza’s beautysalon in South Holland offers nail styling and eyelash treatments to visitors.	Nail Services → Eyebrow Services ⁶² Beauty → Eyelash Services ¹¹³¹	eyelash ³⁵⁴ nails ¹⁷¹⁹ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
lugthart-natuursteen.nl	Lugthart-Natuursteen	Lugthart-Natuursteen is a natural stone company based in Gouda that offers craftsmanship and custom solutions for various projects.	Stone & Tiles → Tiles ⁸⁹⁵ Building & Materials → Facades & Cladding ⁸⁰⁹	wall covering ⁶³ window sill ⁷⁷ countertop ¹⁷⁹ natural stone ⁶¹⁴ restoration ³⁴¹⁷	Krimpenerwaard → Berkenwoude ⁶²
lunchroomplein19schoonhoven.nl	Smash Burgers 'N Chicken	The website of Smash Burgers 'N Chicken is an online ordering platform that allows visitors in Schoonhoven to order dishes, including burgers and chicken dishes, for delivery.	Fast Food → Burgers ⁶⁸⁷ Fast Food → Burger Restaurants ³⁴⁶	chicken burger ¹⁸ milkshake ¹⁹⁵ burger ¹⁴³¹ fries ²⁷⁵³ menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mariellebutter.nl	Paard & Coach Marielle Butter	Paard & Coach Marielle Butter offers guidance and coaching through the use of horses.	Coaching → Horse Coaching ³³⁹ Outdoor → Horse Riding ⁹⁴¹	insight ⁶²⁸ session ¹⁷⁹¹ growth ⁴⁰⁵⁴ horse ⁴³³⁷ coach ²⁵⁸¹⁰	Krimpenerwaard → Bergambacht ³⁰³
marijehofland.nl	MarijeHofland.nl	This website serves as a professional portfolio and resume for Marije van Eijk-Hofland, an experienced IT project manager and internet marketing specialist.	Advertising & Promotion → Online Marketing ⁸¹⁷⁴ Technology → IT ³³³⁷	product management ⁵⁴ internetmarketing ⁷¹ agile ⁴¹⁷ project management ³⁴²³ communication ¹⁰¹⁶²	Krimpenerwaard → Lekkerkerk ²⁴⁴
marleenpedicure.nl	Marleen Pedicure	Marleen Pedicure is a medical pedicure practice in Schoonhoven that treats feet, including those with diabetes and rheumatism.	Orthopedics → Foot Problems ⁹⁷⁷	callus ¹⁰⁸ orthotics ¹⁷² gel nail ²¹⁸ diabetes ⁷⁵⁰ nails ¹⁷¹⁹ foot ¹⁹²⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
marypee.nl	Marypee	The Marypee website is a printing company located in Krimpen aan de Lek, offering various printing techniques such as screen printing, pad printing, digital transfer, plot transfer, sublimation and general printing, and also provides project work and photography services.	Printing → Textile Printing ²⁵¹ Graphic Design & Printing → Graphic Companies ³³	printing technique ⁸⁵ textile ¹⁴²¹ print ⁵⁵¹¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
massagepraktijkvanrees.nl	Massagepraktijk Van Rees	The website of Massagepraktijk Van Rees provides information about the range of massage treatments offered, along with opening hours and contact details.	Massage → Sports Massage ⁶⁴¹	relaxation massage ⁷¹ chair massage ²⁷⁵ sport massage ⁶³⁰ rate ²⁶⁰⁶ massage ⁷⁶⁴⁶ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
metenzekerweten.nl	ABM van Zijl b.v.	The website metenzekerweten.nl offers a variety of measuring and testing equipment, including non-destructive testing equipment, thickness gauges, and hardness testers.	Industry → Industrial ¹⁹⁸⁷	ndt ¹⁶ scale ¹⁹⁴	Krimpenerwaard → Gouderak ¹⁰³
michaelashair.nl	Michaela’s Hair@Home	The website of Michaela’s Hair@Home is a personal hair salon offering services to residents of Bergambacht, Schoonhoven, and Lekkerkerk, with a focus on a relaxed atmosphere and professional results.	Hair Education → Hair Products ⁶¹²	hair coloring ¹¹⁴ hair products ³⁰¹ cut ⁹²⁶ hairdresser ¹³⁷²	Krimpenerwaard → Bergambacht ³⁰³
monicasvoetenservice.nl	Monica Pedicure	The website of Monica Pedicure is an online platform for specialized foot care in Krimpen aan de Lek and surrounding areas, providing personalized care advice and treatments for foot problems.	Foot Care → Medical Foot Care ⁷¹⁰ Orthopedics → Foot Problems ⁹⁷⁷	corn ¹⁰¹ callus ¹⁰⁸ footcare ⁷⁶⁷ nails ¹⁷¹⁹ pedicure ²¹⁹⁶ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
muilwijksnijbloemen.nl	Muilwijk Snijbloemen	Muilwijk Snijbloemen is a flower nursery located in Stolwijk, South Holland, specializing in the cultivation of cut hydrangeas and hollies.	Plants → Nurseries ¹⁰¹² Commerce → Flowers ²²³⁸	hydrangea ⁸⁵ flowers ³²⁴⁸ certification ³³⁸⁰ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Stolwijk ²³²
mva-hoveniers.nl	MVA Hoveniers	MVA Hoveniers is a landscaping company offering services for garden design, construction, maintenance, and renovation.	Garden Maintenance → Landscapers ²⁸⁷	landscaping ¹⁵²⁹ quote ¹²⁸⁶³ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Ammerstol ⁴⁹
nbckrimpenerwaard.nl	Natuurbeheercollectief Krimpenerwaard (NBC Krimpenerwaard)	The website of the Natuurbeheercollectief Krimpenerwaard (NBC Krimpenerwaard) presents information about the cooperative management of nature and agriculture in the Krimpenerwaard, specifically focused on the preservation of the Natuurnetwerk Nederland (NNN).	Nature → Nature Management ⁴⁶ Agriculture → Agricultural Consulting & Management ¹³⁰	cooperative ⁶⁴⁹ nature ⁹⁰⁹⁴ news ¹⁵²⁹³
noordseweide.nl	Stolwijds Ontwikkeling BV	This website provides information about the Noordse Weide project, a new housing development with approximately 100 homes in Stolwijk, developed by Stolwijds Ontwikkeling.	Local Politics → Municipal Council ⁴⁸⁴ Local Government → Municipal Projects ³⁶	home seeker ²¹ feasibility study ²⁵ working group ¹³⁴ home ⁷⁹⁷⁶	Krimpenerwaard → Stolwijk ²³²
novaportus.nl	W.S.V. Nova Portus	The website of W.S.V. Nova Portus presents the Nieuwpoort marina on the Lek River in South Holland, providing information for guests and members.	Boating → Marinas ⁸²⁵ Vacations → City Breaks ⁵³⁶	surroundings ⁴⁶³ marina ⁴⁸⁷ guest ¹³³⁴ member ¹⁰¹⁵⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ondernemerskring-ouderkerk.nl	O.K.O. - Ondernemerskring Ouderkerk	The website of O.K.O. - Ondernemerskring Ouderkerk provides information about the business association, its members, board, and activities in the Krimpenerwaard region. The aim is to promote the business climate in the area and support collaboration between businesses, the municipality, and the province.	Associations → Regional Associations ²⁹² Associations & Groups → Business Associations ¹⁰¹⁸	business climate ²² business association ⁸⁴ region ⁵⁴¹² municipality ⁶⁸³⁷ member ¹⁰¹⁵⁴ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
oosterhoef30.nl	Kleurrijk NVM Makelaars & Taxateurs	The website of Kleurrijk NVM Makelaars & Taxateurs presents a property for sale in Bergambacht, providing detailed information about the location, features, layout, and amenities.	Houses → Semi-Detached Houses ⁷⁵¹ Houses → Townhouses ⁶³²	living area ³⁴⁹ agent ¹²⁵³ property ⁷⁴⁰⁶ garden ¹³¹²⁹	Krimpenerwaard → Bergambacht ³⁰³
partypoppenverhuur.nl	PartyPoppen Rental	The PartyPoppen Rental website, located in Montfoort, offers inflatable pop rentals, including Sarah, Abraham, and Swan inflatables, for various occasions such as anniversaries and birthdays.	Hospitality → Suppliers ¹⁰⁵⁷ Parties → Birthday Parties ¹⁰⁰⁸	banner ⁵¹⁸ party ⁵⁹²⁸ book ¹¹³⁹⁶	Bodegraven-Reeuwijk → Waarder ⁶⁸
partyserviceoudewater.nl	Party Service Oudewater	The website of Party Service Oudewater offers rental of various party supplies, including party tents, tables, and other tableware.	Commerce → Rental Businesses ⁸⁷ Event Rental → Tent Rental ⁴³⁷	party tent ²⁵⁶ tableware ⁶¹³ bar ¹²¹⁶ table ¹⁷⁷⁸ equipment ⁴¹⁴³	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
pedicurejijenik.nl	Pedicure Jij & Ik	The website of Pedicure Jij & Ik offers services for foot care and wellness, including medical pedicure, wellness massages and gel nail treatments.	Foot Care → Medical Foot Care ⁷¹⁰ Nail Services → Nail Products ⁹²⁹	gel nails ²⁰ footcare ⁷⁶⁷ wellness ¹⁵⁶¹ pedicure ²¹⁹⁶ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
pinball4u.nl	Pinball4u	The website of Pinball4u offers digital pinball machines, available in various sizes and specifications, allowing users to enjoy a pinball experience at home without the high cost of a traditional pinball machine.	Games → Computer Games ²⁶³ Hobbies → Gaming ⁶⁰⁵	oled ¹⁷ pinball machine ²⁴ game ²⁸⁰⁷ model ³⁵⁴⁶ showroom ⁴⁸⁸³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
pizzeriashoarmatorino-lekkerkerk.nl	Pizzeria Shoarma Torino	The website Pizzeria Shoarma Torino from Lekkerkerk offers online ordering for delivery of pizzas, pasta, and other dishes.	Italian Restaurant → Pizza Restaurant ³⁵¹ Food Delivery → Delivery ²²²⁷	pasta ¹³⁸⁹ salad ²⁴⁴⁴ pizza ⁴¹⁵⁸ order ⁶⁹¹² menu ¹³⁸⁵⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
popkoorschoonhoven.nl	Popkoor Schoonhoven	The website of Popkoor Schoonhoven presents information about the choir, including rehearsal schedules, repertoire, performances, and contact details.	Choir → Pop Choir ¹⁹⁶ Theater → Performances ⁶⁴⁹	gathering ³⁹⁴ singing ¹⁰⁵⁶ song ¹²⁸⁵ rehearsal ¹⁶³⁹ repertoire ²⁴⁹⁷ choir ³¹²³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
pouwer.nl	Balance Bedrijfsbeëindiging	This website announces the cessation of advisory activities by Pouwer & Stevers, with the continuation of the advisory services by Balance Bedrijfsbeëindiging.	Energy → Energy Transition ²²⁵ Community → Government & Administration ¹⁰⁵⁶⁷	termination ⁸² contact details ¹⁰⁸ consulting ³⁶³⁹ balance ⁴⁵⁸²	Krimpenerwaard → Lekkerkerk ²⁴⁴
prio1-coaching.nl	Prio 1 Coaching & Training	The website Prio 1 Coaching & Training offers specialized coaching and training specifically for first responders to improve their balance, resilience, and leadership skills, utilizing walking and kayaking coaching in a natural environment.	Coaching → Professional Coaching ⁴⁷¹	first responder ¹² walking coaching ²¹⁹ forest ¹⁴¹⁸ nature ⁹⁰⁹⁴ coach ²⁵⁸¹⁰	Krimpenerwaard → Lekkerkerk ²⁴⁴
rapidotypen.nl	Rapido Typen	The website of Rapido Typen provides information about and courses for ten-finger blind typing, targeted at both children and adults.	Learning Disabilities → Dyslexia ⁴³⁸ Driver & Vehicle → Continuing Education ⁴⁵⁴	adhd ³⁵⁴ dyslexia ⁴⁰⁸ course ¹⁴⁷²⁸	Altena → Hank ¹¹³
raymihoveniers.nl	Raymi Hoveniers	Raymi Hoveniers is a landscaping company providing garden design, installation, maintenance, and business gardens.	Garden Maintenance → Landscapers ²⁸⁷ Green Spaces → Green Maintenance ⁴⁴⁹	business garden ¹⁵ garden ¹³¹²⁹ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
renssenklusbedrijf.nl	Renssen Klusbedrijf	Renssen Klusbedrijf is a handyman service that provides a wide range of services in the Bergambacht and surrounding area.	Maintenance & Repair → Skilled Trades ²²⁰ Household & Cleaning → Home Services ¹³²¹	handyman ⁸³⁶ carpentry ²²¹⁸ paint ⁸⁷⁴⁷ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
restaurantgino.nl	Restaurant Gino	The website of Restaurant Gino serves as an online platform for ordering pizzas, kapsalon (hair salon style dishes), Turkish pizzas and other meals, as well as for arranging deliveries to various surrounding villages and towns.	Italian Restaurant → Pizza Restaurant ³⁵¹ Food Delivery → Delivery ²²²⁷	turkish pizza ⁶³ kapsalon ⁵⁰⁹ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Garmerwolde → Lageweg ¹²
restaurantsfinx-lekkerkerk.nl	Restaurant Sfinx	Restaurant Sfinx in Lekkerkerk offers an online ordering system for its menu, showcasing a variety of dishes such as Greek and Turkish specialties, and different plate combinations.	International → Greek ⁴⁶⁵ Websites → Ordering Sites ⁷⁵	pita ¹⁹⁹ plate ⁷⁸⁷ beer ²⁸⁸⁷ dish ⁵⁹³⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
rialeeuwenburgh.nl	Ria Leeuwenburgh	The website of Ria Leeuwenburgh offers creative lessons and workshops, primarily focused on drawing and mixed media collage.	Drawing → Drawing Art ²² Painting → Techniques ¹¹¹	paper ⁷⁷⁰ drawing ¹¹⁰¹ inspiration ⁴⁰⁸¹ studio ⁵⁴⁶⁵	Krimpenerwaard → Stolwijk ²³²
riccardodekoning.nl	Osteopathie praktijk Riccardo de Koning	The website of Osteopathie praktijk Riccardo de Koning is an information page about an academically trained osteopath in Ouderkerk a/d IJssel who provides holistic treatment for physical ailments.	Dentistry → Specialties ³⁷⁸ Physical Therapy → Osteopathy ⁹²²	spine ¹²⁵ osteopathy ⁸⁰⁹ patient ⁴⁰⁸² complaint ⁶⁴⁷⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
rijschoolboutique.nl	Rijschool Boutique	Rijschool Boutique is a driving school that offers lessons for various driving license categories and specializes in driving, motorcycle and scooter lessons.	Traffic Management → Traffic ⁵⁸⁹	driving skills ¹⁶ driving license ⁴⁰² driving lessons ²⁴⁵³ instructor ³¹²⁶	Krimpenerwaard → Bergambacht ³⁰³
rijschoolmaraya.nl	Rijschool Maraya	Rijschool Maraya in Gouda offers driving lessons in the region and surrounding areas, with various packages and options.	Driver & Vehicle → Driver’s License ¹⁶²⁵	driving license ⁴⁰² exam ²¹²⁰ driving lessons ²⁴⁵³ instructor ³¹²⁶ package ⁶¹¹²	Krimpenerwaard → Bergambacht ³⁰³
roosendaal-elektricien.nl	RV Elektra	RV Elektra is an electrician in Roosendaal providing various electrical services.	Energy → Electricity ⁷¹² Technology → Smart Home & Automation ¹¹⁴⁶	group box ⁵³ power ²⁶¹ charging station ⁷⁸⁹ inspection ⁴²⁷⁹ solar panels ⁴⁷⁰¹ installation ¹³⁷⁴²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
royalboogaerdttimber.nl	Royal Boogaerdt Timber	The website of Royal Boogaerdt Timber presents the timber merchant as a long-standing partner specializing in sustainable teak wood and solutions, particularly for the yacht and shipbuilding industry.	Shipbuilding → Components ²³ Trade → Timber Trade ¹¹⁶	fsc ³⁷ teak ¹⁰³ import ⁵¹⁰ yacht ⁶⁴⁷ wood ⁴¹⁵³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
rpdevriestuinen.nl	R.P. De Vries Tuinen	The website of R.P. De Vries Tuinen presents a landscaping company offering services for the design and maintenance of gardens in Krimpen aan den IJssel and the surrounding area.	Garden Maintenance → Landscapers ²⁸⁷ Landscaping → Garden Installation ⁶¹⁷	timber construction ¹⁵⁷ paving ¹⁹⁴² quote ¹²⁸⁶³ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
salonpuursan.nl	Salon Puur San	Salon Puur San is a beauty salon and pedicure practice located in Schoonhoven, offering facial and skin-enhancing treatments, pedicure treatments, and lash lifting services.	Spas & Relaxation → Spa Treatments ⁶²⁶	pedicure ²¹⁹⁶ skin ²⁵¹⁸ relaxation ³⁹⁶⁸ salon ⁵⁵⁴¹ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sandradesign.nl	Sandra Design	The website of Sandra Design showcases the portfolio and services of a graphic designer, Sandra, who offers custom graphic solutions, including logos, branding, and print materials.	Graphic Design → Freelance Graphic Designers ⁴²⁹ Communication → Graphic Communications ¹³	print materials ⁵⁷ graphic design ²⁰⁴² branding ⁴⁶¹⁴ logo ⁴⁶⁶⁰	Krimpenerwaard → Stolwijk ²³²
scharpersflex.nl	Scharpersflex BV	The Poedercoaten.eu website offers services for the repair, transformation and finishing of car rims, including dent removal, blasting and powder coating, and sells powder coating equipment and materials.	Repair → Garage ¹⁷⁷⁹ Metalworking → Powder Coating ⁵⁹	rims ¹³² blasting ¹³⁶ powder coating ¹⁹⁸ equipment ⁴¹⁴³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
schoonhovenhelpt.nl	Stichting Schoonhoven helpt Oekraïne	The website is a crowdfunding initiative for the foundation ‘Schoonhoven helps Ukraine,’ which aims to assist Ukrainian refugees in Poland with emergency aid.	International Aid → Ukraine ²⁷ Social Organization → Humanitarian Organizations ¹¹³⁵	refugees ³⁴⁰ aid ⁴²⁷ goods ⁶⁶⁶ infrastructure ¹⁴⁶⁰ food ³⁸⁷² donation ⁵¹¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
selekt-a.nl	Selekt.A.	The website Selekt.A. specializes in the professional removal of graffiti and the cleaning of facades, with a focus on an environmentally friendly approach.	Maintenance & Services → Facade Maintenance ⁶⁷³ Context → Environment ⁵⁴⁴³⁷	facade cleaning ³⁸⁵ environment ⁴⁸⁷³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
servicevansaar.nl	Service van Saar	Service van Saar is a service provider offering personal care, individual support, and household assistance to seniors and people with disabilities in the Krimpenerwaard region.	Care → Personal Care ⁵⁹²	companionship ¹²² household ³⁸² dementia ⁶⁷⁴ care ¹²³³⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
showa-werkhandschoenen.nl	Stolwijk Beschermd Werken B.V.	Showa Werkhandschoenen is an online store selling work gloves and other personal protective equipment and workwear.	Business → Industry ³⁶⁹⁷⁷	protective equipment ⁶⁶ gloves ²⁹² workwear ⁸⁵¹ comfort ¹⁴⁷³ market ²⁷⁷²	Krimpenerwaard → Stolwijk ²³²
siangpure.nl	Siang Pure	The website offers information and sells products from Siang Pure, a herbal remedy with a long tradition.	Alternative Medicine → Naturopathy ¹⁰⁹⁷ Anatomy & Systems → Respiratory ⁶⁰	blood circulation ⁵⁷ herbs ⁹²⁴ oil ⁹⁷⁰ healing ¹¹⁴⁸	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
siloservice.nl	Silo Service de Langen	Silo Service De Langen is a company that offers service and repair of silos and polyester products.	Plastics → Manufacturing ⁷⁷⁰⁸ Agriculture → Agricultural Technology & Innovation ⁷⁴³	silo ⁹⁶ polyester ¹⁰¹ pipe ⁶⁹⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
skin-point.nl	Skin Point	The website of Skin Point in Stolwijk presents the salon, its treatments, products, and contact information.	Salon & Treatment Centers → Beauty Treatments ²⁵²	beauty salon ⁵⁴⁷ skin ²⁵¹⁸ treatment ²¹²⁰³	Krimpenerwaard → Stolwijk ²³²
snacksonskrimpen-krimpenaandelek.nl	Snacksons Krimpen	Snacksons Krimpen is an online ordering platform for food in Krimpen aan de Lek.	Fast Food → Burgers ⁶⁸⁷	loaded fries ⁴¹ chicken ⁹⁴⁴ sauce ¹¹⁴¹ burger ¹⁴³¹ fries ²⁷⁵³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
spomuza.nl	SPOMUZA	The website of SPOMUZA presents the activities of the Sport, Music and Singing association in Schoonhoven, with information about events, the entry of Sinterklaas (Dutch version of Santa Claus), and opportunities to recruit volunteers and sponsors.	Local & Regional → Regional Events ⁸²¹	sinterklaas ⁴⁵⁶ board ³⁴³⁸ association ⁸⁵⁶² event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sprannkel.nl	Sprannkel Design	Sprannkel Design is a creative advertising and consultancy agency offering a variety of graphic design services.	Online Marketing → Promotion ⁶¹⁴	brand identity ¹⁴⁵⁷ promotion ²⁰⁶² concept ³³³⁸ logo ⁴⁶⁶⁰ atmosphere ⁵⁵⁹¹ design ²⁷²⁰²
stellingbeveiliging.nl	Stelling Beveiliging & Telecommunicatie	The website Stelling Beveiliging offers security solutions and advice for homes, shops, and offices.	Security → Security Systems ⁹⁷¹	alarm ³⁷⁷ plan ²⁵⁶⁶ risk ²⁸⁹⁶ shop ⁶⁴⁸³ security ⁶⁶⁵⁵ home ⁷⁹⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
stucsupply.nl	StucSupply	The website of StucSupply is a plastering company specializing in wall and ceiling finishes, with a focus on decorative solutions and an educational academy.	Finishing & Trades → Interior Finishing ⁹⁸ Construction → Building Systems & Services ⁵⁵⁹	wall finishing ³¹⁰ academy ⁵⁹³ plaster ²¹⁷⁵ bathroom ³⁷⁸⁴	Krimpenerwaard → Stolwijk ²³²
studiodoop.nl	Studio doop	Studio doop is an exercise space for performing artists dedicated to the promotion of the performing arts and the creation of an inclusive and sustainable work environment.	Recordings & Production → Recording Studios ⁴⁷³ Arts → Performing Arts ¹³⁷⁶	warehouse ¹⁰²⁷ space ³⁸⁴⁶ artist ⁵⁷⁴⁵ foundation ⁶⁶⁷⁸ community ⁷⁹³¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
studiovonz.nl	Vonz	The Vonz website showcases handmade home accessories, bags, and vegetarian faux fur products, all made from wool from their own sheep and crafted in a small workshop in the Netherlands.	Crafts → Textile Work ¹³⁴ Crafts → Textiles ¹²⁸⁰	felt ²⁰⁸ wool ⁴⁸⁹ chair ¹²²³ workshop ¹⁹³²⁵
sultanpizzeria-krimpenaandelek.nl	Sultan Pizzeria	The website of Sultan Pizzeria offers online ordering for pizzas, Turkish pizzas, pasta dishes and other dishes from Krimpen aan de Lek.	International → Turkish ⁴¹⁶ Turkish Cuisine → Fast Food ³²²²	calzone ⁹⁰ shoarma ²⁵⁴ chicken ⁹⁴⁴ sauce ¹¹⁴¹ pasta ¹³⁸⁹ pizza ⁴¹⁵⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
sushi-plusrechtuyt.nl	Plus Rechtuyt Schoonhoven	This website is the official online ordering page for Plus Rechtuyt Schoonhoven, where visitors can order sushi and other dishes online and view the menu.	Japanese → Sushi ⁹⁷¹ Meal Solutions → Food Businesses ⁵⁷	sushi ¹⁶⁹⁵ review ¹⁸⁸⁸ promotion ²⁰⁶² dish ⁵⁹³⁶ order ⁶⁹¹² menu ¹³⁸⁵⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tandartsvanmoorsel.nl	Tandartspraktijk van Moorsel	The website of Tandartspraktijk van Moorsel in Schoonhoven provides information about the practice, services, appointment scheduling, opening hours, and contact details. The aim is to inform potential patients and facilitate appointments.	Health → Medical Care & Services ²⁹⁴⁶¹	dental health ³⁴ prevention ¹⁷⁶³ pain ¹⁹¹⁹ practice ⁹⁰⁸⁹ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tcbergambacht.nl	Tennisclub Bergambacht	The website of Tennisclub Bergambacht provides information about membership, activities, competitions, court availability, and events, focusing on tennis in Bergambacht.	Sport Facility → Tennis ²⁰⁷⁸	tennis ⁸³⁶ court ⁹⁹⁹ competition ⁴⁷⁵⁹ lesson ⁵¹⁵⁴ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
techforcerijnmond.nl	TechForce Rijnmond	TechForce Rijnmond is a collaboration aimed at fostering interest in technology and engineering among young people and providing them with opportunities on the technical labor market.	Vocational Training → Technical Education ²¹⁵ Business Services → Collaboration ⁴⁰⁹	technical education ¹⁷ labor market ²⁹⁶ region ⁵⁴¹² education ¹³⁴⁷¹ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
techraceservice.nl	Tech Race Service	Tech Race Service is a one-man business offering various technical services and manufacturing, primarily focused on automotive maintenance and restoration.	Metalworking → Welding ⁸⁹³ Renovation & Restoration → Construction Work ¹⁵	engine ⁷⁵⁸ welding ¹⁰⁵¹ restoration ³⁴¹⁷ car ¹⁰⁸⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tennisgouderak.nl	Gouderakse T.V.	Gouderakse T.V. is a tennis club providing information, news, events, and membership details to its members and the public.	Associations → Sports Associations ¹⁰⁸² Tennis → Tennis Clubs ⁷²⁰	tennis ⁸³⁶ court ⁹⁹⁹ tournament ²⁴⁷⁶ club ⁴²²⁵ membership ¹⁰⁴⁴²	Krimpenerwaard → Gouderak ¹⁰³
thenakedtruth.nl	The Naked Truth Productions	The website of The Naked Truth, an Earring tribute band, showcases their live performances in various theaters and festivals across the Netherlands.	Rock → Tribute Bands ²³⁰ Music & Performance → Music Events ⁷⁵⁸	tour guide ²⁸ theater ²⁵⁴⁴ ticket ²⁷⁸⁵ band ²⁹⁷⁷ festival ³⁸⁰⁴ performance ⁷⁵⁸⁶	Oirschot → East-West-and Middle Beers ²¹⁴
thevegansaint-gouderak.nl	The Vegan Saint	The Vegan Saint website is an online platform where customers can order vegan dishes, sweets, and drinks from Gouderak.	Vegan & Vegetarian → Vegan Restaurants ²⁸	macarons ⁹¹	Krimpenerwaard → Gouderak ¹⁰³
thiendenland.nl	Thiendenland Dental Practice Schoonhoven	The website of Thiendenland Dental Practice Schoonhoven provides information about the dental practice, its services, staff, and opening hours, and serves as a contact point for appointments and emergencies.	Dentistry → Pediatric Dentistry ⁴⁴¹	dental practice ¹⁸¹ emergency ⁷⁵⁰ dentist ²⁵¹⁴ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
topvakantiedeals.nl	TopVakantieDeals	This website offers a comparison service for vacations, last-minute deals, and offers, both within and outside of Europe.	Holidays → All-Inclusive Holidays ⁹⁷	travel provider ²⁹ deal ⁷⁷³ destination ²⁵⁸⁰ hotel ³⁵⁴³ vacation ⁴²³⁴	Drimmelen → Made ³³⁵
tree3stars.nl	Tree3stars Glaskunst & Workshops	The Tree 3 Stars Jewelry & Glass Beads website presents and sells unique, handmade glass bead jewelry and organizes glass bead workshops.	Crafts → Glassworking ⁵⁸¹	glass bead ³⁰ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
trimsalon-noel.nl	Trimsalon Noël	The Trimsalon Noël website is a salon specializing in grooming for all breeds of dogs.	Dogs → Grooming ¹⁶⁰	animal shelter ⁷⁸ coat ⁴⁶⁰ grooming ⁸⁹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Haastrecht ¹⁹³
trouwborstbv.nl	Trouwborst Konstrukties BV	Trouwborst Konstrukties BV is a specialist in the production and supply of lead balcony feeders and rainwater drainage systems.	Metalworking → Stainless Steel Fabrication ¹⁶¹ Garden → Fencing ³⁰⁷	bracket ⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
ttv-top.nl	Tafeltennis vereniging T.O.P. Haastrecht	The website of Tafeltennis vereniging T.O.P. Haastrecht provides information about the association, events, membership, and contact details.	Sports Clubs → Table Tennis ⁴⁹⁵ Associations → Sports Associations ¹⁰⁸²	table tennis association ¹¹ schedule ²⁶²⁴ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴² news ¹⁵²⁹³	Krimpenerwaard → Haastrecht ¹⁹³
tuininbalans.nl	Tuin in Balans	Tuin in Balans is a landscape designer specializing in creating vibrant gardens that cater to the client's individual preferences.	Garden Maintenance → Garden Landscaping ⁷¹¹	flower garden ¹⁷ balance ⁴⁵⁸² nature ⁹⁰⁹⁴ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Lansingerland → Bergschenhoek ⁵⁶⁸
utrechtsetaxi.nl	Utrechtse Taxi	Utrechtse Taxi provides a taxi service in the Utrecht region and surrounding areas, offering specialized services such as airport transportation and wedding transportation. The website showcases a variety of pick-up points and destinations.	Taxi & Ride Services → Taxi ¹⁰⁶²	drive ⁴²⁸ airport ⁷⁸⁹ taxi ²⁰⁹⁰	Woerden → Harmelen ³³⁵
vakantiehuisdehooiberg.nl	Vakantiehuis De Hooiberg	The website offers vacation rental of the De Hooiberg vacation house in Berkenwoude, located in the Krimpenerwaard, the Green Heart, and provides information about the accommodation and surrounding nature.	Accommodation → Cabins ²³¹ Nature → Landscape ¹¹²⁹	green heart ³⁹ vacation house ¹³⁵ egg ³³⁵ bird ⁹²² farm ²⁶²² garden ¹³¹²⁹	Krimpenerwaard → Berkenwoude ⁶²
vanbuurenairco.nl	Van Buuren Airco	Van Buuren Airco is a company that provides air conditioning systems and related services for various applications.	Climate Control → Air Conditioning ¹⁰²² Installation & Repair → Climate Installation ²⁴⁹	climate control ²³⁸ air conditioning ²¹⁷⁸ sale ⁵⁹³⁰ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Lekkerkerk ²⁴⁴
vandenbroektechniek.nl	VDB Techniek	The website of VDB Techniek presents a company that builds, designs, and manufactures ground, road, and water construction machines and parts, with a focus on custom solutions and maintenance.	Industrial Equipment & Services → Machine Building ⁶⁶⁵ Metalworking → Welding ⁸⁹³	building ³²⁰⁴ concept ³³³⁸ machine ³⁷²⁷ repair ¹⁴⁵⁷⁶ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
vanroonverwarming.nl	Van Roon Verwarming	Van Roon Verwarming is an installation company specializing in central heating and related services in the Krimpen aan den IJssel region.	Heating → Boilers ³³⁶ Retail & Supplies → Industrial Supplies ¹³³	boiler ¹²⁴⁰ heat ²¹⁸⁸ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
vanrumph.nl	Van Rumph Secretariële Dienstverlening	Van Rumph Secretariële Dienstverlening offers virtual assistant services to entrepreneurs who want to outsource their secretarial and administrative tasks.	Freelance & Independent → Virtual Assistants ⁸⁴⁰	va ²⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
vdgvloeren.nl	VDG Vloeren	VDG Vloeren is a specialist in PVC flooring and stair renovations in the Krimpenerwaard.	Flooring → PVC Flooring ²⁴⁵ Renovation → Stair Renovation ³⁵⁰	stair renovation ¹⁹⁰ pvc flooring ¹⁹⁹ showroom ⁴⁸⁸³ interior ⁸⁰⁹³
verstoepverhuur.nl	Verstoep Verhuur	Verstoep Verhuur is a company that rents out garage boxes and caravan storage spaces.	Caravans → Caravan Storage ¹⁴⁵ Real Estate → Real Estate Rental ⁷⁰	garage box ¹³⁸ caravan ¹³⁹⁴ box ¹⁹⁸² storage ²⁴⁴⁶ building ³²⁰⁴	Krimpenerwaard → Gouderak ¹⁰³
vrmh.nl	Verkeersregelaars Midden Holland	The website of Verkeersregelaars Midden Holland presents a professional service offering for traffic regulation and other traffic services, focused on the safest possible handling of traffic at various projects and emergencies.	Safety → Traffic Safety ¹¹⁷ Traffic Management → Traffic ⁵⁸⁹	traffic measures ⁴⁷ traffic regulator ⁵⁸ emergency ⁷⁵⁰ traffic ⁹¹⁶	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
vtvgroenakker.nl	VTV Groenakker	VTV Groenakker is a community garden association located in Gouda that promotes natural gardening methods and social interaction.	Gardening → Community Gardens ³⁹³ Nature → Biodiversity ³⁸²	complex ⁵⁶⁸ animal ²⁹⁰⁸ nature ⁹⁰⁹⁴ member ¹⁰¹⁵⁴ garden ¹³¹²⁹	South-Holland → Gouda ³⁵²¹
vuurwerkbergambacht.nl	Van Eijk Vuurwerk	The website of Van Eijk Vuurwerk presents a fireworks shop with both a physical store and a webshop, and offers the possibility to purchase or order fireworks.	Party Supplies → Fireworks ²⁵⁸	identification ⁷⁶ fireworks ⁴¹³ store ³⁹⁰¹ webshop ⁸⁶⁴⁸	Krimpenerwaard → Bergambacht ³⁰³
vuurwerkhal-ouderkerk.nl	Vuurwerkhal Ouderkerk	The website Vuurwerkhal Ouderkerk facilitates online ordering of fireworks in Ouderkerk, in collaboration with suppliers.	Party Supplies → Fireworks ²⁵⁸ Parties → New Year ¹⁸	fireworks ⁴¹³ supplier ¹⁷²⁵ order ⁶⁹¹²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
warmteserviceholland.nl	Warmte Service Holland	The website describes the cessation of Warmte Service Holland and advises visitors to contact KIIP for new purchases, services, parts, and warranties of certain heat equipment brands.	Retail & Commerce → Commerce ⁸²⁴⁴ Installation & Repair → Heating Technology ³⁹	installer ⁶⁷⁷ warranty ⁴⁷⁰¹ part ⁵⁰⁴⁴ brand ¹⁷⁷³⁷	Opmeer → Hoogwoud ¹⁴⁹
werkindeinstallatietechniek.nl	Werk in de Installatietechniek	Werk in de Installatietechniek is a platform designed to help employers in the installation industry attract new colleagues and connect with relevant parties, ultimately making the industry more appealing.	Building → Mechanical Systems ³⁹	energy efficiency ¹⁷⁶ installer ⁶⁷⁷ employer ²³⁸³ vacancy ⁶⁵⁹⁸ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Haastrecht ¹⁹³
wilhelminastraat23a.nl	Alphamakelaardij	This website presents a list of real estate for sale in the Gouda area.	House Types → Houses ²⁵⁴⁶ Gifts → Gift Cards ⁹⁸¹	type ³¹⁰ size ⁸⁰⁰ property ⁷⁴⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
willemiekeversluis.nl	Willemieke Versluis	The website of Willemieke Versluis provides style and color consulting services to individuals, with a focus on helping people discover their own colors and style and making small changes in their environment.	Fashion → Style Advice ³⁷⁰ Fashion → Color Consulting ⁶⁷	color consulting ⁷⁴ personality ⁶⁷¹ color ⁴¹⁵⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
wimdeelenfotografie.nl	Wim Deelen Fotografie	The website of Wim Deelen Fotografie presents the work of photographer Wim Deelen and describes his activities, including conducting photography workshops for children at elementary schools and participating in the Fotoclub Molenwaard.	Arts → Imaging & Photography ⁷⁶⁸⁷	fotoclub ¹¹ photography ⁹⁵⁰³ workshop ¹⁹³²⁵	Rheden → Dieren ⁴⁶²
wimdenhaak.nl	Wim den Haak Ouderwetsche Rijwielen	The website of Wim den Haak Ouderwetsche Rijwielen showcases a bicycle shop and repair shop specializing in vintage bicycles and parts in Schoonhoven.	Cycling → Bicycle Sales ⁴⁵⁵	repair service ⁵⁶ bicycle ²⁸³⁸ part ⁵⁰⁴⁴ collection ⁷⁵⁶⁶ accessories ¹²⁹⁷⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
youngcreatief.nl	Young Creatief Reclamebureau	Young Creatief Reclamebureau is a creative advertising agency based in the Krimpenerwaard, Capelle aan den IJssel, and Gouda regions, specializing in signage and printing for businesses, organizations, and individuals.	Advertising → Outdoor Advertising ²⁵⁴ Visual Communication → Media Agencies ¹⁹⁹	advertising agency ¹⁰⁸ signage ⁸³⁸ print ⁵⁵¹¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
zvv-vhl.nl	Zvv VHL	The website of Zvv VHL provides information about the hall football association, its members, activities, and the opportunity to become a member or sponsor.	Football → Amateur Football ⁷⁵⁷ Football → Hall Football ⁶²	sponsorship ²⁶⁸⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² news ¹⁵²⁹³	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
zwaluwenlaan48.nl	Athome Makelaardij	This website presents an overview of properties for sale and sold.	Houses → Semi-Detached Houses ⁷⁵¹ Apartment Living → For Sale ¹⁰⁰⁷	status ⁶³ type ³¹⁰ address ⁹⁰¹ property ⁷⁴⁰⁶	Voorne aan Zee → Brielle ⁶¹³
zwangerinbeeld.nl	Zwanger in Beeld	The website ‘Zwanger in Beeld’ offers a unique service: the creation of 3D images of pregnant women through digital scans. This serves as a lasting, personal keepsake of the pregnancy.	Health → Pregnancy & Childbirth ⁴²²²	scan ⁷⁹⁰ image ²⁶⁰⁵ appointment ¹³⁵¹⁰	Utrecht Hill Ridge → Amerongen ³¹²
zz-people.nl	ZZ People B.V.	ZZPeople is a service provider specializing in placing production and logistics personnel, agricultural and green personnel, groundwork specialists, and cleaners, primarily for construction and industrial business owners.	Land Development & Earthworks → Earthmoving ⁶⁴³	business owner ⁶⁰ personnel ¹⁰⁸⁴ assignment ¹¹²¹ communication ¹⁰¹⁶² network ¹¹¹²³	Krimpenerwaard → Bergambacht ³⁰³
deouwestal.nl	The Ouwe Stal	The Ouwe Stal in Haastrecht is an event location that hosts dinners, lunches, parties, and weddings in a peaceful polder environment.	Equestrian → Stables ⁶²⁹ Landscape → Polders ²¹²	polder ⁴⁷⁶ stable ⁷⁶⁸ wedding ⁴²⁵⁸ terrace ⁴⁸⁴⁷ party ⁵⁹²⁸ restaurant ¹¹²¹⁵	Krimpenerwaard → Haastrecht ¹⁹³
werkenbijevs.nl	EVS Infrabouw	The website of EVS Infrabouw presents open positions and provides information about the organization and its activities, primarily focused on infrastructure projects in South Holland and Zeeland.	Civil & Infrastructure → Infrastructure Projects ¹³¹ Human Resources → Job Openings ³³	work environment ²⁹⁵ position ⁸⁷⁵ infrastructure ¹⁴⁶⁰ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
iphonereparatiekrimpenerwaard.nl	iPhone Reparatie Krimpenerwaard	The website provides iPhone and tablet repair services in the Krimpenerwaard region.	Computer → Computer Repair ⁸⁹⁸ Repair → Mobile Phone Repair ¹⁰¹²	ipad ⁴⁰⁴ iphone ⁶⁶² device ⁶⁹⁸ screen ¹⁴³⁸ battery ¹⁷⁵¹ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
schoonhoven-stadswandeling.nl	Stadsavonturen	The website offers guided city walks in Schoonhoven, Zutphen and Breda.	Walking → City Walks ⁸⁰ Tourism → City Tours ⁴⁶⁸	city walk ¹³⁰ guide ¹³⁶⁴ history ⁷²⁸⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stichtevents.nl	Sticht Events	Sticht Events is a catering company that provides mobile fry trucks for various occasions, including parties and larger events.	Catering → Mobile Catering ⁸⁷	fry truck ³⁸ guest ¹³³⁴ drink ⁵¹⁹¹ package ⁶¹¹² event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
123schroefpaal.nl	123schroefpaal.nl	The website 123schroefpaal.nl specializes in the installation of vibration-free screw piles for steel foundations, focusing on fast installation and a customer-oriented approach.	Construction Technology → Foundation Technology ¹³⁵ Building & Construction → Sustainable Building Materials ¹¹	machine ³⁷²⁷ foundation ⁶⁶⁷⁸ installation ¹³⁷⁴²	Krimpenerwaard → Haastrecht ¹⁹³
hoogstraat63b.nl	AThome Makelaardij	This website offers information for sale about a property in Nieuwpoort, Netherlands, including detailed descriptions and contact details.	Apartment Living → Maisonette ¹⁰¹ Apartment Living → For Sale ¹⁰⁰⁷	balcony ⁸⁴⁶ living room ¹³²⁵ storage ²⁴⁴⁶ building ³²⁰⁴ apartment ⁵⁰⁸⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
smartphonereparatiezuidplas.nl	Smartphone Repair Zuidplas	Smartphone Repair Zuidplas provides professional smartphone and tablet repair services in the Zuidplas region.	Repair → Mobile Phone Repair ¹⁰¹²	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Zuidplas → Moerkapelle ²¹³
smartphonereparatieteylingen.nl	Smartphone Repair Teylingen	The website Smartphone Repair Teylingen offers professional repair services for smartphones and tablets, with locations in Teylingen, Sassenheim, Voorhout, and Warmond, and further in South Holland. The goal is to make scheduling repairs easy.	Mobile Phones → Smartphone Repair ⁷⁹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Teylingen → Sassenheim ⁵⁹⁹
smartphonereparatielansingerland.nl	Smartphone Repair Lansingerland	The website Smartphone Repair Lansingerland provides professional repair services for smartphones and tablets, with locations in Lansingerland and surrounding areas, and expanding its services to other locations in South Holland.	Repair → Mobile Phone Repair ¹⁰¹²	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Lansingerland → Bergschenhoek ⁵⁶⁸
smartphonereparatieleidschendamvoorburg.nl	Smartphone Repair Leidschendam-Voorburg	The website Smartphone Repair Leidschendam-Voorburg offers professional smartphone and tablet repair services in the Leidschendam-Voorburg region, with locations in Leidschendam and Voorburg.	Mobile Phones → Smartphone Repair ⁷⁹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
smartphonereparatiezwijndrecht.nl	Smartphone Repair Zwijndrecht	The website offers smartphone and tablet repair services in Zwijndrecht and surrounding areas.	Mobile Phones → Smartphone Repair ⁷⁹	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
smartphonereparatiepijnackernootdorp.nl	Smartphone Repair Pijnacker-Nootdorp	The website Smartphone Repair Pijnacker-Nootdorp provides professional smartphone and tablet repair services in the Pijnacker-Nootdorp region and beyond.	Computer → Computer Repair ⁸⁹⁸ Repair → Electronics Repair ⁷⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
smartphonereparatiewestland.nl	Smartphone Repair Westland	The website Smartphone Repair Westland offers professional smartphone and tablet repair services, with locations in the Westland region and beyond.	Technology → Electronics & Components ¹¹²⁶¹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Westland → Monster ³⁶⁰
smartphonereparatiegoereeoverflakkee.nl	Smartphone Repair Goeree-Overflakkee	The website provides smartphone and tablet repair services in and around Goeree-Overflakkee.	Mobile Phones → Smartphone Repair ⁷⁹ Repair → Mobile Phone Repair ¹⁰¹²	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Goeree-Overflakkee → Ooltgensplaat ⁸³
smartphonereparatiebodegravenreeuwijk.nl	Smartphone Repair Bodegraven-Reeuwijk	The website Smartphone Repair Bodegraven-Reeuwijk provides professional repair services for smartphones and tablets, with a focus on the Bodegraven-Reeuwijk region and surrounding areas in South Holland.	Repair → Mobile Phone Repair ¹⁰¹² Electronics & Components → Mobile Phones ¹¹⁸⁶	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
smartphonereparatiekrimpenerwaard.nl	Smartphone Repair Krimpenerwaard	The website Smartphone Repair Krimpenerwaard offers professional repair services for smartphones and tablets, with locations in Krimpenerwaard and surrounding areas. The goal is to be a reliable and specialist provider for smartphone and tablet repairs in the region.	Electronics & Components → Mobile Phones ¹¹⁸⁶ Electronics & Components → Tablets ¹⁹¹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
smartphonereparatiegorinchem.nl	Smartphone Repair Gorinchem	The website provides smartphone and tablet repair services in and around Gorinchem, with locations in South Holland.	Repair → Mobile Phone Repair ¹⁰¹² Technology → Electronics & Components ¹¹²⁶¹	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
gebrdegier.nl	Tuinbouwbedrijf Gebr. de Gier	Tuinbouwbedrijf Gebr. de Gier is a family farm that has been producing and selling vegetable plants and strawberries since 1925.	Plants → Nurseries ¹⁰¹² Produce & Vegetables → Fruit ⁸⁰¹	vending machine ¹²⁷ strawberries ¹⁷² online shop ¹³¹⁰	Alkmaar → Oudorp ³⁴⁵
vandergraafservices.nl	Van der Graaf's Services	Van der Graaf's Services is an experienced automotive mechanic who rents his services to garages for repairs on passenger cars and trucks.	Property Rentals → Rental ¹¹⁶⁹ Repair → Garage ¹⁷⁷⁹	mechanic ²⁸² garage ¹²¹⁰ vehicle ³⁷⁴³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
halogroup.nl	H@lo	The website of H@lo offers awareness and training programs aimed at developing skills and promoting sustainable learning.	Personal Development → Guidance ⁷⁸¹ Digital Media & Design → Digital Transformation ⁹⁵⁴	gamification ⁷⁴ co-creation ¹³⁴ learning ⁹²⁰ skills ¹¹⁰⁵ awareness ¹⁷³⁵ training ²⁸¹³³	Krimpenerwaard → Haastrecht ¹⁹³
beverboxen.nl	FinAmi B.V.	BeverBoxen.nl is a website offering garage boxes for rent in Lekkerkerk, Netherlands.	Temporary & Specialized Property → Garage Boxes ²⁴	garage box ¹³⁸ administrator ¹⁶¹ complex ⁵⁶⁸ rent ⁹⁸¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
goudsmederijmadeira.nl	Goudsmederij Madeira	Goudsmederij Madeira’s website provides information about their workshop, services, and contact details.	Jewelry → Goldsmiths ³¹⁹	silver ⁴⁷⁹ gold ⁸⁰⁵ jewelry ⁴⁵⁹⁹ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stolliesite.nl	Website owner	The Stolliesite website is a genealogical platform documenting the history and images of the Stolwijk and Rodenburg families, made available online.	Personal → Webpages ⁴³ Social Sciences → Genealogy & Family History ¹⁴⁰³	image ²⁶⁰⁵ family ⁶⁴⁶² history ⁷²⁸⁶	Bodegraven-Reeuwijk → Bodegraven ⁷⁴⁹
voordelige-rolcontainer.nl	Reijmgroep B.V.	The website Voordelige Rolcontainer offers affordable roll-on roll-off containers for business waste, with a focus on environmentally friendly processing and a wide range of container formats and frequencies.	Environment → Waste Management ²⁶⁸⁰	roll-on roll-off container ¹¹ container ¹⁷⁰⁹	Zuidplas → Moerkapelle ²¹³
muddetuinen.nl	Mudde Tuinen	The website ‘Mudde Tuinen’ presents the history and current activities of a nursery that has been active in the Lekkerkerk region since 1875, with a focus on sustainable garden design, landscaping, and maintenance.	Plants → Perennials ⁸⁰ Plants → Nurseries ¹⁰¹²	nursery ⁹²⁶ plant ⁴⁵⁰⁹ rental ⁷²⁵⁷ garden ¹³¹²⁹ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
danimc.nl	Dani Marketing & Communicatie	Dani Marketing & Communicatie is a marketing and communication agency that helps businesses establish a strong online presence and reach their target audience.	Business Development → Marketing Strategy ¹⁰⁰¹ Technology & Tools → Marketing Tools ⁸⁷	social media marketing ⁷⁹ email marketing ²¹⁰ marketingstrategy ²⁹²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
lerenenopleiden.nl	Advies, Leren En Opleiden	The website Advies, Leren En Opleiden provides training and consulting services to organizations, teams, employees, and leaders, aiming to improve business results and develop individual competencies.	Training → Corporate Training ¹³³¹ Human Resources → Employee Development ⁷⁶²	competency ²²⁸ employee ⁴⁴²⁹ goal ⁴⁹⁷⁴ training ²⁸¹³³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bobinterieurbouw.nl	BOB Interieurbouw	BOB Interieurbouw is an interior design and furniture maker offering custom solutions.	Storage → Cabinets ⁶¹²	cabinet ¹⁷³⁰ restoration ³⁴¹⁷ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
starlightmusicservice.nl	Starlight Music Service	Starlight Music Service is a company that provides professional sound, lighting, and drive-in shows for various events and parties.	Events & Venues → DJs ¹⁰⁰¹ Electronics & Components → Audio ²³⁵¹	sound ¹⁶⁴⁹ light ⁵¹⁴⁸ rental ⁷²⁵⁷ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
groenbedrijfverhoeve.nl	Groenbedrijf Verhoeve	Groenbedrijf Verhoeve is a landscaper offering garden maintenance, landscaping and renovation services in Stolwijk.	Outdoor & Garden → Landscape Companies ³³⁹	lawn ⁴²⁷ pruning ⁴⁹³ garden ¹³¹²⁹ design ²⁷²⁰²	Krimpenerwaard → Stolwijk ²³²
tonvandijksloopservice.nl	Ton van Dijk Sloopservice	Ton van Dijk Sloopservice is a demolition company based in Haastrecht specializing in various demolition tasks.	Building & Materials → Demolition Services ³¹⁷	demolition ¹¹⁴⁴ planning ¹⁹⁶⁹ building ³²⁰⁴ equipment ⁴¹⁴³	Krimpenerwaard → Haastrecht ¹⁹³
ceritransport.nl	Ceri Transport	Ceri Transport in Bergambacht is a transportation company specializing in the transport of hazardous materials and related services.	Specialized Transport → Tank Transport ³⁰	tank container ¹⁷ hazardous materials ²² germany ¹⁸⁵ certification ³³⁸⁰ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
snackbar-denuyl.nl	Snackbar Den Uyl	The website of Snackbar Den Uyl Bergambacht provides the opportunity to order food online for takeaway or delivery, including a menu and customer reviews.	Fast Food → Fries ⁹⁴⁹	fries ²⁷⁵³ snack ²⁹¹⁶ reviews ³¹⁷² sandwich ⁴⁰⁹⁸ menu ¹³⁸⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
lionbouw.nl	Lion Bouw	The website of Lion Bouw showcases the services of a construction and renovation contractor specializing in various projects, with a focus on private and business tasks.	Construction Companies → Additions ⁴⁵⁸ Renovation → Bathroom Renovation ⁸³⁴	frames ²⁵⁵⁶ roof ³⁶⁶² construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	Krimpenerwaard → Haastrecht ¹⁹³
multimeubelservice.nl	Multi Meubel Service	Multi Meubel Service is a furniture upholstery shop based in Lekkerkerk, Netherlands, specializing in repairing and reupholstering furniture.	Fabrics → Upholstery Fabrics ³¹ Repair → Furniture Repair ²⁵⁹	upholstery ⁶⁷³ fabric ¹⁶⁴⁴ furniture ⁸⁷⁵¹ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Lekkerkerk ²⁴⁴
zwanenpartners.nl	Van der Zwan and partners	Van der Zwan and Partners is a tax and administrative advisory firm serving the Schoonhoven region.	Taxation → VAT ²⁶⁶ Accounting → Bookkeeping ¹²³⁰	filings ³² financial statement ³²¹ tax advice ¹⁵²² administration ⁶⁵⁸⁷	Krimpenerwaard → Bergambacht ³⁰³
hermanmets.nl	Herman Mets	The website of Herman Mets offers services as a sports massage and relaxation massage therapist, focusing on treating muscle complaints, injury prevention, and promoting the body's self-healing capabilities.	Physiotherapy → Sports Physiotherapy ⁷⁴⁷ Massage → Sports Massage ⁶⁴¹	injury prevention ³⁴ muscle ⁴⁹⁸ massage ⁷⁶⁴⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
ankeamoakerboom.nl	Artist	This website presents a retrospective exhibition of jewelry and objects by a maker focusing on beauty, harmony, and contrast, and exploring themes of nature and environmental preservation.	Galleries & Exhibitions → Exhibitions ¹⁰⁸³	shape ¹⁷⁶ jewelry ⁴⁵⁹⁹ exhibition ⁵³³² nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vermeulenmetaaltechniek.nl	Vermeulen Metaaltechniek B.V.	Vermeulen Metaaltechniek is a Dutch manufacturer specializing in the production of bolts, nuts, and anchoring systems for foundation and fastening techniques.	Construction Technology → Foundation Technology ¹³⁵ Maintenance & Repair → Industrial Maintenance ⁷³²	foundation techniques ¹² machine factory ²⁹ bolts ⁶⁹ nuts ⁴¹⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
adriaanmeerkerk.nl	Meerkerk Melkvee Zorg en Loonbedrijf	Meerkerk Melkvee Zorg en Loonbedrijf is a family business that combines dairy farming, agricultural services, and a care farm.	Livestock → Dairy Farming ⁶⁷¹ Community → Social Issues & Welfare ²⁸¹⁵⁹	agricultural services ³⁸ dairy farm ¹²⁹ day activities ¹³⁷ earthmoving ²³³ care farm ²⁴⁶ cow ⁵⁹⁶	Krimpenerwaard → Bergambacht ³⁰³
hetnieuwejasje.nl	Schildersbedrijf Het Nieuwe Jasje	Schildersbedrijf Het Nieuwe Jasje from Stolwijk offers painting, wallpapering and repair services for homes and businesses.	Woodworking → Wood Rot Repair ⁹⁴	color advice ²⁷⁶ wall ¹³⁷⁸ wallpaper ¹⁷⁵⁶ frames ²⁵⁵⁶ paint ⁸⁷⁴⁷	Krimpenerwaard → Stolwijk ²³²
tinyskinsalon.nl	Tiny Skin Salon	Tiny Skin Salon is a beauty salon specializing in skin care and skin improvement located in the Krimpenerwaard, Ouderkerk aan den IJssel, emphasizing personalized and relaxing treatments.	Dermatology → Skin Therapy ⁶⁶¹	microneedling ¹⁹³ skin ²⁵¹⁸ salon ⁵⁵⁴¹ massage ⁷⁶⁴⁶ treatment ²¹²⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
jhdistributie.nl	JH Distributie	JH Distributie is a distribution company that provides local newspaper distribution services in the Krimpenerwaard region.	Marketing → Direct Mail & Distribution ²⁸⁶ Local News → Municipal News ¹⁵³	printed materials ¹⁷ district ³⁷¹ newspaper ³⁹⁶	Krimpenerwaard → Bergambacht ³⁰³
jacolien-edelsmid.nl	Jacolien Edelsmid	The website of Jacolien Edelsmid showcases handcrafted, personalized jewelry created on commission and designed to convey a message or commemorate anniversaries.	Jewelry → Handmade Jewelry ⁸⁶² Marketing → Creative & Design Services ⁴⁹³⁸	anniversary ⁶⁷⁰ atelier ¹⁴¹⁷ jewelry ⁴⁵⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ansichtopnederland.nl	ansichtopnederland.nl	The website provides an overview of places in the Netherlands.	Context ¹⁶¹³⁹⁴	place ²⁴² province ⁵¹⁸ region ⁵⁴¹²	Hollands Kroon → Barsingerhorn ⁴⁰
souvenirs-vandermeulen.nl	Souvenirs van der Meulen vof	The Souvenirs van der Meulen vof website is a wholesaler that supplies Dutch souvenirs.	Specialty Shops → Souvenirs ¹⁹³ Commerce → Gift Industry ³²	teacup ¹⁷ keychain ¹⁷² souvenir ¹⁷⁵ jewelry ⁴⁵⁹⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kwog.nl	Kruiswijk Woudenberg Verhuur	The website of Kruiswijk Woudenberg Verhuur presents a rental offer for residential and commercial spaces in various locations, including Schoonhoven, Bergambacht and Gouda, and provides information on project development and investment in real estate.	Rental Properties → Student Housing ¹⁸² Commercial Property → Commercial Space ⁴⁸⁹	business hall ²³ student housing ³⁴ garage box ¹³⁸ commercial space ²⁴⁵ apartment ⁵⁰⁸⁸	Krimpenerwaard → Bergambacht ³⁰³
rstotaalservice.nl	RS Totaal Service	RS Totaal Service is a sun shading expert based in the Stolwijk and Gouda region, offering sun shading solutions.	Windows & Doors → Windows ²⁹⁹⁹ Interior → Doors ¹²⁹⁷	glass sliding wall ³² terrace canopy ⁵⁶ sun shading ⁸³⁵ aluminum ¹¹⁹⁷ screen ¹⁴³⁸	Krimpenerwaard → Stolwijk ²³²
rotterdam-witgoedservice.nl	Witgoedservice Rotterdam	The website, Witgoedservice Rotterdam, provides appliance repair and installation services in Rotterdam and surrounding areas, offering a diagnosis for € 69.95 with a three-month warranty.	Household Appliances → Appliance Repair ²²⁴	appliance ⁹⁵⁶ diagnosis ¹⁴⁹⁰ warranty ⁴⁷⁰¹ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Lansingerland → Bergschenhoek ⁵⁶⁸
giga-twin.nl	Giga-Twin	The Giga-Twin website serves as an information source and a virtual introduction to the company, which specializes in the repair of motorcycles.	Repair → Motorcycle Repair ¹⁷²	motorcycle ²¹¹⁰ opening hours ²⁹⁵³ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
apotheyoga.nl	Studio 3	The website presents Yin Yoga and the services of Studio 3 in Schoonhoven, providing information about the studio location, the instructor, and the content of the classes.	Yoga → Yin Yoga ¹¹³	yin yoga ¹²⁷ class ²⁰⁷⁶ body ³⁴⁹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
taxivanutrechtnaar.nl	Taxi van Utrecht naar	Taxi van Utrecht naar is a taxi service providing transportation within and around Utrecht.	Public Transportation → Regional Transportation ⁹² Taxi & Ride Services → Airport Transportation ³⁶⁵	ride ¹⁰⁷⁵ driver ¹⁸³² taxi ²⁰⁹⁰ destination ²⁵⁸⁰ rate ²⁶⁰⁶ book ¹¹³⁹⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
bergenopzoom-elektricien.nl	RV Elektra	The website of RV Elektra is an online platform offering electrical services in Bergen Op Zoom and surrounding areas, with a focus on electrical panels, installations, inspections, and sustainable energy solutions.	Building → Electrical Systems ¹⁹² Energy → Renewable Energy ¹²⁶⁷	electrical panel ¹⁵³ electrician ⁸¹⁹ inspection ⁴²⁷⁹ quote ¹²⁸⁶³ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
csi-cleaning.nl	Cleaning Solutions International B.V.	CSI-Cleaning is a specialist cleaning company offering a range of facilities services.	Homeownership & Management → Homeowners Associations ⁵⁴⁶ Maintenance & Repair → Facility Services ⁶⁷¹	restroom ³⁰ facility ²⁶¹⁶ cleaning ⁴⁵⁶⁷ floor ⁴⁷⁸¹	Krimpenerwaard → Gouderak ¹⁰³
deurdijk.nl	DeurDijk	DeurDijk is a product designed to keep water out of doors, preventing water damage.	Crime & Safety → Disasters ³⁶ Household & Cleaning → Home Services ¹³²¹	rainfall ⁵² water damage ⁸⁴ neighbor ¹⁵⁸ household ³⁸²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
alleschoenenwinkels.nl	AlleSchoenenwinkels.nl	The website AlleSchoenenwinkels.nl provides an overview of all shoe stores in the Netherlands, including their opening hours, addresses and contact details.	Clothing & Accessories → Shoe Stores ⁴⁴¹	search function ²⁷³ map ⁸⁰¹ address ⁹⁰¹ shoes ²⁶⁹⁹ opening hours ²⁹⁵³	Krimpenerwaard → Bergambacht ³⁰³
shogendoorn.nl	S. Hogendoorn - Grondwerk	The website of S. Hogendoorn - Grondwerk presents the services of a company specializing in drainage, groundwork, and rental.	Land Development & Earthworks → Site Preparation ²³ Civil & Infrastructure → Road Construction ⁴⁸¹	garden design ⁹⁶⁴ drainage ¹³²² groundwork ¹³⁴⁸ paving ¹⁹⁴² light ⁵¹⁴⁸ rental ⁷²⁵⁷	Krimpenerwaard → Gouderak ¹⁰³
logopediepraktijkmoordrecht.nl	Logopediepraktijk Moordrecht	The website of Logopediepraktijk Moordrecht provides information about the practice, the logopedist, contact details, opening hours, and the offered logopedical services.	Childcare → Language Development ⁵⁷⁴ Education → Special Needs & Support ⁶³⁷²	logopedics ¹⁵² examination ⁴²⁹ speech ⁵³² language ²⁰¹⁶ registration ⁴³⁶⁶ treatment ²¹²⁰³	Zuidplas → Moordrecht ³³²
cijferfocus.nl	Cijferfocus	Cijferfocus provides financial services and administrative support to freelancers (ZZP), SMEs (MKB), and individuals in the Krimpenerwaard region.	Company & Business → Individuals ⁸²⁷	tax return ⁷⁸⁷ bookkeeping ¹³¹⁹ administration ⁶⁵⁸⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
stal-lammerts.nl	Stal Lammerts	Stal Lammerts is a horse breeding and sales company specializing in jumping horses.	Animal Husbandry → Horse Farms ¹⁷⁴ Apparel → Equestrian ²³¹⁹	jump ⁹² breed ¹⁷⁴⁴ horse ⁴³³⁷ video ⁶⁷¹⁴	Krimpenerwaard → Bergambacht ³⁰³
softijsdiscounter.nl	Softijsdiscounter.nl	Softijsdiscounter.nl is an online store selling premium ice cream powder mixes at discount prices. The website provides information about the products, shipping costs, and contact details.	Meal Solutions → Frozen Food ²⁵	factory ⁵²⁶ water ²⁵⁰¹ ship ⁵¹⁰³ brand ¹⁷⁷³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
kleingrondbezitsommelsdijk.nl	Klein Grondbezit Sommelsdijk	Kleingrondbezit Sommelsdijk is a cooperative organization that allows members to pursue their gardening hobby by renting land.	Gardening → Allotments ¹¹⁵ Gardening → Community Gardens ³⁹³	land ⁴⁷² shed ⁶³⁰ plot ¹⁰⁵¹ association ⁸⁵⁶² member ¹⁰¹⁵⁴ garden ¹³¹²⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
dacschoonhoven.nl	DAC Schoonhoven	The website of DAC Schoonhoven presents the care farm and its activities.	Farms & Farm Businesses → Care Farms ⁴⁷³ Events & Activities → Agricultural Activities ²⁵	care farm ²⁴⁶ sheep ²⁷⁴ farm ²⁶²² animal ²⁹⁰⁸ nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
zonnepaneleninkoopactie.nl	Zonnepaneleninkoopactie.nl	The website zonnepaneleninkoopactie.nl informs and facilitates residents and entrepreneurs in purchasing solar panels through municipal campaigns.	Energy → Energy Saving ¹¹⁵¹ Management & Consulting → Consultants ⁴⁴⁴	advisor ¹⁰⁵⁵ campaign ³⁴²⁸ registration ⁴³⁶⁶ solar panels ⁴⁷⁰¹ municipality ⁶⁸³⁷ energy ⁹⁰⁷⁵	Zwartewaterland → Hasselt ⁴⁹⁰
studiotekaat.nl	Studio te Kaat	The website of Studio te Kaat showcases a portfolio of infographics, illustrations, and visual communication, focusing on visualizing complex data and processes for various organizations and projects.	Graphic Design → Infographics ⁸⁵ Marketing → Creative & Design Services ⁴⁹³⁸	infographic ²⁸³ visualization ⁶²¹ illustration ²⁴⁴⁷ data ⁵⁸⁷² design ²⁷²⁰²	Sluis → Breskens ²⁹⁴
gmitgenberg.nl	G. Mitgenberg	The website of G. Mitgenberg total facade renovation provides an overview of the different steps involved in a complete facade renovation, including cleaning, stripping, pointing and impregnation.	Renovation → Facade Renovation ²⁷⁹	facade renovation ¹³⁰ strip ¹³³ impregnation ¹⁸⁷ point ²¹⁷ facade cleaning ³⁸⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
sb55biljart.nl	Stichting Welzijn Krimpenerwaard	The website of the Schoonhovense Biljartclub 55+ serves as an information source for members and potential members of the billiard club, as well as a platform for announcements and organizing activities.	Team → Billiards ³⁶⁵	billiard club ²³ billiard table ⁴³ seniors ⁹⁰⁴ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
robdebieautoschade.nl	Rob de Bie Autoschade	Rob de Bie Autoschade is an auto repair company specializing in damage repair and related services in Schoonhoven.	Auto Repair Services → Dent Repair ¹⁸⁶ Cleaning Services → Car Cleaning ¹³⁶	spotrepair ⁶⁷ headlight ⁸² damage repair ³²⁶ paint ⁸⁷⁴⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
ardejongmetaalbewerking.nl	A.R. de Jong Metaalbewerking B.V.	The website of A.R. de Jong Metaalbewerking B.V. showcases their services as a metalworking company specializing in the production of components for the concrete industry.	Metals & Fabrication → Metals ⁴⁸⁶ Building & Materials → Concrete Structures ²⁶⁸	grille ⁴² gutter ⁵⁵⁰ metalworking ⁵⁶⁵ frame ⁸⁸³ machine ³⁷²⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hansbrandkunst.nl	Hans Brand Kunst	The Hans Brand Kunst website showcases the artwork of artist Hans Brand, consisting of paintings, drawings, and photography, with a focus on landscapes and abstract interpretations.	Portraiture → Individual Photographers ²⁴ Painting → Individual Artists ⁶⁶⁸	abstract ¹⁰⁸ landscape ²⁶⁰⁹ paintings ³⁹⁰⁷ photography ⁹⁵⁰³	Krimpenerwaard → Lekkerkerk ²⁴⁴
streekschoonhoven.nl	Streek Schoonhoven	The website of Schilderclub Streek Schoonhoven provides information about the association of amateur artists, their activities, members, and contact details.	Hobbies → Creative Hobbies ⁴¹² Knowledge → Arts ³⁷⁷²⁵	free work ²⁰ atelier ¹⁴¹⁷ member ¹⁰¹⁵⁴ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
maraandewandel.nl	Mar Krimpen aan de Lek	This website documents Mar Krimpen aan de Lek's 2017 walk for the Nijmegen Vierdaagse, aiming to raise funds for the Krimpenerwaard Food Bank.	Humanitarian Organizations → Food Aid ¹⁴⁵ Social Organization → Charities ²⁴¹⁹	vierdaagse ²³ facebook ⁸⁵⁰ walk ²¹⁶¹ donation ⁵¹¹⁰ photo ⁷⁷⁷⁸ blog ¹³³⁹²	Gelderland → Nijmegen ⁹³⁸⁴
zwrc.nl	ZWRC	This website advertises the sale of 2-MMC (second milk mudding ship) in various locations across the Netherlands.	Logistics → Transportation ¹¹⁰² Marine & Watercraft → Shipping ⁶⁵⁴	2mmc ¹¹ province ⁵¹⁸ price ⁸³²⁸	Voorne aan Zee → Brielle ⁶¹³
klusbedrijfvreeswijk.nl	Klusbedrijf Vreeswijk	Klusbedrijf Vreeswijk is a company specializing in various construction and renovation projects, primarily in the Nieuwegein area.	Construction Companies → Additions ⁴⁵⁸ Renovation → Bathroom Renovation ⁸³⁴	bathroom ³⁷⁸⁴ construction ⁷⁴²¹ garden ¹³¹²⁹ renovation ¹³⁸⁴⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vandegriendschilders.nl	Van de Griend Schilderwerken	Van de Griend Schilderwerken is a painting company offering services in the areas of painting, glasswork, and wall finishing in the Schoonhoven and Gorinchem region.	Interior → Wall Coverings ⁴³⁵ Insulation → Glazing ¹⁸⁸	maintenance service ¹⁹ glasswork ¹⁶⁰ wall finishing ³¹⁰ paint ⁸⁷⁴⁷ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
verhuurminihijskraan.nl	R. Lekkerkerker Minihijskraan Verhuur	R. Lekkerkerker Minihijskraan Verhuur offers rental of compact mini-lifting cranes for construction projects and other applications.	Logistics → Lifting Equipment ²¹⁶ Building & Materials → Construction Machinery ⁷³⁰	operator ¹⁷⁰ lift ⁴⁴⁵ crane ⁶⁶² rental ⁷²⁵⁷	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
astotaalbouwmaatschappij.nl	A&S Totaalbouwmatschappij	The website of A&S Totaalbouwmatschappij presents the services of a construction company offering complete renovations and interior construction for individuals and businesses.	Architecture → Architectural Services ¹⁰⁰⁶ Events & Hospitality → Planning ⁶⁶³	testimonials ⁴¹⁶ permits ⁶⁴³ calculation ⁶⁵⁷ interior ⁸⁰⁹³ renovation ¹³⁸⁴⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hygienewerkt.nl	Hygiënewerkt	The website Hygiënewerkt offers products and solutions for hygiene, including disinfectants, cleaning agents, and dispensers, emphasizing sustainability and prevention.	Household Goods → Cleaning Supplies ⁶³³ Hygiene & Environmental Factors → Hygiene ¹³⁵	hand towel ¹² cleaning agent ¹⁴ toilet paper ⁴¹ disinfectant ⁶³ corona ⁸⁵ dispenser ¹⁸²	Krimpenerwaard → Lekkerkerk ²⁴⁴
vanbreukelenhoveniers.nl	van Breukelen Hoveniers	van Breukelen Hoveniers Schoonhoven is a landscaping company that provides garden design, landscaping, maintenance, and pergolas in Schoonhoven and surrounding areas.	Landscaping → Garden Installation ⁶¹⁷	pergola ⁴⁹² landscaping ¹⁵²⁹ fence ¹⁸¹⁴ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autorijschoolvanhemert.nl	Autorijschool van Hemert	Autorijschool van Hemert is an auto driving school based in Oud-Alblas offering driving lessons.	Transportation → Driving & Lessons ¹¹⁶³	cbr ¹⁷² volvo ²⁰⁵ driving instructor ²⁵² license ¹²⁸⁸ driving lessons ²⁴⁵³ lesson ⁵¹⁵⁴	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
installatiebedrijfvandenheuvel.nl	Installatiebedrijf Van den Heuvel	The website of Installatiebedrijf Van den Heuvel presents the company’s services, primarily focused on plumbing, air conditioning, heat pumps, roofing, and ventilation techniques, and offers the possibility to request a quote and contact the company.	Home Improvement → Plumbing ²⁷³³ Installation & Mounting → Installers ¹⁰⁰⁷	quote request ⁵⁴ plumbing ¹⁷⁶¹ air conditioning ²¹⁷⁸ heat pump ²⁵⁴¹ roofing ²⁸⁰⁶	Krimpenerwaard → Schoonhoven ⁵⁴⁴
woneninammerstol.nl	Developer	This website provides information about three new, sustainable, and affordable homes being built in Ammerstol on the Willem van Lutterveldstraat, targeting one- and two-person households.	Living → Sustainable Living ⁸¹⁷	affordability ²² storage room ⁶⁹ brochure ¹⁶⁴² home ⁷⁹⁷⁶ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Ammerstol ⁴⁹
senalparfums.nl	Senal Parfums	The website Senal Parfums is an online shop offering a variety of fragrances, including men's, women's, unisex, and home scents, as well as car perfumes. It features Eau de Parfum in various sizes.	Fashion → Fragrances ⁵⁹⁸	scent ³³³ fragrance ³⁹⁵ online shop ¹³¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
doggyrette.nl	Dé Trimsalon in the Krimperwaard	Dé Trimsalon in the Krimperwaard offers professional grooming services for dogs, cats, and rabbits.	Dog Care → Grooming Salons ⁶⁵¹	grooming ⁸⁹⁶ animal ²⁹⁰⁸ horse ⁴³³⁷ dog ⁵⁴⁸³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
lagendijkautos.nl	Lagendijk Auto’s	Lagendijk Auto’s is an automotive dealership specializing in the sale of used cars, including passenger and commercial vehicles.	Used Cars → German Brands ⁶²	dealership ²⁹² vehicle ³⁷⁴³ car ¹⁰⁸⁶⁵ brand ¹⁷⁷³⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
ladunyamode.nl	LaDunya Mode	LaDunya Mode is a webshop offering current fashion trends.	Clothing → Sweaters ¹⁰⁷	sweater ⁴¹³ jewelry ⁴⁵⁹⁹ sale ⁵⁹³⁰ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵
remij.nl	Remij b.v.	Remij is a company specializing in the reuse of waste materials and the creation of new valuable materials within a circular economy.	Sustainable Construction → Circular Construction ⁸⁰ Building & Materials → Demolition ⁶⁸⁷	waste material ³⁴ reuse ¹⁰⁰ demolition ¹¹⁴⁴	Krimpenerwaard → Bergambacht ³⁰³
verdooldblog.nl	Verdoold Makelaars	Verdoold Makelaars is a real estate agency offering services including residential, mortgage, and business brokerage.	Property Sales → Buying a House ⁸⁷² Financial Services → Insurance Advice ²⁵⁵	agency ⁹⁴⁴ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹	South-Holland → Krimpen aan den IJssel ⁶⁵⁴
dkrglasvezelbeheer.nl	DKR Glasvezelbeheer	The website of DKR Glasvezelbeheer provides information about the installation of fiber optic connections in the Krimpenerwaard region, specifically targeting ‘outskirts’ areas overlooked by major internet providers.	Internet → Fiber Optic Internet ¹⁰⁰ Civil & Infrastructure → Infrastructure ¹⁰³³	business premises ¹⁸⁸ fiber optic ²⁷⁹ internet ¹⁶⁷⁸ region ⁵⁴¹² installation ¹³⁷⁴² collaboration ¹⁶⁰³⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
matrixpraktijk.nl	Matrixpraktijk Krimpenerwaard	Matrixpraktijk Krimpenerwaard provides coaching and counseling services for both young people and adults in the Krimpenerwaard region.	Self-Help → Mindset ¹⁵⁰ Walking → Walking Coaching ¹⁸⁹	thoughts ⁴⁴⁴ counseling ⁷⁴¹ peace ¹¹¹³ emotion ²¹⁶⁹ complaint ⁶⁴⁷⁹ coach ²⁵⁸¹⁰
greenfieldmakelaardij.nl	Greenfield Makelaardij	Greenfield Makelaardij & Bouwconsultancy is a real estate agency and construction consultancy based in Schoonhoven, specializing in the purchase, sale, rental, new construction, and renovation of properties, and offering a complete service with a focus on client support.	Real Estate → Intangible Services ⁵⁵ Real Estate & Investment → Real Estate ²¹⁴⁷¹	new construction ²⁶⁷² mortgage ⁴⁵⁶⁴ sale ⁵⁹³⁰ property ⁷⁴⁰⁶ renovation ¹³⁸⁴⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
blauwlichten.nl	blauwlichten.nl	This website presents a list of fire departments (Brandweerkorpsen) in the Netherlands.	Emergency Services → Fire Department ¹³⁸	netherlands ¹³⁷⁶	Hof van Twente → Diepenheim ²⁰⁰
nagelstudiobijcaroline.nl	Caroline – Nail Studio	The website of ‘Bij Caroline – Nail Studio’ is an online platform for a nail studio that focuses on personalized attention, advice, and high-quality nail treatments in Krimpen aan de IJssel.	Health → Cosmetics & Aesthetic ⁴⁵⁷⁹	nail studio ²⁵¹ gel polish ³⁸⁶ nails ¹⁷¹⁹ pedicure ²¹⁹⁶ massage ⁷⁶⁴⁶ appointment ¹³⁵¹⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
jcdekkertimmerwerk.nl	J.C. Dekker Timmerwerk	J.C. Dekker Timmerwerk is a timber company that offers a variety of carpentry services, from minor repairs to complete renovations.	Garden → Garden Houses ³⁵⁵ Outdoor Living → Pergolas ²⁵³	dormer ⁹⁹ pergola ⁴⁹² shed ⁶³⁰ extension ¹⁹⁴¹ carpentry ²²¹⁸ interior ⁸⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
reparatie-centrale-rotterdam.nl	Reparatiecentrale Rotterdam	Reparatiecentrale Rotterdam offers direct appliance repair services with a guarantee to customers in the Rotterdam area.	Repair → Washing Machine Repair ²⁹	dishwasher ³²⁴ refrigerator ⁴⁷⁵ washing machine ⁴⁸⁷ appliance ⁹⁵⁶ warranty ⁴⁷⁰¹ repair ¹⁴⁵⁷⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
jeugd-toernooi.nl	Stichting Jeugdtoernooien v.v. Dilettant	The website of Stichting Jeugdtoernooien v.v. Dilettant presents the youth tournament organized by Dilettant football club on June 15, 2024, in Krimpen aan de Lek.	Football → Youth Football ²⁰² Context → Community ⁵⁷⁴¹⁰	trophy ¹⁴⁵ participant ¹⁹³⁴ tournament ²⁴⁷⁶ registration ⁴³⁶⁶ association ⁸⁵⁶²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
bijunive.nl	Univé	The website of Univé Netwerk presents a cooperative network of over one hundred local Univé communities across the Netherlands. It highlights the relationship between these communities and their members, emphasizing security and opportunities in life.	Sustainability → Cooperatives ⁹⁷⁰	cooperative ⁶⁴⁹ member ¹⁰¹⁵⁴ network ¹¹¹²³	Amsterdam → North ⁶⁵⁷
reijmgroenontwerp.nl	Reijm groenontwerp en advies	Reijm groenontwerp en advies is a company specializing in garden design and providing advice.	Financial Services → Advice ¹⁰⁰³	green ⁸⁸⁹ landscape ²⁶⁰⁹ garden ¹³¹²⁹ design ²⁷²⁰²	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
bertan.nl	Bertan Veldhuijzen van Zanten	The website showcases travel experiences and photos of Bertan Veldhuijzen van Zanten, primarily related to his travels and his dog, Sam.	Vacations → Nature Travel ¹⁸⁶ SpecificDestinations → Caribbean Islands ⁴⁴²	sam ¹⁹ mustang ²³ tuscany ⁷⁰ dog ⁵⁴⁸³ travel ⁷²¹⁰ nature ⁹⁰⁹⁴	Krimpenerwaard → Stolwijk ²³²
peethoogendoornkaas.nl	Peet Hoogendoorn Kaas	The Peet Hoogendoorn Kaas website showcases a family-run cheese business with over 150 years of history. The website offers a variety of cheeses, including renowned brands and regional cheeses, through various channels such as markets, a country store, and online ordering.	Dairy → Cheese ⁵³⁰	cheese ¹²⁰⁵ market ²⁷⁷² production ⁴⁵⁸²	Krimpenerwaard → Bergambacht ³⁰³
salonrebecca.nl	Salon Rebecca	The website of Salon Rebecca is an online platform for a beauty and medical pedicure salon located in South Holland. It serves to inform clients about the salon, book appointments, and offer their services.	Websites → Local Businesses ⁸⁵	beauty ⁶⁸⁴ foot ¹⁹²⁹ pedicure ²¹⁹⁶ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
coachinghappysoul.nl	Coaching Happy Soul	Coaching Happy Soul offers coaching services aimed at motivating and encouraging clients to regain control over their autonomy.	Care → Personal Care ⁵⁹² Administrative Support → Family Businesses ⁶⁶⁴	autonomy ¹⁵⁵ motivation ⁸⁹⁴ inspiration ⁴⁰⁸¹ coach ²⁵⁸¹⁰	Krimpenerwaard → Haastrecht ¹⁹³
joyworshipband.nl	Joy!	The website of Joy! presents this musical band that, driven by a passion for God and music, performs at various occasions, including church services, events, and weddings.	Church & Religious → Gospel Music ³¹ Religious & Spiritual → Religious Events ¹³¹	crowdfunding ²⁴⁶ band ²⁹⁷⁷ church ³⁴³⁹ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
rlzonwering.nl	RL Zonwering & Markiezen	The website RL Zonwering & Markiezen offers a wide range of sun shading products and services, including awnings, screens, shutters, and indoor sun shading, with a focus on quality and personalized service.	Windows → Shutters ²⁸¹ Garden → Sun Shading ⁵⁶⁸	terrace coverings ²¹ blinds ⁴⁴⁶ awning ⁵⁴⁶ shutters ⁶⁴⁵ sun shading ⁸³⁵ screen ¹⁴³⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
eshmine.nl	Eshmine	Eshmine is an online shop that sells authentic, handcrafted, and fashionable handmade clothing.	Fashion → Sustainable Fashion ⁶⁴	handmade ²⁷⁰ fashion ²²¹² shop ⁶⁴⁸³ order ⁶⁹¹² collection ⁷⁵⁶⁶ accessories ¹²⁹⁷⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
desfeermakelaar.nl	de Sfeermakelaar	De Sfeermakelaar is a company that provides professional arrangements for parties and events, including weddings and corporate events, and supplies DJs, shows, and sound equipment.	Events & Venues → DJs ¹⁰⁰¹ Weddings → Wedding Planning ⁶⁷⁷	show ¹³⁹¹ sound ¹⁶⁴⁹ dj ¹⁷²² wedding ⁴²⁵⁸ party ⁵⁹²⁸ event ⁴⁵¹⁹⁹	North-Holland → Amsterdam ⁴¹²⁵³
mourikassurantien.nl	Mourik Assurantiën, Administraties, Adviezen & Belastingen	Mourik Assurantiën, Administraties, Adviezen & Belastingen is a firm that offers a range of financial services to individuals and businesses.	Governance → Law ¹⁴¹³³ Financial Services → Entrepreneur Advice ⁶²	taxes ⁵⁰⁰ bookkeeping ¹³¹⁹ insurance ⁶³⁵⁹ administration ⁶⁵⁸⁷	Krimpenerwaard → Bergambacht ³⁰³
doomic.nl	Micha	The website is a personal digital portfolio of Micha containing his school results, work experience, projects, and CV. It provides an overview of his background and interests.	Business Software → Online Tools ³⁹⁶ Higher Learning → Higher Professional Education ²¹	background ¹²⁴ cv ⁵¹⁶ portfolio ⁶⁸⁵⁴ software ⁸²⁹¹ education ¹³⁴⁷¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
degoudenlinde.nl	Atelier De Gouden Linde	The website of Atelier De Gouden Linde describes the restoration of antique and gilded picture and mirror frames for private individuals.	Visual Arts → Framing ¹³⁹	gilding ²⁰ picture frames ²⁷ frames ²⁵⁵⁶ restoration ³⁴¹⁷ workshop ¹⁹³²⁵	South-Holland → The Hague ¹⁹⁸⁹⁸
atelier-henk-konstapel.nl	Atelier Henk Konstapel	The website of Atelier Henk Konstapel showcases the artwork of the artist, consisting of sculptures, jewelry, and glass objects, along with information about exhibitions and the creative process.	Visual Arts → Sculptors ²⁰³ Decorative Arts & Crafts → Glass Art ¹²⁸	glass fusing ⁴⁵ sculpting ¹⁷¹ stone ⁷²⁴ sculpture ¹⁴⁴⁰ jewelry ⁴⁵⁹⁹ exhibition ⁵³³²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
corinebaarda.nl	Corine Baarda sieraden	The website of Corine Baarda sieraden showcases her work as a goldsmith and jewelry designer, as well as her courses and workshops in jewelry making.	Jewelry → Goldsmiths ³¹⁹	braille ¹² goldsmith ²²⁴ ring ⁸⁰⁰ jewelry ⁴⁵⁹⁹ workshop ¹⁹³²⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
deleuksteuitjesvannederland.nl	deleuksteuitjesvannederland.nl	The website provides an overview of fun outings in the Netherlands, such as company parties, bachelor parties, and team-building events.	Outings → Regional Outings ³⁰ Corporate Events → Corporate Outings ⁸⁷⁸	outing ⁹⁸² city ¹⁸⁷⁵ event ⁴⁵¹⁹⁹	The Hague → Scheveningen ¹⁶²⁵
loodgieterschoonhoven.nl	Loodgietersbedrijf Pompe V.O.F.	Loodgieter Pompe Schoonhoven is a plumbing company based in Schoonhoven that offers a wide range of plumbing services.	Home Improvement → Plumbing ²⁷³³	central heating ¹⁹⁰ plumbing ¹⁷⁶¹ roofing ²⁸⁰⁶ bathroom ³⁷⁸⁴ solar panels ⁴⁷⁰¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gouda-witgoedservice.nl	Witgoedservice Gouda	The website Witgoedservice Gouda provides repair and installation services for household appliances, including washing machines, dryers, dishwashers and refrigerators, with a three-month warranty. The website also facilitates the reporting of malfunctions and communication with the service.	Repair → Mobile Phone Repair ¹⁰¹² Repair → Household Appliances ¹²²⁶	appliance ⁹⁵⁶ warranty ⁴⁷⁰¹ region ⁵⁴¹² installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶	Zuidplas → Moordrecht ³³²
jolandeuitbeijerse.nl	Erasmus University Rotterdam	This website presents the research themes of Jolande uit Beijerse, a researcher and lecturer at the Erasmus University Rotterdam, focusing on youth criminal justice and judicial youth interventions.	Law → Criminal Law ¹⁸⁰³ Human Resources → Personnel Policy ⁴⁶	intervention ²⁸³ legislation ⁵⁹³ society ¹³⁷⁶ research ⁸⁹⁶⁷ education ¹³⁴⁷¹	Krimpenerwaard → Stolwijk ²³²
247taxiutrecht.nl	247 Taxi Utrecht	The 247 Taxi Utrecht website provides a taxi service in the Utrecht region, particularly for trips to and from airports and other destinations. The site aims for an affordable price and easy booking.	Taxi → Regional Taxis ⁸⁶	airport ⁷⁸⁹ ride ¹⁰⁷⁵ taxi ²⁰⁹⁰ rate ²⁶⁰⁶ book ¹¹³⁹⁶	Vijfheerenlanden → Vianen ⁷⁰⁷
bo-bestrating.nl	Bo’s Bestrating	Bo’s Bestrating is a company offering paving and garden design services in the province of South Holland.	Garden Maintenance → Gardeners ⁶⁸⁵ Garden → Paving ¹⁰⁰³	streetwork ¹¹² fence ¹⁸¹⁴ paving ¹⁹⁴²	Krimpenerwaard → Bergambacht ³⁰³
opslagbijdeboer.nl	Opslagbijdeboer.nl	Opslagbijdeboer.nl offers affordable storage space in and around Bergambacht, with flexible rental terms and a personal approach.	Logistics → Storage ¹¹⁷⁰	flexibility ⁹⁹⁶ storage ²⁴⁴⁶ rental ⁷²⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
e-chopperkrimpenerwaard.nl	E-chopper rental Krimpenerwaard	The website, E-chopper rental Krimpenerwaard, offers the opportunity to rent e-scooters and fatbikes in the Krimpenerwaard, with a focus on green and relaxing tours.	Electric Vehicles → Electric Scooters ¹⁰⁸ Tourism → Regional Tourism ²⁴²	e-scooter ⁵³ scooter ¹²³⁶ reservation ³³⁷³ route ³⁴²⁵	Krimpenerwaard → Bergambacht ³⁰³
fysiotherapiepraktijk-schoonhoven.nl	Fysiotherapiepraktijk Mourits-Verlegh	The website of Fysiotherapiepraktijk Mourits-Verlegh in Schoonhoven provides information about the physiotherapy treatments offered, including physiotherapy and edema therapy, and provides contact details for clients.	Dermatology → Skin Therapy ⁶⁶¹ Specialty Medicine → Edema Therapy ²²	edema therapy ¹⁸⁶ therapist ¹⁸⁹⁰ physiotherapy ⁴⁶⁸⁸ complaint ⁶⁴⁷⁹ practice ⁹⁰⁸⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
schoonmaakbedrijfperkouw.nl	Perkouws schoonmaakbedrijf	Perkouws Cleaning Company is a cleaning company that offers services in the Netherlands.	Building & Construction → Exterior ¹¹⁴	solar ¹³² staircase ⁴⁵⁴ window ²⁰³⁰ office ²⁸⁹⁸ cleaning ⁴⁵⁶⁷ floor ⁴⁷⁸¹	Krimpenerwaard → Berkenwoude ⁶²
capelleaandenijssel-elektricien.nl	K.A. Techniek	The website of K.A. Techniek is an electrical contractor offering services in Capelle Aan Den IJssel and surrounding areas.	Lighting & Electrical → Utilities ³⁸⁸ Energy → Electricity ⁷¹²	power outage ⁸⁴ electrical panel ¹⁵³ electrician ⁸¹⁹ inspection ⁴²⁷⁹ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	Lansingerland → Bergschenhoek ⁵⁶⁸
visserswaterwerken.nl	Aannemingsbedrijf Vissers B.V.	Aannemingsbedrijf Vissers B.V. is a water construction company with over 50 years of experience providing various services.	Nature → Waterways ¹⁶¹ Civil & Infrastructure → Waterway Construction ⁴⁵	pontoon ⁴⁶ waterworks ¹⁰⁰ bridge ⁵⁵⁷ stair ⁸¹⁵ locks ⁹⁵³ ship ⁵¹⁰³	Veere → Domburg ³⁶⁸
holistic-harmony.nl	Holistic Harmony	The website of Holistic Harmony is a naturopathic therapy practice located in Bergambacht, Krimpenerwaard, offering holistic treatments.	Alternative Medicine → Naturopathy ¹⁰⁹⁷	haptonomy ¹²¹ drainage ¹³²² energy ⁹⁰⁷⁵	Krimpenerwaard → Bergambacht ³⁰³
rttransport.nl	R&T Transport B.V.	The website of R&T Transport describes a family-owned transport company offering services throughout Europe, with a focus on flexibility and supporting various clients.	Construction Machinery → Crane Rental ¹³⁵	transport service ¹⁸ fleet ¹³⁵¹ truck ¹⁴¹² trailer ¹⁶²⁴ transport ⁶¹⁰⁵	Krimpenerwaard → Bergambacht ³⁰³
heemskerkfamilierecht.nl	Heemskerk Familierecht & Nalatenschappen	The website of Heemskerk Familierecht & Nalatenschappen provides personalized legal guidance and advice on wills, estates, estate planning, inheritance tax reporting, and long-term care legislation.	Inheritance Law → Wills ²⁰⁰	estate planning ⁹³ will ⁵¹⁰ estate ¹⁰⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
ontstoppingsbedrijf-ridderkerk.nl	Ontstoppingsbedrijf Ridderkerk	Ontstoppingsbedrijf Ridderkerk provides professional unclogging services and plumbing services in the Ridderkerk region and surrounding areas.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	unclogging service ³⁰ pipe ⁶⁹⁵ drain ⁸⁸⁶ problem ²²¹⁴	Molenlanden → Kinderdijk ¹⁵⁸
schijfdata.nl	SchijfData.nl	The website SchijfData.nl offers data recovery, computer upgrade, and data destruction services, primarily in the region of Gouda and Bodegraven-Reeuwijk.	IT → Data Recovery ¹⁹	data destruction ⁴³ data recovery ⁸⁴ drive ⁴²⁸ backup ⁴⁹⁴	Krimpenerwaard → Bergambacht ³⁰³
formaatplus.nl	Formaat Plus Reclame Projecten bv	Formaat Plus Reclame Projecten is a full-service advertising agency providing solutions for internal and external advertising campaigns.	Creative & Design Services → Advertising ²⁴⁵² Marketing & Branding → Self-Employment ³⁵	execution ⁴²⁶ advertising ²³⁰² communication ¹⁰¹⁶²	Krimpenerwaard → Gouderak ¹⁰³
onlineadministratieverzekerd.nl	Administratieverzekerd	Administratie verzekerd provides assistance with administration, e-bookkeeping, and advice on insurance.	Accounting → Bookkeeping ¹²³⁰	bookkeeping ¹³¹⁹ insurance ⁶³⁵⁹ administration ⁶⁵⁸⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tsadministratievedienstverlening.nl	TS Administratieve Dienstverlening	TS Administrative Services provides administrative services to businesses, startups, and individuals.	Startup & Innovation → Startups ⁴³³ Vocational Training → MBO ⁶⁹⁰	diploma ⁷⁹⁵ payroll ¹⁸²³ account ⁵⁷⁸¹ administration ⁶⁵⁸⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vlamboyantcv.nl	Vlamboyant cv-keteltechniek	Vlamboyant cv-keteltechniek is an installation company specializing in central heating boilers and gas heaters.	Emergency Services → Fire Department ¹³⁸ Home → Installation & Repair ³²⁴¹	emergency service ³⁷² boiler ¹²⁴⁰ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
takretadeluxe.nl	T.A. Kreta Deluxe	T.A. Kreta Deluxe is a construction and renovation company based in the Netherlands.	Plastics → Plastics Processing ¹⁵⁴	plastic ¹²³² construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	The Hague → City Center ⁴⁴⁵
verkuilkaas.nl	Verkuil Kaashandel V.O.F.	The website of Verkuil Cheese Shop presents weekly offers of cheese, nuts, and other treats, and provides information about the locations where the cheese shop can be found.	Dairy → Cheese ⁵³⁰ Produce & Vegetables → Vegetables ¹⁰⁷⁰	vacuum ⁹⁵ nuts ⁴¹⁷ cheese ¹²⁰⁵ market ²⁷⁷²	Krimpenerwaard → Bergambacht ³⁰³
lb-sporthorses.nl	Lizzy Bulham Sporthorses	Lizzy Bulham Sporthorses is a website that facilitates the purchase and sale of sport horses, along with saddling and training services.	Equestrian → Dressage ¹⁷⁹ Animals → Horses ¹⁴⁵⁵	saddle ³⁶⁴ stable ⁷⁶⁸ horse ⁴³³⁷ sale ⁵⁹³⁰ training ²⁸¹³³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
gimenoadministraties.nl	Gimeno Administraties	Gimeno Administraties is an administrative company offering accounting, financial, and tax services to individuals, small and medium-sized businesses, corporations, and real estate investors.	Business Software → Accounting Software ⁹⁸⁴ Administration → Secretarial Services ⁸⁵¹	fiscal ³² tax ²¹⁰⁰ administration ⁶⁵⁸⁷	Krimpenerwaard → Lekkerkerk ²⁴⁴
reparatiecentrale-witgoed-gouda.nl	ReparatieCentrale Witgoed Gouda	The website of ReparatieCentrale Witgoed Gouda offers professional repair and installation services for household appliances, including washing machines, dryers and dishwashers, in and around Gouda.	Household Appliances → White Goods ¹³²	dryer ²⁰³ dishwasher ³²⁴ washing machine ⁴⁸⁷ diagnosis ¹⁴⁹⁰ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶	Zuidplas → Moordrecht ³³²
smartphonereparatiesdenhaag.nl	Smartphone Repair The Hague	The website offers smartphone and tablet repair services in and around The Hague.	Electronics & Components → Mobile Phones ¹¹⁸⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ part ⁵⁰⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Wassenaar → Duindigt ¹⁵
mgraveland.nl	M. Graveland Bouw	M. Graveland Bouw is a construction company specializing in new construction, renovation, insulation, and carpentry work, with a focus on concrete construction and monolithic floors.	Building & Materials → Concrete ³⁹⁰ Insulation & Glazing → Insulation ¹⁵⁴³	concrete construction ²⁴ carpentry ²²¹⁸ insulation ²⁴⁴⁸ new construction ²⁶⁷² renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
boonstoppel-edelmetaal.nl	Boonstoppel BV	The website of Boonstoppel presents an old family business specializing in handcrafted metalwork, including restoration, gilding, silvering, and galvanizing techniques.	Metalworking → Surface Treatment ¹⁷³	galvanizing ³⁶ objects ⁴²⁶ silver ⁴⁷⁹ metal ¹⁰⁹⁰ craftsmanship ¹⁸⁵⁸ restoration ³⁴¹⁷	Krimpenerwaard → Schoonhoven ⁵⁴⁴
uitvaartbergambacht.nl	Uitvaart Bergambacht	Uitvaart Bergambacht is an end-of-life care provider in Bergambacht that arranges and cares for complete funerals.	Funeral Services → Funeral Arrangement ⁴⁸⁶	undertaker ²⁸ burial ⁴⁰⁶ cremation ⁶¹⁵ farewell ¹¹⁰⁹ funeral ²⁴⁷⁷	Krimpenerwaard → Bergambacht ³⁰³
electrocontrol.nl	Electrocontrol	Electrocontrol is an electrical engineering company that provides services for installations, repairs, and inspections in the Krimpenerwaard region.	Installation & Repair → Climate Installation ²⁴⁹	control technology ⁷⁹ alarm system ⁴⁹⁵ inspection ⁴²⁷⁹ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
huismanbouwentimmerwerken.nl	Huisman Bouw- en Timmerwerken	Huisman Bouw- en Timmerwerken is a construction and carpentry company based in Lekkerkerk, Netherlands, that offers renovation and building services in the surrounding area.	Building & Materials → Carpentry & Joinery ⁸³⁰	carpentry ²²¹⁸ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
dehollandscheijssel.nl	Van Schaik Grafimedia	The website presents and sells the photo book ‘De Hollandsche IJssel’ by Johan Nebbeling, a collection of photos of the Hollandsche IJssel.	Books → Publishers ¹⁰⁴⁰ Image Products → Photo Books ¹⁶	photo book ¹³⁵ bookstore ¹⁴⁹ region ⁵⁴¹² photo ⁷⁷⁷⁸	Zuidplas → Moerkapelle ²¹³
basvanderwouden.nl	Van der Wouden drainage and garden construction	The website of Van der Wouden drainage and garden construction is a specialized service provider focusing on drainage services, drainage techniques, unclogging, inspections, garden renovation, and landscaping, with a focus on the Krimpenerwaard region.	Plumbing → Drainage ⁵⁷⁰ Landscaping → Garden Installation ⁶¹⁷	garden construction ⁸⁶ unclogging ²⁴⁴ drainage ¹³²² paving ¹⁹⁴² inspection ⁴²⁷⁹
bbpolderzicht.nl	Bed & Breakfast Polderzicht	Bed & Breakfast Polderzicht is a renovated farmhouse barn near Rotterdam offering comfortable stays with six B&B rooms and breakfast.	Accommodation → Breakfast ³⁶⁴ Accommodation → Beds ²²⁸	polder ⁴⁷⁶ view ¹⁰⁴⁵ b&b ¹⁰⁶⁰ bike ¹⁵⁴¹ breakfast ¹⁸²² room ³⁴¹¹	Krimpenerwaard → Lekkerkerk ²⁴⁴
paso-geluidsinstallaties.nl	Vodavi bv	Paso Geluids- & Omroepinstallaties offers installation and supply of audio and broadcast equipment, as well as emergency evacuation systems, with a focus on quality and good value for money.	Technology → Audiovisual & Media ⁶⁸⁸ Technology → Smart Home & Automation ¹¹⁴⁶	evacuation system ¹¹ audio system ⁴⁰	Krimpenerwaard → Bergambacht ³⁰³
pieterkokdienstverlening.nl	Pieter Kok dienstverlening	Pieter Kok dienstverlening is an administrative service provider with 35 years of experience, specializing in the non-profit sector.	Administration → Secretarial Services ⁸⁵¹ Government & Legal → Tax ¹³²²	administrative services ⁸⁶ annual financial statement ¹²⁵ budget ¹³³⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
tonspek-specialparts.nl	Ton Spek Special Parts	The website of Ton Spek Special Parts showcases the company's services, primarily the development and machining of parts for motorcycles, particularly Suzuki RGB 500 models, and the realization of projects for various brands such as Honda.	Metalworking → Milling ⁴²⁶	cad/cam ⁴¹ cnc machining ⁵⁶ 3d printing ³³² part ⁵⁰⁴⁴	Krimpenerwaard → Haastrecht ¹⁹³
vanderzwaal.nl	Van der Zwaal B.V.	The website of Vanderzwaal.nl offers educational pathways and support to educational institutions, focused on improving processes, preventing early school leaving, and addressing teacher shortages.	Special Needs & Support → Support Education ²³⁴ Research & Academia → Educational Development ³⁵⁴	career orientation ¹⁴ project leadership ⁸⁵ process guidance ⁸⁶ pathway ⁴⁴⁷ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Bergambacht ³⁰³
vdkservice.nl	VDKService.nl	The VDKService.nl website is a resource for glass work services in the Krimpenerwaard and surrounding area, offering a professional and independent service for glass projects, from advice to installation and maintenance.	Insulation → Glazing ¹⁸⁸ Insulation & Glazing → Glasswork ¹⁸⁷	glass ²⁹¹⁹ quote ¹²⁸⁶³ maintenance ²⁰⁰⁹³
itsmetimebeauty.nl	It’s me time!	The website of ‘It’s me time!’ is a beauty salon offering various skin-enhancing treatments, nail treatments, and eyebrow/eyelash care.	Salon & Treatment Centers → Beauty Centers ⁶³¹	nail treatment ²³⁰ facials ³⁰² eyelash ³⁵⁴ skin analysis ³⁶¹ eyebrows ¹¹²⁷ appointment ¹³⁵¹⁰	Krimpenerwaard → Stolwijk ²³²
bedrijfsuitjeschiedam.nl	Bedrijfsuitjes Schiedam	The website bedrijfsuitjeschiedam.nl offers a wide range of corporate outings and team activities in Schiedam and the surrounding region, focused on organizing memorable staff outings and team-building events.	Corporate Events → Corporate Outings ⁸⁷⁸ Tourism → City Tours ⁴⁶⁸	city game ⁸¹ corporate outing ³⁸⁸ quiz ⁷¹⁰ app ⁴⁵⁹⁵ restaurant ¹¹²¹⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
hoveniersbedrijfweltevree.nl	Hoveniersbedrijf Weltevree	Hoveniersbedrijf Weltevree is a landscaping company specializing in garden maintenance, ranging from garden design and construction to ground work and property boundaries.	Garden → Fences ⁸²⁴ Environment → Environmental Technology ⁷¹²	property boundary ¹⁰ garden maintenance ⁴⁶² garden design ⁹⁶⁴ groundwork ¹³⁴⁸ portfolio ⁶⁸⁵⁴	De Fryske Marren → Echtenerbrug ²⁴
woodandi.nl	Wood & I	Wood & I is an online shop that offers handcrafted wooden gifts and decorations.	Gifts & Souvenirs → Gift Items ³⁴² Gifts & Souvenirs → Gift Boxes ⁷⁸	board ³⁴³⁸ wood ⁴¹⁵³ gift ⁶⁴⁴² shop ⁶⁴⁸³	Krimpenerwaard → Stolwijk ²³²
autopoetsschoonhoven.nl	Autopoets Schoonhoven	The website of Autopoets Schoonhoven offers professional car washing and car care services in the Schoonhoven area. The website presents various cleaning packages and offers an appointment module.	Car Care & Detailing → Detailing ⁹⁴¹ Maintenance & Services → Car Wash ⁴⁹⁵	spotrepair ⁶⁷ exterior ²³⁷ package ⁶¹¹² interior ⁸⁰⁹³ car ¹⁰⁸⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
influencerblog.nl	Influencerblog.nl	The website Influencerblog.nl collects information about influencers and their news.	Blogs & Publications → Press Releases ⁷³¹ Internet → Entertainment ⁶⁵	influencer ¹⁴⁹ youtube ⁴⁸⁶ politics ¹²⁵⁹ car ¹⁰⁸⁶⁵ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
buinails.nl	Bui Nails & Spa	Bui Nails & Spa is a nail studio offering manicure, pedicure, acrylic nails, gel nails, and gel polish.	Makeup → Makeup Artists ⁷³³	nail stylist ¹¹³ gel polish ³⁸⁶ manicure ⁷⁰¹ confidence ¹¹⁶³ studio ⁵⁴⁶⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jaapvermeulen.nl	Timmer- en Aannemingsbedrijf Jaap Vermeulen	Timmer- en Aannemingsbedrijf Jaap Vermeulen is a construction company offering various building projects, from renovations to new builds, with a customer-focused approach.	Construction Companies → Construction Contractors ⁵³⁶ Building & Materials → Carpentry & Joinery ⁸³⁰	extension ¹⁹⁴¹ carpentry ²²¹⁸ new construction ²⁶⁷² renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
muziekschoolpetervogel.nl	Muziekschool Peter Vogel	Muziekschool Peter Vogel provides music lessons in various locations within the Alblasserwaard region.	Education & Training → Instrument Lessons ¹⁶⁸ Music Education → Music Schools ³⁶⁷	ukulele ⁶⁴ music school ¹¹⁵ keyboard ²³⁷ guitar lesson ³⁰⁶ music lesson ⁴⁶⁷ piano ⁸²⁰	Molenlanden → Wijngaarden ³⁴
crystalhealinghands.nl	Crystal Healing Hands	The website of Crystal Healing Hands presents the services of André Hoogenboom, a craniosacral and holistic massage therapist, who utilizes energy transfer and various therapeutic forms to support people in their personal growth.	Coaching → Spiritual Coaching ⁷⁴³ Alternative Medicine → Energy Medicine ⁹⁸⁸	growth process ¹¹ life energy ⁶⁰ blockage ⁹⁶⁵ therapy ⁷⁴⁴⁸ massage ⁷⁶⁴⁶ energy ⁹⁰⁷⁵	Krimpenerwaard → Haastrecht ¹⁹³
detoren-schoonhoven.nl	The Toren Schoonhoven	The Toren Schoonhoven offers office and meeting spaces for rent in a representative business building in Schoonhoven.	Real Estate → Commercial Property ¹⁸⁴⁰ Office & Workspace → Office Space ¹²⁹²	business building ²⁷ office building ⁵¹ meeting space ²⁰⁰ office space ⁷⁷³ parking ¹⁹²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
irmahaarenhuidsalon.nl	Kapsalon Irma	Kapsalon Irma offers a wide range of hair services, including haircuts, coloring, styling, perms, bridal hairstyles, and beard styling for men, with additional services like pedicures and beauty treatments.	Dermatology → Scalp Care ⁴⁰² Hair Education → Hair Color ¹⁶³	bridal hairstyle ¹³³ hair products ³⁰¹ haircare ⁴⁶⁹ hair salon ⁷¹⁷ styling ²³³¹ color ⁴¹⁵⁹	Krimpenerwaard → Berkenwoude ⁶²
twandetuinman.nl	Twan de Tuinman	The website of Twan de Tuinman is a platform for garden design, garden construction, and garden maintenance, focused on the Schoonhoven region and surroundings.	Garden Maintenance → Garden Landscaping ⁷¹¹ Garden → Garden Structures ³⁰⁹	flower box ⁴⁴ garden construction ⁸⁶ garden maintenance ⁴⁶² garden design ⁹⁶⁴ paving ¹⁹⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
everest-techniek.nl	Everest Techniek	Everest Techniek Schoonhoven is a service provider offering technical support, inspections, and project management to installation companies and system integrators.	Networking → Network Installation ¹³⁰ Security → Security Systems ⁹⁷¹	security system ²¹² capacity ²⁸² project management ³⁴²³ installation ¹³⁷⁴²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
vijzelbedrijfvandam.nl	Vijzelbedrijf Van Dam	Vijzelbedrijf Van Dam is a company specializing in the straightening of leaning buildings.	Garden → Garden Sheds ⁴⁰⁰	shed ⁶³⁰ buildings ⁸⁹⁸ home ⁷⁹⁷⁶	Garmerwolde → Lageweg ¹²
projectburoinca.nl	Projectburo INCA	Projectburo INCA is an organization that provides specialized support for projects and courses, particularly focused on technical training and educational organizations.	Management & Consulting → Consulting ²¹²⁷ Human Resources → Employee Development ⁷⁶²	realization ²³² learning ⁹²⁰ education ¹³⁴⁷¹ course ¹⁴⁷²⁸	Krimpenerwaard → Stolwijk ²³²
iwslopik.nl	IWS Lopik	The website of IWS Lopik showcases the services of a comprehensive installation company specializing in electrical engineering, plumbing, and central heating, and operating in the Lopikerwaard region.	Heating → CV Boilers ¹⁶⁷	installation company ¹⁰⁰ central heating ¹⁹⁰ electrical engineering ⁸¹⁷ plumbing ¹⁷⁶¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
mkb-data.nl	MKB Data	MKB Data Home offers practical data solutions and reporting dashboards aimed at the SMB and freelance sectors.	Legal & Administration → Business Support ⁴⁸⁸ Information Technology → Data Management ⁸²⁷	dashboard ¹³⁷⁴ report ⁴⁵⁵¹ data ⁵⁸⁷²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
imkerij-bijman.nl	Imkerij Bijman	The website of Imkerij Bijman (Lopik) provides information about the beekeeping operation, its products (honey, beeswax candles, propolis), and sales points, as well as services for capturing bee swarms in the region.	Agriculture → Beekeeping ²²⁹ Nature → Insects ²²⁸	propolis ⁵¹ beeswax ⁶⁶ sales points ⁸⁸ bees ³⁷³ honey ⁴³²	Lopik → Cabauw ¹⁸
kentie-bv.nl	Kentie B.V.	The website of Kentie B.V. showcases the company’s services, specializing in the heaving of steel pipe piles for various indoor and outdoor projects, with a focus on vibration-free heaving and mini-heaving work.	Garden → Paving ¹⁰⁰³ Construction Technology → Foundation Technology ¹³⁵	paving ¹⁹⁴²	Krimpenerwaard → Lekkerkerk ²⁴⁴
utrecht.remonstranten.nl	Evangelisch Lutherse gemeente Geertekerk Utrecht (RGU)	The Geertekerk Utrecht website provides information about the community, its services, activities, and events, as well as rental opportunities and contact details.	Protestantism → Churches ¹⁰⁰⁹ Protestantism → Lutheran Churches ¹⁷	diaconate ¹⁸² church service ⁸⁷⁹ community ⁷⁹³¹ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
scholen.ihub.nl	iHub onderwijs	iHub onderwijs is an organization focused on providing appropriate educational support and guidance to children with diverse needs.	Social Issues & Welfare → Youth Services ³¹³	family care ¹⁵ foster care ⁷⁰ parent ⁴³¹⁸ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Rotterdam → Hoogvliet ⁵¹⁶
shop.workinstyle.nl	Voetbalshop Roosendaal	This website is an online sports store offering a wide range of sports equipment and apparel, with online sales and delivery services.	Associations → Sports Associations ¹⁰⁸² Shopping → Sports Stores ¹⁴²	sports clubs ⁸⁴ shopping cart ¹⁵²¹ account ⁵⁷⁸¹ webshop ⁸⁶⁴⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
krimpenaandenijssel.vvd.nl	VVD Krimpen aan den IJssel	The website of the VVD Krimpen aan den IJssel presents news, positions, and events related to local politics in Krimpen aan den IJssel.	Local Politics → Parties ⁶²² Local Politics → Political Parties ⁸⁹⁸	council ⁴²⁶ position ⁸⁷⁵ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
campagne.zorgpartners.nl	Zorgpartners Midden-Holland	Zorgpartners Midden-Holland is a care organization providing care for elderly individuals with dementia, brain injuries, or physical limitations, both in traditional and innovative settings.	Neurology → Dementia ⁵⁰⁹ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	colleague ³⁷⁸ home care ⁸²⁷ home ⁷⁹⁷⁶ care ¹²³³⁸	Alphen aan den Rijn → Boskoop ⁶⁵²
eijk.echtebakker.nl	Arjan van der Eijk, De Echte Bakker	The website of ‘De Echte Bakker’ is an online shop and a presentation of a bakery with locations in Gouda, Bergambacht and Haastrecht, which sells and delivers artisan bread and baked goods.	Dairy → Cheese ⁵³⁰	specialty ²²⁹ bakery ⁷¹⁸ bread ¹⁶²² webshop ⁸⁶⁴⁸	Krimpenerwaard → Bergambacht ³⁰³
keuren.zilver.nl	Zilver.nl	The Zilverkeuren website is a database that collects information about Dutch silver hallmarks (zilverkeuren) and English import hallmarks from the period of 1600 to present. The aim is to help collectors and historians identify and research silver.	Jewelry → Silver ¹⁰⁰ Resources → Databases ³⁴⁸	silversmith ¹¹ hallmark ²³ database ¹¹⁵³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
newbornplaza.ollieschool.nl	Brenda Olie	Newborn Plaza is an educational event focused on birth, newborn, baby, and pregnancy photography.	Arts → Imaging & Photography ⁷⁶⁸⁷	speaker ¹⁴⁸¹ shop ⁶⁴⁸³ photography ⁹⁵⁰³ workshop ¹⁹³²⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Berkenwoude ⁶²
smartphonereparatiedordrecht.nl	Smartphone Reparatie Dordrecht	The website provides smartphone and tablet repair services in Dordrecht and surrounding areas.	Mobile Phone Repair → Electronic Devices ¹¹⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
vermeulenklusbedrijf.jouwweb.nl	Dave Vermeulen Aanneembedrijf	The website of Dave Vermeulen Aanneembedrijf showcases the company’s services in the areas of skylights, extensions and construction, focusing on quality, speed and customer satisfaction.	Roofing → Skylights ⁴⁷¹ Construction Companies → Additions ⁴⁵⁸	plastic frames ⁹⁵ skylight ⁹⁶⁶ extension ¹⁹⁴¹ foundation ⁶⁶⁷⁸	Krimpenerwaard → Haastrecht ¹⁹³
schoonhovenoutdoor.nl	Schoonhoven Outdoor	Schoonhoven Outdoor is a specialist in outdoor styling and garden design, offering a wide range of garden materials, advice, and installation services.	Essential → Home ⁷⁰⁷⁰⁸	garden ¹³¹²⁹ design ²⁷²⁰²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
salonshades.nl	SALON SHADES	The website of SALON SHADES is a modern salon in Gouderak specializing in highlights, balayage coloring, cutting, and styling. The aim is to provide clients with personalized attention and to refresh or maintain their style.	Hair Care → Salons ¹⁴⁷⁶	balayage ⁸³ highlights ¹⁰⁹ style ²³⁴⁸ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Krimpenerwaard → Gouderak ¹⁰³
stadavontuur.nl	Stadsavonturen	Stadsavonturen is a company that organizes corporate outings and city walks in various cities of the Netherlands.	Corporate Events → Corporate Outings ⁸⁷⁸	city walk ¹³⁰ corporate outing ³⁸⁸ dinner ¹⁵³³ theater ²⁵⁴⁴	Bronckhorst → Vorden ⁴¹⁶

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.